Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "weird error"
-
Yesterday, in a meeting with project stakeholders and a dev was demoing his software when an un-handled exception occurred, causing the app to crash.
Dev: “Oh..that’s weird. Doesn’t do that on my machine. Better look at the log”
- Dev looks at the log and sees the exception was a divide by zero error.
Dev: “Ohhh…yea…the average price calculation, it’s a bug in the database.”
<I burst out laughing>
Me: “That’s funny.”
<Dev manager was not laughing>
DevMgr: “What’s funny about bugs in the database?”
Me: “Divide by zero exceptions are not an indication of a data error, it’s a bug in the code.”
Dev: “Uhh…how so? The price factor is zero, which comes from a table, so that’s a bug in the database”
Me: “Jim, will you have sales with a price factor of zero?”
StakeholderJim: “Yea, for add-on items that we’re not putting on sale. Hats, gloves, things like that.”
Dev: “Steve, did anyone tell you the factor could be zero?”
DBA-Steve: “Uh...no…just that the value couldn’t be null. You guys can put whatever you want.”
DevMgr: “So, how will you fix this bug?”
DBA-Steve: “Bug? …oh…um…I guess I could default the value to 1.”
Dev: “What if the user types in a zero? Can you switch it to a 1?”
Me: “Or you check the factor value before you try to divide. That will fix the exception and Steve won’t have to do anything.”
<awkward couple of seconds of silence>
DevMgr: “Lets wrap this up. Steve, go ahead and make the necessary database changes to make sure the factor is never zero.”
StakeholderJim: “That doesn’t sound right. Add-on items should never have a factor. A value of 1 could screw up the average.”
Dev: “Don’t worry, we’ll know the difference.”
<everyone seems happy and leaves the meeting>
I completely lost any sort of brain power to say anything after Dev said that. All the little voices kept saying were ‘WTF? WTF just happened? No really…W T F just happened!?’ over and over. I still have no idea on how to articulate to anyone with any sort of sense about what happened. Thanks DevRant for letting me rant.15 -
Had to debug an issue,
*ssh user@domain*
"some wild network connection issue"
*hmm weird.. *
*checks everything again*
*hmm seems alright.. *
*tries again*
*same damn error*
*ssh -v user@domain*
*syntax error thingy on the -v part*
😮
*messages co-worker asking what the fuck could be giving on*
"ey mate check your aliases 😂"
*alias"
"alias ssh="echo {insert network connection issue"*
*loud laughing from the co-worker I messaged*
MOTHERFUCKER 😆15 -
That weird moment when you get an error "please contact your administrator" and then you realize that you are the administrator..4
-
Its that time of the morning again where I get nothing done and moan about the past ... thats right its practiseSafeHex's most incompetent co-worker!!!
Today I'd like to tell you the story of "i". Interesting about "I" is that he was actually a colleague of yesterdays nominee "G" (and was present at the "java interface" video call, and agreed with G!): https://devrant.com/rants/1152317/...
"I" was the spearhead of a project to end all projects in that company. It was suppose to be a cross-platform thing but ended up only working for iOS. It was actually quite similar to this: https://jasonette.com/ (so similar i'm convinced G / I were part of this but I can't find their github ID's in it).
To briefly explain the above + what they built ... this is the worst piece of shit you can imagine ... and thats a pretty strong statement looking back at the rest of this series so far!
"I" thought this would solve all of our problems of having to build similar-ish apps for multiple customers by letting us re-use more code / UI across apps. His main solution, was every developers favourite part of writing code. I mean how often do you sit back and say:
"God damn I wish more of this development revolved around passing strings back and forth. Screw autocomplete, enums and typed classes / variables, I want more code / variables inside strings in this library!"
Yes thats right, the main part of this bullshittery was putting your entire app, into JSON, into a string and downloading it over http ... what could possibly go wrong!
Some of my issues were:
- Everything was a string, meaning we had no autocomplete. Every type and property had to be remembered and spelled perfectly.
- Everything was a string so we had no way to cmd + click / ctrl + click something to see somethings definition.
- Everything was a string so any business logic methods had to be remembered, all possible overloaded versions, no hints at param types no nothing.
- There was no specific tooling for any of this, it was literally open up xcode, create a json file and start writing strings.
- We couldn't use any of the native UI builders ... cause strings!
- We couldn't use any of the native UI layout constructs and we had to use these god awful custom layout managers, with a weird CSS feel to them.
What angered me a lot was their insistence that "You can download a new app over http and it will update instantly" ... except you can't because you can't download new business logic only UI. So its a new app, but must do 100% exactly the same thing as before.
His other achievements include:
- Deciding he didn't like apple's viewController and navigationBar classes and built his own, which was great when iOS 7 was released (changed the UI to allow drawing under the status bar) and we had no access to any of apples new code or methods, meaning everything had to be re-built from scratch.
- On my first week, my manager noticed he fucked up the login error handling on the app I was taking over. He noticed this as I was about to leave for the evening. I stayed so we could call him (he was in an earlier timezone). Rather than deal with his fucked up, he convinced the manager it would be a "great learning experience" for me to do it ... and stay in late ... while he goes home early.
- He once argued with me in front of the CEO, that his frankenstein cross-platform stuff was the right choice and that my way of using apples storyboards (and well thought out code) wasn't appropriate. So I challenged him to prove it, we got 2 clients who needed similar apps, we each did it our own way. He went 8 man weeks over, I came in 2 days under and his got slated in the app store for poor performance / issues. #result.
But rather than let it die he practically sucked off the CEO to let him improve the cross platform tooling instead.
... in that office you couldn't swing a cat without hitting a retard.
Having had to spend a lot more time working with him and more closely than most of the other nominees, at a minimum "I" is on the top of my list for needing a good punch in the face. Not for being an idiot (which he is), not for ruining so much (which he did), but for just being such an arrogant bastard about it all, despite constant failure.
Will "I" make it to most incompetent? Theres some pretty stiff competition so far
Tune in later for more practiceSafeHex's most incompetent co-worker!!!6 -
First thing this morning I heard my boss had taken some PSDs to a client today. I thought it was a bit weird because he doesn't have a laptop. Midday I got a call to say all my PSDs were corrupted:
"I'm with the client now. We're very unhappy, we can't get your files to open."
"Oh, right. They should be fine. What version of Photoshop are you using?"
"The latest."
"Okay, what's the error?"
"There isn't one."
"Okay, so it's freezing?"
"No, we can't see the files at all."
"Which laptop are you using?"
"The Nexus."
"The what?"
"That tablet thing."
So after about 20 minutes we figured out he's copied the PSDs and a shortcut to Photoshop on to a USB stick. Then plugged the USB into a USB to micro USB cable and stuck that in an Android Nexus. Expecting to open Photoshop.exe and the PSDs.
I don't mind people being confused with technology but when it's your own boss, who doesn't even bother to let you know anything, then phones up and tells you off you just want to strangle him.16 -
Storytime!
This customer comes in and practically throws a computer on the counter.
Customer: This computer isn't working. I've ran the diagnostics and it says it's software. *places a dvd case with a 32 bit Windows 7 disk in it on the counter* It had Windows 10 on it, but I want Windows 7 on it.
Me: Well, you may have issues with the drivers if you put Windows 7 on it--
Customer: I don't care, I just want Windows 7.
Me: You SHOULD care. That means no wifi, no display, no mouse... Windows 7 doesn't like Windows 10 hardware.
Customer: Then... check to see Windows 7 compatibility!
Me: Alright.... *makes notes to check for Windows 7 compatibility*
Me: So has this Windows 7 been used before?
Customer: Yes, it has.
Me: On how many computers?
Customer: I've installed it on two computers and it works just fine.
Me: That's weird because Windows license keys are for one computer only. Are both of them connected to the internet?
Customer: Yes.
Me: Well, okay then... *finishes up ticket*
Customer: I work in this field and I just don't understand why they don't come with the disks anymore. How much is a Windows 10 disk?
Me: *gives price*
Customer: And do you have any?
Me: Let me check *I go to where they are, find some and come back out*
Me: Unfortunately we're out at the moment and would have to special order some back in.
Customer: OK. So then how much to fix this computer?
Me: *price of installing Windows and backing up data*
Customer: That's halfway to the price of a new one of these!
Me: Well yes, an HP at Walmart... But you do have that option if you want to take it.
Customer: Well, why does it cost that much?
Me: Well, it's $labor1 to install Windows, $labor2 to do some basic setup and drivers, and $labor3 to backup and restore data.
Customer: Oh, well I don't want data.
Me: Okay, well then it would be $total - $labor3
Customer: ...Okay, fine
Me: *updates the ticket*
When she finally left I put it on the bench and the first message said "SMART ERROR." I then did 4 different tests that said "lol, the hard drive is failing."
If you "worked in this field," you would know that a SMART error is hard drive related.
If you worked in this field, you would know that Windows is only a 1PC license, so why are you lying about installing it with no issues on other computers?
If you worked in this field, you would know you would want a 64bit Windows on your computer.
If you worked in this field, you would know how to find a Windows 10 installation media online.
If you worked in this field, you would know that HPs are not good computers to get.
IF YOU FUCKING WORKED IN THIS FIELD YOU WOULDN'T BE SUCH A FUCKING CUNT.17 -
The day I send myself about 76k mails
> be me
> be working on a rest api
> implement an error handler that would send me a mail with exception details
> use same error handler in mail send error handler
> Summoned the recursion devil by accident
> Test error handler
> Forgot port forwarding to SMTP server
> keep the debug session open
> throw new UnexpectedInterruptionException()
> get back to work
> Add the missing port forwarding rule to putty
> The error handler starts doing it's thing
> The handler chain starts to pop
> handler after handler executes
> PCFreeze.png
> WhatTheFuckIsGoingOn.gif
> VS finally accepts stop debugging
> PhoneVibrationSpam.mp3
> Peek into webmail
> WowFinallySomeFanMail
> Look into it
> Realizing what I have done
> Delete mailbox
> Remove recursion
> Wow that's how randy must have felt in southpark
> Feel weird
> Shutdown, go outside
> What's up anon?
> Nothing, really
6 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Seven months ago:
===============
Project Manager: - "Guys, we need to make this brand new ProjectX, here are the specs. What do you think?"
Bored Old Lead: - "I was going to resign this week but you've convinced me, this is a challenge, I never worked with this stack, I'm staying! I'll gladly play with this framework I never used before, it seems to work with this libA I can use here and this libB that I can use here! Such fun!"
Project Manager: - "Awesome! I'm counting on you!"
Six months ago:
====================
Cprn: - "So this part you asked me to implement is tons of work due to the way you're using libA. I really don't think we need it here. We could use a more common approach."
Bored Old Lead: - "No, I already rewrote parts of libB to work with libA, we're keeping it. Just do what's needed."
Cprn: - "Really? Oh, I see. It solves this one issue I'm having at least. Did you push the changes upstream?"
Bored Old Lead: - "No, nobody uses it like that, people don't need it."
Cprn: - "Wait... What? Then why did you even *think* about using those two libs together? It makes no sense."
Bored Old Lead: - "Come on, it's a challenge! Read it! Understand it! It'll make you a better coder!"
Four months ago:
==============
Cprn: - "That version of the framework you used is loosing support next month. We really should update."
Bored Old Lead: - "Yeah, we can't. I changed some core framework mechanics and the patches won't work with the new version. I'd have to rewrite these."
Cprn: - "Please do?"
Bored Old Lead: - "Nah, it's a waste of time! We're not updating!"
Three months ago:
===============
Bored Old Lead: - "The code you committed doesn't pass the tests."
Cprn: - "I just run it on my working copy and everything passes."
Bored Old Lead: - "Doesn't work on mine."
Cprn: - "Let me take a look... Ah! Here you go! You've misused these two options in the framework config for your dev environment."
Bored Old Lead: - "No, I had to hack them like that to work with libB."
Cprn: - "But the new framework version already brings everything we need from libB. We could just update and drop it."
Bored Old Lead: - "No! Can't update, remember?"
Last Friday:
=========
Bored Old Lead: - "You need to rewrite these tests. They work really slow. Two hours to pass all."
Cprn: - "What..? How come? I just run them on revision from this morning and all passed in a minute."
Bored Old Lead: - "Pull the changes and try again. I changed few input dataset objects and then copied results from error messages to assertions to make the tests pass and now it takes two hours. I've narrowed it to those weird tests here."
Cprn: - "Yeah, all of those use ORM. Maybe it's something with the model?"
Bored Old Lead: - "No, all is fine with the model. I was just there rewriting the way framework maps data types to accommodate for my new type that's really just an enum but I made it into a special custom object that needs special custom handling in the ORM. I haven't noticed any issues."
Cprn: - "What!? This makes *zero* sense! You're rewriting vendor code and expect everything to just work!? You're using libs that aren't designed to work together in production code because you wanted a challenge!?? And when everything blows up you're blaming my test code that you're feeding with incorrect dataset!??? See you on Monday, I'm going home! *door slam*"
Today:
=====
Project Manager: - "Cprn, Bored Old Lead left on Friday. He said he can't work with you. You're responsible for Project X now."24 -
This just confused me a lot. I thought I knew all songs of this entire album but apparently I didn’t. Found it weird that Spotify would give such an error but still 😆
12 -
Designer: Need to file a bug, I'm not getting an option to login with FaceID
Me: Oh weird bug. Is it setup on the phone you are testing with?
Designer: yes, use it in all other apps
Me: Did you get an error during onboarding on the FaceID screen?
Designer: nope no error
Me: ..... hhhmm, can you show me your settings?
Me: ... eh, says you have FaceID disabled for this app ... did you click "No" to FaceID during onboarding?
Designer: Yes, to test edge cases
Me: ................ ok ........ if you setup the app and told it to not allow FaceID to login ......... you won't get the ability to use FaceID to login .......... like .... by design .... on purpose ...... cause .... you told it to do that
Designer: No no, it needs to have a setting on the login screen to allow me to turn that back on incase I forget my passcode
Me: the fuck it does. Yeah we can't have anything on the login page that says, without authorization, change my settings
*Deep breath*
Me: Remember we had this conversation previously, where you didn't want the user to create a passcode during onboarding as it was too much friction, and wanted to do FaceID only. With your backup plan being to allow the user to create a NEW passcode on the login screen if FaceID failed .... remember that discussion we had about security? ... and how its important? ... and that we like having any? Ok so its the same reason as that, just with a different setting this time
Designer: ... hhmm i'm not sure I like this
Me: ... tough luck then, not happening
Me: oh and btw, remember we had that other talk about reproduction steps for bugs? Like when the app crashed and you told me it was because its in light mode, and nothing else at all? So disabling FaceID, is very relevant info to the problem of "I can't login with FaceID", please tell me these things first11 -
The stupid stories of how I was able to break my schools network just to get better internet, as well as more ridiculous fun. XD
1st year:
It was my freshman year in college. The internet sucked really, really, really badly! Too many people were clearly using it. I had to find another way to remedy this. Upon some further research through Google I found out that one can in fact turn their computer into a router. Now what’s interesting about this network is that it only works with computers by downloading the necessary software that this network provides for you. Some weird software that actually looks through your computer and makes sure it’s ok to be added to the network. Unfortunately, routers can’t download and install that software, thus no internet… but a PC that can be changed into a router itself is a different story. I found that I can download the software check the PC and then turn on my Router feature. Viola, personal fast internet connected directly into the wall. No more sharing a single shitty router!
2nd year:
This was about the year when bitcoin mining was becoming a thing, and everyone was in on it. My shitty computer couldn’t possibly pull off mining for bitcoins. I needed something faster. How I found out that I could use my schools servers was merely an accident.
I had been installing the software on every possible PC I owned, but alas all my PC’s were just not fast enough. I decided to try it on the RDS server. It worked; the command window was pumping out coins! What I came to find out was that the RDS server had 36 cores. This thing was a beast! And it made sense that it could actually pull off mining for bitcoins. A couple nights later I signed in remotely to the RDS server. I created a macro that would continuously move my mouse around in the Remote desktop screen to keep my session alive at all times, and then I’d start my bitcoin mining operation. The following morning I wake up and my session was gone. How sad I thought. I quickly try to remote back in to see what I had collected. “Error, could not connect”. Weird… this usually never happens, maybe I did the remoting wrong. I went to my schools website to do some research on my remoting problem. It was down. In fact, everything was down… I come to find out that I had accidentally shut down the schools network because of my mining operation. I wasn’t found out, but I haven’t done any mining since then.
3rd year:
As an engineering student I found out that all engineering students get access to the school’s VPN. Cool, it is technically used to get around some wonky issues with remoting into the RDS servers. What I come to find out, after messing around with it frequently, is that I can actually use the VPN against the screwed up security on the network. Remember, how I told you that a program has to be downloaded and then one can be accepted into the network? Well, I was able to bypass all of that, simply by using the school’s VPN against itself… How dense does one have to be to not have patched that one?
4th year:
It was another programming day, and I needed access to my phones memory. Using some specially made apps I could easily connect to my phone from my computer and continue my work. But what I found out was that I could in fact travel around in the network. I discovered that I can, in fact, access my phone through the network from anywhere. What resulted was the discovery that the network scales the entirety of the school. I discovered that if I left my phone down in the engineering building and then went north to the biology building, I could still continue to access it. This seems like a very fatal flaw. My idea is to hook up a webcam to a robot and remotely controlling it from the RDS servers and having this little robot go to my classes for me.
What crazy shit have you done at your University?9 -
I thought this launch (security/privacy blog) would go smooth:
- analytics fell, except for one thing, apart for yet unknown reasons
- MySQL came with a very weird error which took me like half an hour of research before I hacked my way past it.
- the firewall started to fuck around for no reason, works now though.
Nginx worked without issues though, as well as NetData 😅
Yeah, didn't go as planned :P10 -
Unaware that this had been occurring for while, DBA manager walks into our cube area:
DBAMgr-Scott: "DBA-Kelly told me you still having problems connecting to the new staging servers?"
Dev-Carl: "Yea, still getting access denied. Same problem we've been having for a couple of weeks"
DBAMgr-Scott: "Damn it, I hate you. I got to have Kelly working with data warehouse project. I guess I've got to start working on fixing this problem."
Dev-Carl: "Ha ha..sorry. I've checked everything. Its definitely something on the sql server side."
DBAMgr-Scott: "I guess my day is shot. I've got to talk to the network admin, when I get back, lets put our heads together and figure this out."
<Scott leaves>
Me: "A permissions issue on staging? All my stuff is working fine and been working fine for a long while."
Dev-Carl: "Yea, there is nothing different about any of the other environments."
Me: "That doesn't sound right. What's the error?"
Dev-Carl: "Permissions"
Me: "No, the actual exception, never mind, I'll look it up in Splunk."
<in about 30 seconds, I find the actual exception, Win32Exception: Access is denied in OpenSqlFileStream, a little google-fu and .. >
Me: "Is the service using Windows authentication or SQL authentication?"
Dev-Carl: "SQL authentication."
Me: "Switch it to windows authentication"
<Dev-Carl changes authentication...service works like a charm>
Dev-Carl: "OMG, it worked! We've been working on this problem for almost two weeks and it only took you 30 seconds."
Me: "Now that it works, and the service had been working, what changed?"
Dev-Carl: "Oh..look at that, Dev-Jake changed the connection string two weeks ago. Weird. Thanks for your help."
<My brain is screaming "YOU NEVER THOUGHT TO LOOK FOR WHAT CHANGED!!!"
Me: "I'm happy I could help."4 -
I've found and fixed any kind of "bad bug" I can think of over my career from allowing negative financial transfers to weird platform specific behaviour, here are a few of the more interesting ones that come to mind...
#1 - Most expensive lesson learned
Almost 10 years ago (while learning to code) I wrote a loyalty card system that ended up going national. Fast forward 2 years and by some miracle the system still worked and had services running on 500+ POS servers in large retail stores uploading thousands of transactions each second - due to this increased traffic to stay ahead of any trouble we decided to add a loadbalancer to our backend.
This was simply a matter of re-assigning the IP and would cause 10-15 minutes of downtime (for the first time ever), we made the switch and everything seemed perfect. Too perfect...
After 10 minutes every phone in the office started going beserk - calls where coming in about store servers irreparably crashing all over the country taking all the tills offline and forcing them to close doors midday. It was bad and we couldn't conceive how it could possibly be us or our software to blame.
Turns out we made the local service write any web service errors to a log file upon failure for debugging purposes before retrying - a perfectly sensible thing to do if I hadn't forgotten to check the size of or clear the log file. In about 15 minutes of downtime each stores error log proceeded to grow and consume every available byte of HD space before crashing windows.
#2 - Hardest to find
This was a true "Nessie" bug.. We had a single codebase powering a few hundred sites. Every now and then at some point the web server would spontaneously die and vommit a bunch of sql statements and sensitive data back to the user causing huge concern but I could never remotely replicate the behaviour - until 4 years later it happened to one of our support staff and I could pull out their network & session info.
Turns out years back when the server was first setup each domain was added as an individual "Site" on IIS but shared the same root directory and hence the same session path. It would have remained unnoticed if we had not grown but as our traffic increased ever so often 2 users of different sites would end up sharing a session id causing the server to promptly implode on itself.
#3 - Most elegant fix
Same bastard IIS server as #2. Codebase was the most unsecure unstable travesty I've ever worked with - sql injection vuns in EVERY URL, sql statements stored in COOKIES... this thing was irreparably fucked up but had to stay online until it could be replaced. Basically every other day it got hit by bots ended up sending bluepill spam or mining shitcoin and I would simply delete the instance and recreate it in a semi un-compromised state which was an acceptable solution for the business for uptime... until we we're DDOS'ed for 5 days straight.
My hands were tied and there was no way to mitigate it except for stopping individual sites as they came under attack and starting them after it subsided... (for some reason they seemed to be targeting by domain instead of ip). After 3 days of doing this manually I was given the go ahead to use any resources necessary to make it stop and especially since it was IIS6 I had no fucking clue where to start.
So I stuck to what I knew and deployed a $5 vm running an Nginx reverse proxy with heavy caching and rate limiting linked to a custom fail2ban plugin in in front of the insecure server. The attacks died instantly, the server sped up 10x and was never compromised by bots again (presumably since they got back a linux user agent). To this day I marvel at this miracle $5 fix.1 -
WHAT THE ACTUAL FUCKING FUCK MICROSOFT?!!
I go to log into my laptop:
me: *enter the pin*
Windows: Error
me: Ok let's try the password...
Win: WRONG PASSWORD!
me: *checking my password manager* Nope, pretty sure that's correct... Ok, whatever let's try to reset it.
me: *generates new password and resets the password for the account*
Windows: You can now log in
me: *enters the new password*
Windows: WRONG PASSWORD!
me: that's weird... let's try that again
Windows: WRONG PASSWORD!
me: Ok... reset once more *I enter the same password I generated before*
Windows: ThAt Is An OlD pAsSwOrD
me: *getting really pissed* FINE, GODDAMIT, HERE, NEW PASSWORD
Windows: You can now log in
me: *enters the new new password*
Windows: wRoNg PaSsWoRd!
jdjsjcjj+3+@!o(€;#@!(&(1!!#((#(€_"jsjeucjcjfdjosdifhshabxnfnxjsosoguwqlqqlall#7@+1(
aaaaaáaaaaaaaaaaaaaaaaaaaaaaaaaa
FUCK FUCK FUCK FUCK FUCK FUCK FUCK
YOU FUCKING INCOMPETENT CUNTS AT MICROSOFT!!!!!1!!!!!!!
I'M GONNA FUCKING TEAR YOU INTO THOUSAND PIECES AND THEN RUN YOU THROUGH A SHREDDER!!
YOU MOTHERFUCKING IDIOTIC CUNTS
FREAKING DEGENERATES22 -
Real fact: 1999
IT: IT, how can I help?
MrB: I'm Butcheek. This program is shit, I can't even log-in!
IT: oh.. Ok Mr. Butcheek, let’s see if I can help...
MrB: of course you can: fix this shitty program and made me log in!
IT: I’ll try to do my best to assist you, can you...
MrB: I just want to log in! Can you speak my language? This new program is ridiculous, I wonder why you IT guys changed the old one, it was a mess but at least I could log in...
IT: I'm sorry you are experiencing this problem, but to assist you I need to know exactly what's the problem
MrB: I CANT LOG IN!!!
IT: ok, I understand this, but can you please provide some more information? Do you receive any particular error messages?
MrB: it says “wrong password” but it's not true!
IT: Ok, that's strange. Look, I'm resetting your password and then you will try again. At the first log in you will be asked to change it again, ok?
MrB: just be quick, I can't waste any more time on this!
IT: sure... Ok done. Please, can you try again? The password is “butcheek”
MrB: it asks for the username. What am I supposed to write here?
IT: “butcheek”
MrB: oh... Ok. And what's the password?
IT: “butcheek”
MrB:... No... Wait... Ok, “butcheek” is the password but what's the username?
IT: “butcheek”!
MrB: you don't understand, I have to put both username AND password!
IT: I know! “butcheek”! For both username AND password!
MrB: so I have to write “butcheek”-”butcheek”?
IT: yes, “butcheek”-”butcheek”!
MrB: so... “butcheek”...twice? Sounds weird... are you sure?
IT: yes I'm sure! However, you can choose either to write “butcheek” twice or “ASS” once, if you prefer...4 -
Support elevates a ticket.
Ticket: customer is getting a weird error uploading photo.
Can’t recreate. Tell support to call them back. I’ll sit in on the call.
Watch the process. Noting extraordinary...
Hmm.
Me: can you get the customer to open the pic in photo viewer?
Support asks as much.
Support: uh, he says he gets a similar error opening this photo in the photo viewer.
Me: 🤦♂️ that is a corrupt file! -
EEEEEEEEEEEE Some fAcking languages!! Actually barfs while using this trashdump!
The gist: new job, position required adv C# knowledge (like f yea, one of my fav languages), we are working with RPA (using software robots to automate stuff), and we are using some new robot still in beta phase, but robot has its own prog lang.
The problem:
- this language is kind of like ASM (i think so, I'm venting here, it's ASM OK), with syntax that burns your eyes
- no function return values, but I can live with that, at least they have some sort of functions
- emojies for identifiers (like php's $var, but they only aim for shitty features so you use a heart.. ♥var)
- only jump and jumpif for control flow
- no foopin variable scopes at all (if you run multiple scripts at the same time they even share variables *pukes*)
- weird alt characters everywhere. define strings with regular quotes? nah let's be [some mental illness] and use prime quotes (‴ U+2034), and like ⟦ ⟧ for array indexing, but only sometimes!
- super slow interpreter, ex a regular loop to count to 10 (using jumps because yea no actual loops) takes more than 20 seconds to execute, approx 700ms to run 1 code row.
- it supports c# snippets (defined with these stupid characters: ⊂ ⊃) and I guess that's the only c# I get to write with this job :^}
- on top of that, outdated documentation, because yea it's beta, but so crappin tedious with this trail n error to check how every feature works
The question: why in the living fartfaces yolk would you even make a new language when it's so easy nowadays to embed compilers!?! the robot is apparently made in c#, so it should be no funcking problem at all to add a damn lua compiler or something. having a tcp api would even be easier got dammit!!! And what in the world made our company think this robot was a plausible choice?! Did they do a full fubbing analysis of the different software robots out there and accidentally sorted by ease of use in reverse order?? 'cause that's the only explanation i can imagine
Frillin stupid shitpile of a language!!! AAAAAHHH
see the attached screenshot of production code we've developed at the company for reference.
Disclaimer: I do not stand responsible for any eventual headaches or gauged eyes caused by the named image.
(for those interested, the robot is G1ANT.Robot, https://beta.g1ant.com/)
4 -
Is it just me who sees this? JS development in a somewhat more complex setting (like vue-storefront) is just a horrible mess.
I have 10+ experience in java, c# and python, and I've never needed more than a a few hours to get into a new codebase, understanding the overall system, being able to guess where to fix a given problem.
But with JS (and also TS for that matter) I'm at my limits. Most of the files look like they don't do anything. There seems to be no structure, both from a file system point of view, nor from a code point of view.
It start with little things like 300 char long lines including various lambdas, closures and ifs with useless variables names, over overly generic and minified method/function names to inconsistent naming of files, classes and basically everything else.
I used to just set a breakpoint somewhere in my code (or in a compiled dependency) wait this it is being hit and go back and forth to learn how the system state changes.
This seems to be highly limited in JS. I didn't find the one way to just being able to debug, everything that is. There are weird things like transpilers, compiler, minifiers, bablers and what not else. There is an error? Go f... yourself ...
And what do I find as the number one tipp all across the internet? Console.log?? are you kidding me, sure just tell me, your kidding me right?
If I would have to describe the JS world in one word, I would use "inconsistency". It's all just a pain in the ass.
I remember when I switcher from VisualStudio/C# to Eclipse/Java I felt like traveling back in time for about 10 years. Everyting seemd so ... old-schoolish, buggy, weird.
When I now switch from java to JS it makes me feel the same way. It's all so highly unproductive, inconsistent, undeterministic, cobbled together.
For one inconveinience the JS communinity seems to like to build huge shitloads of stuff around it, instead of fixing the obvious. And noone seems to see that.
It's like they are all blinded somehow. Currently I'm also trying to implement a small react app based on react-admin. The simplest things to develop and debug are a nightmare. There is so much boilerplate that to write that most people in the internet just keep copying stuff, without even trying to understand what it actually does.
I've always been a guy that tries to understand what the fuck this code actuall does. And for most of the parts I just thing, that the stuff there is useless or could be done in a way more readable way. But instead, all the devs out there just seem to chose the "copy and fix somehow-ish" way.
I'm all in for component-izing stuff. I like encapsulation, I'm a OOP guy by heart. But what react and similar frameworks do is just insane. It's just not right (for some part).
Especially when you have to remember so much stuff that is just mechanics/boilerplate without having any actual "business logical function".
People always say java is so verbose. I don't think it is, there is so few syntax that it almost reads like a prose story. When I look at JS and TS instead, I'm overwhelmed by all the syntax, almost wondering every second line, what the actual fuck this could mean. The boilerplate/logic ration seems way to off ..
So it really makes me wonder, if all you JS devs out there are just so used to that stuff, that you cannot imagine how it could be done better? I still remember my C# days, but I admin that I just got used to java. So I can somehow understand that all. But JS is just another few levels less deeper.
But maybe I'm just lazy and too old ...4 -
My neural networks journey so far:
Look up tutorials -> see that Python is a popular tool for ML -> install Python -> pip install scipy -> breaks with some weird error involving BLAS library code -> spend half an hour fixing it -> try installing Theano -> breaks because my USERNAME HAS A SPACE IN IT LIKE SERIOUSLY? WTF -> make new account without a space in the name -> repeat till Theano -> run tests, found out that I didn't install CUDA support -> scrap the install and redo with CUDA support -> CUDA libraries take forever to download on shitty internet -> run tests -> breaks with some weird Theano compiler error -> go crying to friend -> friend tells me about Anaconda -> scrap the previous install and download Anaconda over shitty connection -> mess up conda environments because noobishness -> scrap, retry -> YESS I FINALLY GOT IT WORKING TIME TO DO SOME LEARNI-crap it's 4 in the morning already.
I realize that I'm a Python noob (and also, uni computers with GPUs have preconfigured Windows installed only, no Linux), but is installing Python libraries always such a pain? Am I doing something wrong? Installing via Anaconda felt like cheating, tbh.6 -
Recently applied at a local company. Webform, "enter some details and we'll get back to you"-like.
Entered my details, hit submit, lo and behold "Error 503 - something went wrong on our end".
I was just baffled. It's a well-established IT company and they can't even get their application form to work?
So I'm sitting there in the debugger console, monitoring network stuff to see if anything is weird. I obviously hit submit some several more times during that.
Eventually I give up.
In the night my phone wakes me up with a shitton of "we've received your application and will review it..." emails.
Yeah they didn't get back to me.2 -
I've got a puzzle! How well do you know the weird GNU coreutils error messages?
$ rm foo/
rm: cannot remove 'foo/': Is a directory
$ rm -r foo/
rm: cannot remove 'foo/': Not a directory
What am I?7 -
When I launch my startup, I'm gonna insert all kinds of very stupid and weird error messages in place of the actual errors just so the people can have a chuckle instead of being annoyed
maybe someone's gonna post it on reddit or something, I don't mind, that's actually a good thing
14 -
Today on "How the Fuck is Python a Real Language?": Lambda functions and other dumb Python syntax.
Lambda functions are generally passed as callbacks, e.g. "myFunc(a, b, lambda c, d: c + d)". Note that the comma between c and d is somehow on a completely different level than the comma between a and b, even though they're both within the same brackets, because instead of using something like, say, universally agreed-upon grouping symbols to visually group the lambda function arguments together, Python groups them using a reserved keyword on one end, and two little dots on the other end. Like yeah, that's easy to notice among 10 other variable and argument names. But Python couldn't really do any better, because "myFunc(a, b, (c, d): c + d)" would be even less readable and prone to typos given how fucked up Python's use of brackets already is.
And while I'm on the topic of dumb Python syntax, let's look at the switch, um, match statements. For a long time, people behind Python argued that a bunch of elif statements with the same fucking conditions (e.g. x == 1, x == 2, x == 3, ...) are more readable than a standard switch statement, but then in Python 3.10 (released only 1 year ago), they finally came to their senses and added match and case keywords to implement pattern matching. Except they managed to fuck up yet again; instead of a normal "default:" statement, the default statement is denoted by "case _:". Because somehow, everywhere else in the code _ behaves as a normal variable name, but in match statement it instead means "ignore the value in this place". For example, "match myVar:" and "case [first, *rest]:" will behave exactly like "[first, *rest] = myVar" as long as myVar is a list with one or more elements, but "case [_, *rest]:" won't assign the first element from the list to anything, even though "[_, *rest] = myVar" will assign it to _. Because fuck consistency, that's why.
And why the fuck is there no fallthrough? Wouldn't it make perfect sense to write
case ('rgb', r, g, b):
case ('argb', _, r, g, b):
case ('rgba', r, g, b, _):
case ('bgr', b, g, r):
case ('abgr', _, b, g, r):
case ('bgra', b, g, r, _):
and then, you know, handle r, g, and b values in the same fucking block of code? Pretty sure that would be more readable than having to write "handeRGB(r, g, b)" 6 fucking times depending on the input format. Oh, and never mind that Python already has a "break" keyword.
Speaking of the "break" keyword, if you try to use it outside of a loop, you get an error "'break' outside loop". However, there's also the "continue" keyword, and if you try to use it outside of a loop, you get an error "'continue' not properly in loop". Why the fuck are there two completely different error messages for that? Does it mean there exists some weird improper syntax to use "continue" inside of a loop? Or is it just another inconsistent Python bullshit where until Python 3.8 you couldn't use "continue" inside the "finally:" block (but you could always use "break", even though it does essentially the same thing, just branching to a different point).17 -
I don't know if I'm being pranked or not, but I work with my boss and he has the strangest way of doing things.
- Only use PHP
- Keep error_reporting off (for development), Site cannot function if they are on.
- 20,000 lines of functions in a single file, 50% of which was unused, mostly repeated code that could have been reduced massively.
- Zero Code Comments
- Inconsistent variable names, function names, file names -- I was literally project searching for months to find things.
- There is nothing close to a normalized SQL Database, column ID names can't even stay consistent.
- Every query is done with a mysqli wrapper to use legacy mysql functions.
- Most used function is to escape stirngs
- Type-hinting is too strict for the code.
- Most files packed with Inline CSS, JavaScript and PHP - we don't want to use an external file otherwise we'd have to open two of them.
- Do not use a package manger composer because he doesn't have it installed.. Though I told him it's easy on any platform and I'll explain it.
- He downloads a few composer packages he likes and drag/drop them into random folder.
- Uses $_GET to set values and pass them around like a message contianer.
- One file is 6000 lines which is a giant if statement with somewhere close to 7 levels deep of recursion.
- Never removes his old code that bloats things.
- Has functions from a decade ago he would like to save to use some day. Just regular, plain old, PHP functions.
- Always wants to build things from scratch, and re-using a lot of his code that is honestly a weird way of doing almost everything.
- Using CodeIntel, Mess Detectors, Error Detectors is not good or useful.
- Would not deploy to production through any tool I setup, though I was told to. Instead he wrote bash scripts that still make me nervous.
- Often tells me to make something modern/great (reinventing a wheel) and then ends up saying, "I think I'd do it this way... Referes to his code 5 years ago".
- Using isset() breaks things.
- Tens of thousands of undefined variables exist because arrays are creates like $this[][][] = 5;
- Understanding the naming of functions required me to write several documents.
- I had to use #region tags to find places in the code quicker since a router was about 2000 lines of if else statements.
- I used Todo Bookmark extensions in VSCode to mark and flag everything that's a bug.
- Gets upset if I add anything to .gitignore; I tried to tell him it ignores files we don't want, he is though it deleted them for a while.
- He would rather explain every line of code in a mammoth project that follows no human known patterns, includes files that overwrite global scope variables and wants has me do the documentation.
- Open to ideas but when I bring them up such as - This is what most standards suggest, here's a literal example of exactly what you want but easier - He will passively decide against it and end up working on tedious things not very necessary for project release dates.
- On another project I try to write code but he wants to go over every single nook and cranny and stay on the phone the entire day as I watch his screen and Im trying to code.
I would like us all to do well but I do not consider him a programmer but a script-whippersnapper. I find myself trying to to debate the most basic of things (you shouldnt 777 every file), and I need all kinds of evidence before he will do something about it. We need "security" and all kinds of buzz words but I'm scared to death of this code. After several months its a nice place to work but I am convinced I'm being pranked or my boss has very little idea what he's doing. I've worked in a lot of disasters but nothing like this.
We are building an API, I could use something open source to help with anything from validations, routing, ACL but he ends up reinventing the wheel. I have never worked so slow, hindered and baffled at how I am supposed to build anything - nothing is stable, tested, and rarely logical. I suggested many things but he would rather have small talk and reason his way into using things he made.
I could fhave this project 50% done i a Node API i two weeks, pretty fast in a PHP or Python one, but we for reasons I have no idea would rather go slow and literally "build a framework". Two knuckleheads are going to build a PHP REST framework and compete with tested, tried and true open source tools by tens of millions?
I just wanted to rant because this drives me crazy. I have so much stress my neck and shoulder seems like a nerve is pinched. I don't understand what any of this means. I've never met someone who was wrong about so many things but believed they were right. I just don't know what to say so often on call I just say, 'uhh..'. It's like nothing anyone or any authority says matters, I don't know why he asks anything he's going to do things one way, a hard way, only that he can decipher. He's an owner, he's not worried about job security.12 -
Stumble across weird error, google error, find single search result with exact error, open page, question posted in 2006, no answers2
-
Got rebuked by the Java teacher today at the University for using proper long names for variables in the code. She though I was just wasting time being lazy in the lab. "If something can be achieved by a single character, why type that long variable again and again?". *Everyone in class laughs*
Then, there was an error in my code [turned out to be long long int in Java is weird], and I had no clue what was going wrong [I'm a week old in Java]. So, I had initially called her to help. She made me change all private methods and attributes to public. When asked "why?", got trolled again.
Now, I know it's okay, and not that I really care about what my classmates think of me, but getting this kind of treatment really sucks. And if this is how future software developers are crafted today, maintainability is surely going to be an issue tomorrow.
Maybe staying in this stupid country was my worst career choice. I should have tried harder and gone abroad.11 -
*Has idea that will change the world!*
*finds awesome software to help accomplish said idea*
$apt install awesome-software
*Get weird error: Google error for 30 minutes and (of course!) come up with nothing useful and finally*
$apt install awesome-software
"Installation Succeded!"
Now.. What was my idea again?!?! -
So ok here it is, as asked in the comments.
Setting: customer (huge electronics chain) wants a huge migration from custom software to SAP erp, hybris commere for b2b and ... azure cloud
Timeframe: ~10 months….
My colleague and me had the glorious task to make the evaluation result of the B2B approval process (like you can only buy up till € 1000, then someone has to approve) available in the cart view, not just the end of the checkout. Well I though, easy, we have the results, just put them in the cart … hmm :-\
The whole thing is that the the storefront - called accelerator (although it should rather be called decelerator) is a 10-year old (looking) buggy interface, that promises to the customers, that it solves all their problems and just needs some minor customization. Fact is, it’s an abomination, which makes us spend 2 months in every project to „ripp it apart“ and fix/repair/rebuild major functionality (which changes every 6 months because of „updates“.
After a week of reading the scarce (aka non-existing) docs and decompiling and debugging hybris code, we found out (besides dozends of bugs) that this is not going to be easy. The domain model is fucked up - both CartModel and OrderModel extend AbstractOrderModel. Though we only need functionality that is in the AbstractOrderModel, the hybris guys decided (for an unknown reason) to use OrderModel in every single fucking method (about 30 nested calls ….). So what shall we do, we don’t have an order yet, only a cart. Fuck lets fake an order, push it through use the results and dismiss the order … good idea!? BAD IDEA (don’t ask …). So after a week or two we changed our strategy: create duplicate interface for nearly all (spring) services with changed method signatures that override the hybris beans and allow to use CartModels (which is possible, because within the super methods, they actually „cast" it to AbstractOrderModel *facepalm*).
After about 2 months (2 people full time) we have a working „prototype“. It works with the default-sample-accelerator data. Unfortunately the customer wanted to have it’s own dateset in the system (what a shock). Well you guess it … everything collapsed. The way the customer wanted to "have it working“ was just incompatible with the way hybris wants it (yeah yeah SAP, hybris is sooo customizable …). Well we basically had to rewrite everything again.
Just in case your wondering … the requirements were clear in the beginning (stick to the standard! [configuration/functinonality]). Well, then the customer found out that this is shit … and well …
So some months later, next big thing. I was appointed technical sublead (is that a word)/sub pm for the topics‚delivery service‘ (cart, delivery time calculation, u name it) and customerregistration - a reward for my great work with the b2b approval process???
Customer's office: 20+ people, mostly SAP related, a few c# guys, and drumrole .... the main (external) overall superhero ‚im the greates and ur shit‘ architect.
Aberage age 45+, me - the ‚hybris guy’ (he really just called me that all the time), age 32.
He powerpoints his „ tables" and other weird out of this world stuff on the wall, talks and talks. Everyone is in awe (or fear?). Everything he says is just bullshit and I see it in the eyes of the others. Finally the hybris guy interrups him, as he explains the overall architecture (which is just wrong) and points out how it should be (according to my docs which very more up to date. From now on he didn't just "not like" me anymore. (good first day)
I remember the looks of the other guys - they were releaved that someone pointed that out - saved the weeks of useless work ...
Instead of talking the customer's tongue he just spoke gibberish SAP … arg (common in SAP land as I had to learn the hard way).
Outcome of about (useless) 5 meetings later: we are going to blow out data from informatica to sap to azure to datahub to hybris ... hmpf needless to say its fucking super slow.
But who cares, I‘ll get my own rest endpoint that‘ll do all I need.
First try: error 500, 2. try: 20 seconds later, error message in html, content type json, a few days later the c# guy manages to deliver a kinda working still slow service, only the results are wrong, customer blames the hybris team, hmm we r just using their fucking results ...
The sap guys (customer service) just don't seem to be able to activate/configure the OOTB odata service, so I was told)
Several email rounds, meetings later, about 2 months, still no working hybris integration (all my emails with detailed checklists for every participent and deadlines were unanswered/ignored or answered with unrelated stuff). Customer pissed at us (god knows why, I tried, I really did!). So I decide to fly up there to handle it all by myself16 -
Fun issue
Swedish client is unable to enter a currency conversion rate in a field and submit. 'Not a float' well we can clearly see that it is a float when he does it (0.5 for example), not an issue for us though.
Reproducing was a nightmare, eventually it boiled down to the fact that the framework we were using had automatic locale checks. Now because our numeric fields are actually weird text fields (front end nonsense), it was converting the period to be a comma (Swedish people would write 0,5 normally). And if you actually entered 0,5 the range check (0.01-1000) failed because it couldn't parse the comma (no locale check on that one)
Godamn facepalm. Really confused the hell out of us when we saw the error, had to go diving through library code. To top this off, locale checks are supposed to be disabled as of about 2 years ago
In revenge against our oppressor :PHP: on slack is now an alias for the shit emoji5 -
So I'm making a file uploader for a buddy of mine and I got an error that I had never seen before. Suddenly I had C++ code and some other weird shite in my terminal. Turns our that I got a memory leak and the first thing that sprung to mind was "Fuck yes, I get to do some NCIS ass debugging".
Now the app worked fine for smaller files, like 5MB - 10MB files, but when I tried with some Linux ISO's it would produce the memory leak.
Well I opened the app with --inspect and set some breakpoints and after setting some breakpoints I found it. Now, for this app I needed to do some things if the user uploads an already existing file. Now to do that I decided to take the SHA string of the file and store it in a database. To do this I used fs.readFile aaaaaaaaaand this is where it went wrong. fs.readFile doesn't read the file as a stream.
Well when I found that, boy did I feel stupid :v
5 -
I just remembered a weird fix in a bug, some old developer hide the error message using css, placing it in a div then just used display none. LOL4
-
porra; caralho; toma no cu.
this fucking shit xamarin. I wish the ass who programed the xamarin vs2017 integration to go fuck off.
srsly, I just want to fucking code this fucking fucker VS2017 keep shitting all around me
first I was gonna install it. didn't install because no memory left. fair enough, my fault there.
cleaned 35 gbs.
finish installing VS, with xamarin. FIRST GOD DAMN TIME I create fucking project, 2 fucking errors and 3 warnings. I DIDN'T EVEN TYPE A COMMA.
ok, tried fucking it. it seems to be conflict between version of Android and xamarin forms. fucker you it shouldn't be like this. anyway.
tried downloading the updated Android version.
it failed at 80%! what error you ask? missing fucking space ok, fuck that thing is huge, ok, my fault again. uninstalled all programs I was not using, all projects I'm not current working on. more fucking 30GB free. tried again. ANDROID IS TOO FUVKING HUGE CAN'T INSTALL IN 30GB!!!
Ok. instead of updating android, gonna downgrade xamarin, can't downgrade. ok gonna remove and install an early version.
unistalled. CAN'T FIND XAMARIN DLLS.
I was like, fuck this project, gonna start a new one. ok, all seems fine, for some weird reason. Except no. I try adding a new page, ops, APPARENTLY VS2017 CAN'T LOAD A GODDAMN .XAML
Ok, I can create a .cs page. done, except now I get a fucking timeout error. fuck.
I search the internet for a workaround, see a guy saying I could manually add a .xaml + .cs by creating this files and then adding them to the proj file.
did it. I go again, everything seems fine. but now I can't freaking reference the damn page.
I'm fucking losing my mind here.
In the mean time I have to turn in this project at the end of the week AND I CAN'T FUCKING OPEN THE GOD DAMN FREKING PROJECT PROPERLY!
FUCK. MY. LIFE.
FUCK XAMARIM AS WELL
FUCK VISUAL STUDIO
FUCK MICROSOFT
FUCK THAT DAMN SSD
FUCK THAT BOSS WHO THINK THAT A 128GB SSD IS ENOUGH
FUCK IT ALL...15 -
I fucking hate printers. And printers hate me too.
I've been working as a software engineer for almost seven years now, and not a single day as a printer technician, which does not stop my mother from calling me each time a printer breaks down, as she did today. I hop over to her place, the printer is connected via usb into the ethernet socket, but she swears it's been printing an hour ago, and she hasn't moved a thing. - "weird", I think, "it must be connected wirelessly". Suddenly my sister, who's an Arts major, comes over, saying her printer broke down too - "cool so they're both wifi printers". I reset the router and my sister's printer springs back to life.
But my mom's printer, which is old and in bad shape (the printer, not my mom! assholes...), doesn't. It keeps on displaying a weird error message, and fails to receive any print job, whether wired or wireless.
I spent 15 seconds resetting the router, and 15 minutes troubleshooting mom's printer. Nothing worked.
I finally give up and leave the house.
Not a minute goes by and I receive a "your sister fixed the printer" text from mom.
I fucking hate printers.5 -
A few months ago I bought an e scooter to get from home to work.
The backstory to this:
My car broke down on the highway, my sister's car broke down on the highway and we didn't have another car apart of my dad's anymore.
Which means I had to look for another car. The cars between 1k-5k € are dogshit and when you want to register the car you have to have an appointment at a government building which happens to be closed when I'm getting out of my 8-5 job.
I had enough and bought an e scooter.
Now back to now:
In the beginning it was cool.
Could get anywhere I wanted to in combination with the Germany ticket. Except for the Netherlands where my beautiful girlfriend is.
There I can legally not use it but that's ok lol.
The German government is hyping e mobility and public transportation up, but for what?
E mobility currently sucks ass with all the shit laws for e.g. e scooters and when you want to transport it in public transport, people give you weird looks, the bus driver wants you to buy a bicycle ticket even if I can fold the e scooter and more. The scanners in the bus of the German buses cannot read my German ticket for some reason and every bus driver in my city knows that and they just look at it and are like "Ok, you're cool. Continue moving", but this old grandma looking ass bitch is like "No, according to the law you need to show it to the scanner and not to me". I fucking know. I've been doing this shit for a year and you know that but it doesn't work. It says to me that I need to show it to you instead of to the scanner bc this machine is fucking dumb and apparently I'm holding the people because I started a discussion with her. This driver ... ugh. The buses in my city come whenever they want as well.
Like sometimes 5 minutes earlier, sometimes up to 30 minutes later.
Inconsistent motherfuckers and I am the one making everyone wait? Suck my donkey kong balls.
German trains... well you know how that goes. It doesn't. It sucks ass.
Every single fucking train line has a problem. Either a previous train has something, or staff is missing, or a technical error or the train driver's ass is itchy and needs scratches from his assistant. There's always something.
When I want to travelled home from my gf I spent not lying 8 fucking hours on the trains on Sunday.
Normally it takes max. 5 hours with a train and 3-4 hours with a car.
I can also go on a rant because of the Dutch train system because it also sucks, BUT they are reliable. They are there when they say they are gonna be there. 99% of the times.
In Germany it is somewhere at 10%.
Now I realized that e scooters are uncomfortable and expensive toys who need maintenance just like a car but nonetheless they are reliable unlike the public transport.
In the winter it will be even worse.
Electrical cars are way expensive and affordable electrical cars you need to keep charging every few baby steps.
I also looked at 125ccm motorcycles which you can drive if you upgrade your existing car driver's license, but ngl that's a scam. Not worth it at all.
And that's why I am looking for a traditional car now. E mobility is not there yet in Germany and public transport is not doable at this moment.15 -
not sure if this totally classifies as a rant, but here goes:
so my Pi is giving a lot of problems. can't install software, keep getting weird error messages. so I try DD a new image onto the card. does not work at all. tried on three different machines :D
next I try run rm -rf /
it's obviously totally fucked. nothing works. pull the plug and plug it in again to see what happens.... it boots up again :D all the commands are back. no files are gone.
and that's when I was like fuck this and I returned the sd card :D2 -
I am a mechanical engineer first and my companies go to sysadmin second. So software developing isnt really my main field of expertise buuttt:
WHY IS SLOOPY SOFTWARE WRITING A VIABLE EXCUSE?
Story:
Yesterday i started to migrate some stuff from our old Win 2008 Server to the new 2016. Turns out there are some MS SQL Express Servers running. Quick check for what they are turns out that they are activly used. So far so good. For other reasons we have a new MSSQL 2017 Core Licence. So i thought, hey it would be nice to just move those 2012, 2008 and 2014 Express Servers to a real one that can use the entire machines capabilities.
After some try & error with exporting one of the softwares (where i had to elevate one the user rights to sysadmin for reasons) the entire system stopped working. I didnt deleted anything or changed anything! Well, i elevated user rights. After 2 hours of support call it turns out that the software stopped working cause i gave the database user sysadmin rights. I dont know enough about MSSQL to judge wether that is logical or not, but it sounds super illogical and i suspect sloopy software writing on the manufacturers part. One way or another, the excuse from the telephone support was "yeah, our software is a very fragile child"
Okay.
After i told all that my coworkers two of them were also "yeah, that is just how the [company] software is, you have to be careful with it"
Apparently it broke in the past for other minor stuff.
As an engineer i cannot build bridges that collapse when you use the left and the right lane at the same time. For an architect it isnt okay to build an house where the front door explodes when you open a window. It is not okay for a power tool to go out in a fireball when you accidently drill plastic with it. But for some weird reasons its socially acceptable for programs to be sloopy, buggy and only working under specific conditions. Since when is it okay for a car only to work when you know specific steps to make it run? Like, throwing your spare key in the gas tank, the kick the left wheel exactly three times and finally tapping the steering wheel 5 times left, 4 times right. What? That would be ridiculous? But that is exactly how that software works. You have to follow a specific step guide to make it work, EVERY TIME.
I. JUST. DONT. GET. IT3 -
So I'm basically my family's IT guy, as you'd expect, but this is just pulling my hairs.
My mom's laptop has a weird error message saying something about a corrupt windows update database.
Not wanting to mess the system up, I decided to factory reset the computer and see if that helped.
During the factory reset, windows tells me that it can't delete all files, and that another factory reset might be in order.
Alright, I don't think any more of it and proceed to setup the account on the computer, everything works fine.
Next day I decide to run windows update on it just to see if everything works as it should, the computer restarts and immediately BSoDs on me. Upon reboot the same error from before the system reset pops up again, and I'm back to square one.
Fuck windows and all its constant issues
9 -
I HATE SURFACES SO FRICKING MUCH. OK, sure they're decent when they work. But the problem is that half the time our Surfaces here DON'T work. From not connecting to the network, to only one external screen working when docked, to shutting down due to overheating because Microsoft didn't put fans in them, to the battery getting too hot and bulging.... So. Many. Problems. It finally culminated this past weekend when I had to set up a Laptop 3. It already had a local AD profile set up, so I needed to reset it and let it autoprovision. Should be easy. Generally a half-hour or so job. I perform the reset, and it begins reinstalling Windows. Halfway through, it BSOD's with a NO_BOOT_MEDIA error. Great, now it's stuck in a boot loop. Tried several things to fix it. Nothing worked. Oh well, I may as well just do a clean install of Windows. I plug a flash drive into my PC, download the Media Creation Tool, and try to create an image. It goes through the lengthy process of downloading Windows, then begins creating the media. At 68% it just errors out with no explanation. Hmm. Strange. I try again. Same issue. Well, it's 5:15 on a Friday evening. I'm not staying at work. But the user needs this laptop Monday morning. Fine, I'll take it home and work on it over the weekend. At home, I use my personal PC to create a bootable USB drive. No hitches this time. I plug it into the laptop and boot from it. However, once I hit the Windows installation screen the keyboard stops working. The trackpad doesn't work. The touchscreen doesn't work. Weird, none of the other Surfaces had this issue. Fine, I'll use an external keyboard. Except Microsoft is brilliant and only put one USB-A port on the machine. BRILLIANT. Fortunately I have a USB hub so I plug that in. Now I can use a USB keyboard to proceed through Windows installation. However, when I get to the network connection stage no wireless networks come up. At this point I'm beginning to realize that the drivers which work fine when navigating the UEFI somehow don't work during Windows installation. Oh well. I proceed through setup and then install the drivers. But of course the machine hasn't autoprovisioned because it had no internet connection during setup. OK fine, I decide to reset it again. Surely that BSOD was just a fluke. Nope. Happens again. I again proceed through Windows installation and install the drivers. I decide to try a fresh installation *without* resetting first, thinking maybe whatever bug is causing the BSOD is also deleting the drivers. No dice. OK, I go Googling. Turns out this is a common issue. The Laptop 3 uses wonky drivers and the generic Windows installation drivers won't work right. This is ridiculous. Windows is made by Microsoft. Surface is made by Microsoft. And I'm supposed to believe that I can't even install Windows on the machine properly? Oh well, I'll try it. Apparently I need to extract the Laptop 3 drivers, convert the ESD install file to a WIM file, inject the drivers, then split the WIM file since it's now too big to fit on a FAT32 drive. I honestly didn't even expect this to work, but it did. I ran into quite a few more problems with autoprovisioning which required two more reinstallations, but I won't go into detail on that. All in all, I totaled up 9 hours on that laptop over the weekend. Suffice to say our organization is now looking very hard at DELL for our next machines.4
-
Is it weird that I'm excited to get to test my code for my side project that I'm working on? It feels like I should hate this since I'm going to graduate next year and my career will be doing this as a job. Really, though, I'm glad to make sure my code is designed properly. It gives me confidence in my programming skills. BTW, if anyone is trying to use a build tool in Python there are NO guides to get started that I've seen! I had to go through trial and error to get pybuilder running!2
-
I hate dev politics...
PM: Hey there is a weird error happening when I upload this file on production, but it works on our test environments.
Me: After looking at this error, I don't find any issues with the code, but this variable is set when the application is first loaded, I bet it wasn't loaded correctly our last deployment and we just need to reload the application.
Senior Dev: We need to output all of the errors and figure out where this error is coming from. Dump out all the errors on everything in production!!
Me: That's dumb... the code works on test... it's not the code.. it's the application.
Senior dev: %$*^$>&÷^> $
Me: Hey I have an idea! If test works... I can go ahead and deploy last week's changes to prod and dump those errors you were talking about!!
Senior Dev: OK
Me: *runs Jenkins job the deploys the new code and restarts the application*
PM: YAY you fixed it!!
Senior Dev: Did you sump put those errors like I said.
Me: Nope didn't touch a thing... I just deployed my irrelevant changes to that error and reloaded the application.2 -
Pulled an all nighter for a project, the next thing i know i am demonstrating my code with the error message i forgot to change which was houston we got a problem, i felt so weird and i was laughing very hard after the project presentation
-
Am I the only developer in existence who's ever dealt with Git on Windows? What a colossal train wreck.
1. Authentication. Since there is no ssh key/git url support on Windows, you have to retype your git credentials Every Stinking Time you push. I thought Git Credential Manager was supposed to save your credentials? And this was impossible over SSH (see below). The previous developer had used an http git URL with his username and password baked in for authentication. I thought that was a horrific idea so I eventually figured out how to use a Bitbucket App password.
2. Permissions errors
In order to commit and push updates, I have to run Git for Windows as Administrator.
3. No SSH for easy git access
Here's where I confess that this is a Windows Server machine running as some form of production. Please don't slaughter me! I am not the server admin.
So, I convinced the server guy to find and install some sort of ssh service for Windows just for the off times we have to make a hot fix in production. (Don't ask, but more common than it should be.)
Sadly, this ssh access is totally useless as the git colors are all messed up, the line wrap length and window size are just weird (seems about 60 characters wide by 25 lines tall) and worse of all I can't commit/push in git via ssh because Permissions. Extremely aggravating.
4. Git on Windows hangs open and locks the index file
Finally, we manage to have Git for Windows hang quite frequently and lock the git index file, meaning that we can't do anything in git (commit, push, pull) without manually quitting these processes from task manager, then browsing to the directory and deleting the .git/index.lock file.
Putting this all together, here's the process for a pull on this production server:
Launch a VNC session to the server. Close multiple popups from different services. Ask Windows to please not "restart to install updates". Launch git for Windows. Run a git pull. If the commits to be pulled involve deleting files, the pull will fail with a permissions error. Realize you forgot to launch as Administrator. Depending on how many files were deleted in the last update, you may need to quit the application and force close the process rather than answer "n" for every "would you like to try again?" file. Relaunch Git as Administrator. Run Git pull. Finally everything works.
At this point, I'd be grateful for any tips, appreciate any sympathy, and understand any hatred. Windows Server is bad. Git on Windows is bad.9 -
Tldr: fucked up windows boot sector somehow, saved 4 months worth of bachelor thesis code, never hold back git push for so long!
Holy jesus, I just saved my ass and 4 months of hard work...
I recently cloned one of my SSDs to a bigger one and formatted the smaller one, once I saw it went fine. I then (maybe?) sinned by attaching an internal hdd to the system while powered on and detached, thinking "oh well, I might have just done smth stupid". Restart the system: Windows boot error. FUCK! Only option was to start a recovery usb. Some googling and I figured I had to repair the boot section. Try the boot repair in the provided cmd. Access denied! Shit! Why? Google again and find a fix. Some weird volume renaming and other weird commands. Commands don't work. What is it now? Boot files are not found. What do I do now? At this point I thought about a clean install of Windows. Then I remembered that I hadn't pushed my code changes to GitHub for roughly 4 months. My bachelor thesis code. I started panicking. I couldn't even find the files with the cmd. I panicked even more. I looked again at the tutorials, carefully. Tried out some commands and variations for the partition volumes, since there wasn't much I could do wrong. Suddenly the commands succeeded, but not all of them? I almost lost hope as I seemed to progress not as much as I hoped for. I thought, what the hell, let's restart and see anyway. Worst case I'll have to remember all my code😅🤦.
Who would have thought that exactly this time it would boot up normally?
First thing I immediately did: GIT PUSH --ALL ! Never ever hold back code for so long!
Thanks for reading till the end! 👌😅7 -
I don't understand some developer's thought processes when they fix a bug/issue.
Let's say the error is -> "Cannot read property id of undefined".
My first thought is to add a check for undefined and null and figure out if further code should be executed if a null or undefined is encountered, depending on what the code is supposed to do.
But some devs are like, "Yesterday the sunrise was at 5:30 AM, Earth's rotational axis is titled at 15 degrees to the left, My aunt asked me about how I am doing today, so therefore the bug fix is required at line 65,456 of this particular kernel file".
And they implement it, and it WORKS.
Weird.4 -
I really hate PHP frameworks.
I also often write my own frameworks but propriety. I have two decades experience doing without frameworks, writing frameworks and using frameworks.
Virtually every PHP framework I've ever used has causes more headaches than if I had simply written the code.
Let me give you an example. I want a tinyint in my database.
> Unknown column type "tinyint" requested.
Oh, doctrine doesn't support it and wont fix. Doctrine is a library that takes a perfectly good feature rich powerful enough database system and nerfs it to the capabilities of mysql 1.0.0 for portability and because the devs don't actually have the time to create a full ORM library. Sadly it's also the defacto for certain filthy disgusting frameworks whose name I shan't speak.
So I add my own type class. Annoying but what can you do.
I have to try to use it and to do so I have to register it in two places like this (pseudo)...
Types::add(Tinyint::class);
Doctrine::add(Tinyint::class);
Seems simply enough so I run it and see...
> Type tinyint already exists.
So I assume it's doing some magic loading it based on the directory and commend out the Type::add line to see.
> Type to be overwritten tinyint does not exist.
Are you fucking kidding me?
At this point I figure out it must be running twice. It's booting twice. Do I get a stack trace by default from a CLI command? Of course not because who would ever need that?
I take a quick look at parent::boot(). HttpKernel is the standard for Cli Commands?
I notice it has state, uses a protected booted property but I'm curious why it tries to boot so many times. I assume it's user error.
After some fiddling around I get a stack trace but only one boot. How is it possible?
It's not user error, the program flow of the framework is just sub par and it just calls boot all over the place.
I use the state variable and I have to do it in a weird way...
> $booted = $this->booted;parent::boot();if (!$booted) {doStuffOnceThatDependsOnParentBootage();}
A bit awkward but not life and death. I could probably just return but believe or not the parent is doing some crap if already booted. A common ugly practice but one that works is to usually call doSomething and have something only work around the state.
The thing is, doctrine does use TINYINT for bool and it gets all super confused now running commands like updates. It keeps trying to push changes when nothing changed. I'm building my own schema differential system for another project and it doesn't have these problems out of the box. It's not clever enough to handle ambiguous reverse mappings when single types are defined and it should be possible to match the right one or heck both are fine in this case. I'd expect ambiguity to be a problem with reverse engineer, not compare schema to an exact schema.
This is numpty country. Changing TINYINT UNSIGNED to TINYINT UNSIGNED. IT can't even compare two before and after strings.
There's a few other boots I could use but who cares. The internet seems to want to use that boot function. There's also init stages missing. Believe it or not there's a shutdown and reboot for the kernel. It might not be obvious but the Type::add line wants to go not in the boot method but in the top level scope along with the class definition. The top level scope is run only once.
I think people using OOP frameworks forget that there's a scope outside of the object in PHP. It's not ideal but does the trick given the functionality is confined to static only. The register command appears to have it's own check and noop or simply overwrite if the command is issued twice making things more confusing as it was working with register type before to merely alias a type to an existing type so that it could detect it from SQL when reverse engineering.
I start to wonder if I should just use columnDefinition.
It's this. Constantly on a daily basis using these pretentious stuck up frameworks and libraries.
It's not just the palava which in this case is relatively mild compared to some of the headaches that arise. It's that if you use a framework you expect basic things out of the box like oh I don't know support for the byte/char/tinyint/int8 type and a differential command that's able to compare two strings to see if they're different.
Some people might say you're using it wrong. There is such a thing as a learning curve and this one goes down, learning all the things it can't do. It's cripplesauce.12 -
I've been out of the loop with websites and frontends for a while. Now, is it me or is it just overengineered to make a static website that's not a blog these days?
I mean, I need to make a landing page. 6 sections + footer. And I don't want to end up with a 600+ lines html file. With tailwind possibly.
JEKYLL
I've used it a few times, and after 3 years I still get some weird error when installing everything. Maybe it's trivial, but I know shit about ruby. Plus, I don't need ruby for anything else, and the official Docker image just doesn't work, exactly like the quickstart tutorial. 3 years later, same issues.
HUGO
I like this guy but god, the docs are just unreadable, it's not compatible with tailwind 3.x (or smth) and it's been a pain to build a user-configurable homepage. Plus, it does more than half of the work by itself, Fair enough, it's supposed to be used for blogs.
ANY OTHER "JAMSTACK" BULLSHIT
Anything is either a blogging engine or delivers some crappy javascript blob from hell. I just need an html document, that weird thingie the whole World Wide Web was built upon, broken into pieces so I can keep my sanity.
Looking forward to get the fucking AWS Solutions Architect. Looking even more forward to build my farm.8 -
TL;DR Calendar services sucks.
Imagine yourself as startup. You don't want to spend fortune on paying $5 per user per month for Google Services. Also you don't want to pay that to Microsoft for O365. You want to run it itself because you already have droplet running with your other services (ERP for example. Funny story too btw.) Ok, decision has been made, let install something.
I have pretty good experience with OwnCloud from past as Cloud file sharing service. Calendar is not bad for single user purpose (understand it as personal calendar, no invitations to others, sharing is maximum I tried) What can possibly go wrong when I deploy that and use its Calendar?
Well, lot. OwnCloud itself runs well (no rant here) but Calendar is such pain in ass. Trouble is with CalDav under hood and its fragmented standards. So, you want to send invitation to your team for recurrent meeting. Nothing weird. It sends as one invitation to each one, good. Now you realize you have a conflict, so you need to change time of one occurence. Move it, send update. And here comes shitstorm. It is not able to bisect one occurence from series. So it splits it to separate events and send invitation for every single one. 30 INVITATIONS IN 2 SECONDS! Holy sh*t! You want to revert that. Nope, won't do. So you accept your destiny and manually erase every single one with memo in head about planning recurring events.
Another funny issue is when SwiftMailer library (which is responsive for sending e-mails from OwnCloud) goes to spamming mayhem. It is pretty easy to do. When e-mail doesn't comply to RFC, it is rejected, right? So if because of some error CalDav client passes non-compliant e-mail (space as last character is non-compliant btw) and SwiftMailer tries to send it to multiple recepients (one of them is broken, rest is fine), it results in repetitive sending same invitation over and over in 30 minute interval. Sweet.
So now I am sitting in front of browser, looking for alternatives. Not much to choose from. I guess I'll try SOGO. It looks nice. For now.5 -
I'm considering quitting a job I started a few weeks ago. I'll probably try to find other work first I suppose.
I'm UK based and this is the 6th programming/DevOps role I've had and I've never seen a team that is so utterly opposed to change. This is the largest company I've worked for in a full time capacity so someone please tell me if I'm going to see the same things at other companies of similar sizes (1000 employees). Or even tell me if I'm just being too opinionated and that I simply have different priorities than others I'm working with. The only upside so far is that at least 90% of the people I've been speaking to are very friendly and aren't outwardly toxic.
My first week, I explained during the daily stand up how I had been updating the readmes of a couple of code bases as I set them up locally, updated docker files to fix a few issues, made missing env files, and I didn't mention that I had also started a soon to be very long list of major problems in the code bases. 30 minutes later I get a call from the team lead saying he'd had complaints from another dev about the changes I'd spoke about making to their work. I was told to stash my changes for a few weeks at least and not to bother committing them.
Since then I've found out that even if I had wanted to, I wouldn't have been allowed to merge in my changes. Sprints are 2 weeks long, and are planned several sprints ahead. Trying to get any tickets planned in so far has been a brick wall, and it's clear management only cares about features.
Weirdly enough but not unsurprisingly I've heard loads of complaints about the slow turn around of the dev team to get out anything, be it bug fixes or features. It's weird because when I pointed out that there's currently no centralised logging or an error management platform like bugsnag, there was zero interest. I wrote a 4 page report on the benefits and how it would help the dev team to get away from fire fighting and these hidden issues they keep running into. But I was told that it would have to be planned for next year's work, as this year everything is already planned and there's no space in the budget for the roughly $20 a month a standard bugsnag plan would take.
The reason I even had time to write up such a report is because I get given work that takes 30 minutes and I'm seemingly expected to take several days to do it. I tried asking for more work at the start but I could tell the lead was busy and was frankly just annoyed that he was having to find me work within the narrow confines of what's planned for the sprint.
So I tried to keep busy with a load of code reviews and writing reports on road mapping out how we could improve various things. It's still not much to do though. And hey when I brought up actually implementing psr12 coding standards, there currently aren't any standards and the code bases even use a mix of spaces and tab indentation in the same file, I seemingly got a positive impression at the only senior developer meeting I've been to so far. However when I wrote up a confluence doc on setting up psr12 code sniffing in the various IDEs everyone uses, and mentioned it in a daily stand up, I once again got kickback and a talking to.
It's pretty clear that they'd like me to sit down, do my assigned work, and otherwise try to look busy. While continuing with their terrible practices.
After today I think I'll have to stop trying to do code reviews too as it's clear they don't actually want code to be reviewed. A junior dev who only started writing code last year had written probably the single worst pull request I've ever seen. However it's still a perfectly reasonable thing, they're junior and that's what code reviews are for. So I went through file by file and gently suggested a cleaner or safer way to achieve things, or in a couple of the worst cases I suggested that they bring up a refactor ticket to be made as the code base was trapping them in shocking practices. I'm talking html in strings being concatenated in a class. Database migrations that use hard coded IDs from production data. Database queries that again quote arbitrary production IDs. A mix of tabs and spaces in the same file. Indentation being way off. Etc, the list goes on.
Well of course I get massive kickback from that too, not just from the team lead who they complained to but the junior was incredibly rude and basically told me to shut up because this was how it was done in this code base. For the last 2 days it's been a bit of a back and forth of me at least trying to get the guy to fix the formatting issues, and my lead has messaged me multiple times asking if it can go through code review to QA yet. I don't know why they even bother with code reviews at this point.15 -
Me: I just know there's gotta be a better way to do this.
PM: No I think it's just a problem of inexperience. You and $coworker just haven't spent enough time in WordPress.
Me: no you're right. I'm just trying to get a better handle on the code and make things as less error prone as possible.
PM: well we really don't have very many errors.
Me: wait, what about the (list off other issues)?
PM: those all have been resolved already.
Me: Oh. Ok. I guess it's just me.
PM: See, I make changes and nothing breaks. You guys just need to continue working on this.
Me: ... 🤨
Me: (weird flex but ok) hey! Look at this guy over here!
PM: (Laughs)3 -
I'M CHANGING 200 + SSIS PACKAGES WHILE VISUAL STUDIO KEEPS ON CRASHING EVERY 15 MINUTES WITH SOME WEIRD UI ERROR THAT HAS NOTHING TO DO WITH THE PACKAGE ITSELF. ITS MAKING ME WANT TO GAUGE MY EYES OUT AND PULL OUT MY HAIR. FUCK MICROSOFT AND FUCK PEOPLE THAT MAKE ME USE THIS WORTHLESS TOOL!!!!!1
-
"You broke the build"
o.O
Me checking the build.
Oh. There's a weird 500 from github.
Oh yeah:
Error 503 first byte timeout
on the package.json of some node dependency.
That's what you get for relying on the cloud. -
aagh fuck college subjects. over my last 4 years and 7 sems in college, i must have said this many times : fuck college subjects. But Later i realize that if not anything, they are useful in government/private exams and interviews.
But Human computer Interaction? WHAT THE FUCK IS WRONG WITH THIS SUBJECT???
This has a human in it, a comp in it, and interaction in it: sounds like a cool subject to gain some robotics/ai designing info. But its syllabus, and the info available on the net , is worse than that weird alienoid hentai porn you watched one night( I know you did).
Like, here is a para from the research paper am reading, try to figure out even if its english is correct or not:
============================
Looking back over the history of HCI publications, we can see how our community has broadened intellectually from its original roots in engineering research and, later, cognitive science. The official title of
the central conference in HCI is “Conference on Human Factors in Computing Systems” even though we usually call it “CHI”. Human factors for interaction originated in the desire to evaluate whether pilots
could make error-free use of the increasingly complex control systems of their planes under normal conditions and under conditions of stress. It was, in origin, a-theoretic and entirely pragmatic. The conference and field still reflects these roots not only in its name but also in the occasional use of simple performance metrics.
However, as Grudin (2005) documents, CHI is more dominated by a second wave brought by the cognitive revolution. HCI adopted its own amalgam of cognitive science ideas centrally captured in Card, Moran & Newell (1983), oriented around the idea that human information processing is deeply analogous to computational signal processing, and that the primary computer-human interaction task is enabling communication between the machine and the person. This cognitive-revolution-influenced approach to humans and technology is what we usually think of when we refer to the HCI field, and particularly that represented at the CHI conference. As we will argue below, this central idea has deeply informed the ways our field conceives of design and evaluation.
The value of the space opened up by these two paradigms is undeniable. Yet one consequence of the dominance of these two paradigms is the difficulty of addressing the phenomena that these paradigms mark as marginal.
=============================7 -
I have this classmate in college that names all his variables and classes like this: "seosX". I once spent an afternoon of my life helping him with this weird error he was getting running his program and the class name and file didn't have the same name...
I blocked him from all social media and my life. My IQ has doubled since. -
I am not a PHP dev but this back end error message when accessing /notif looks weird.
Is this a security bug?
7 -
Multi User, One Account, and other shit
I'm gonna rant about something as a user, and someone who makes stupid web stuff.
My bank has been updating their web banking over time and they decided that every individual on an account, should have their own login. They really want to push this on their users, I suspect specifically folks like me and my wife who share one login for the joint accounts we have at the bank together.
Why share one login, because it's the only sure fire way I know that I and my wife can see all the same shit no doubt about it.
The banks never tell you what you can see or can't with joint accounts, I doubt it is even documented on their end, but in every damn case something is hidden or different in some weird way.
Messages to the bank people? If I send it, my wife often can't. I get that for security reasons that's a thing, but it makes no sense for a joint account.
ANY difference to me breaks online banking ENTIRELY. Joint accounts are supposed to be... well one account that is the same.
Other banks we used where we had different logins for the joint account, each login actually had separate bill pay accounts per user. So if I went to bill pay and scheduled something to be paid, my wife had no idea, same if she did.
Right fucking there, banking is just broken entirely!
So no Mr. Bank, fuck you we're both logging in via the same login.
Fast forward to N00bPancakes making a thing.
So my employer has a customer (Direct Customer). Direct Customer wants a thing that makes communication with their customer (Indirect Customer) easier.
The worst thing about making something for your customer's customer is that Direct Customer always imagines that Indirect Customer is gonna be super ninja power users....
But no, that's not the case... in fact almost nobody is a power user, and absolutely nobody WANTS to be a power users.
Worse yet in my case the only reason this tool exists is because Direct Customer and Indirect Customer can't communicate well enough anyway... that should tell you something about the amount of effort Indirect Customer is willing to expend.
So with that tool, this situation constantly comes up:
Direct Customer thinks it would be great if every user from Indirect Company had some sort of custom messaging, views, and etc in of Cool Communication Tool. The reason is because that's what Direct Customer loves about Ultra Complex Primary Tool that they use ....
Then I have to fight the constant fight of:
NOBODY WANTS TO BE A POWER USER, NOBODY EVEN WANTS TO DO MUCH OF ANYTHING ON THE INTERNET THAT ISN'T SCREAMING AT OTHER PEOPLE OR POST MEMES OR WATCH SHITTY VIDEOS. THE MOMENT ANYONE AT INDIRECT COMPANY LOGS IN AND SEES ANY INFO THAT IS DIFFERENT FROM THEIR COWORKER THEY'LL SHIT THEMSELVES, FLOOD EVERYONE WITH 'OH GAWD SOME NON SPECIFIED THING IS WRONG' AND RESPOND TO EMAILS LIKE A JELLYFISH DROPPED OFF IN NEW MEXICO... AND NOTHING WILL GET DONE!!!
God damn it people.
Also side rant while I'm busy fighting the good fight to keep shit simple and etc:
People bitch about how horrible the modern web is and then bitch at web devs like we're rulers of the internet or something.... What really pisses me off about that is other devs who do that.... like bro, do you make policy at your company? You decide not to sell some info or whatever shit your company sells? Like fuck off with your 'man I miss html' because you got scared by some shitty JS error and ran back to your language of choice and just poked your head out of the the basement and got scared... and you shit on another developer about that? Fuck you. -
Pentesting for undisclosed company. Let's call them X as to not get us into trouble.
We are students and are doing our first pentest at an actual company instead of assignments at school. So we're very anxious. But today was a good day.
We found some servers with open ports so we checked a few of them out. I had a set of them with a bunch of open ports like ftp and... 8080. Time to check this out.
"please install flash player"... Security risk 1 found!
System seemed to be some monitoring system. Trying to log in using admin admin... Fucking works. Group loses it cause the company was being all high and mighty about being secure af. Other shit is pretty tight though.
Able to see logs, change password, add new superuser, do some searches for USERS_LOGGEDIN_TODAY! I shit you not, the system even had SUGGESTIONS for usernames to search for. One of which had something to do with sftp and auth keys. Unfortunatly every search gave a SQL syntax error. Used sniffing tools to maybe intercept message so we could do some queries of our own but nothing. Query is probably not issued from the local machine.
Tried to decompile the flash file but no luck. Only for some weird lines and a few function names I presume. But decompressing it and opening it in a text editor allowed me to see and search text. No GET or POST found. No SQL queries or name checks or anything we could think of.
That's all I could do for today. So we'll have to think of stuff for next week. We've already planned xss so maybe we can do that on this server as well.
We also found some older network printers with open telnet. Servers with a specific SQL variant with a potential exploit to execute terminal commands and some ftp and smb servers we need to check out next week.
Hella excited about this!
If you guys have any suggestions let us know. We are utter noobs when it comes to this.6 -
Hey guys and girls, quick question.
Im currently writing my own collection-framework in Go.
It has a Collection-Interface, that looks like this:
Clear()
Size() int
ToSlice() []interface{}
Add(...interface{}) error
Remove(...interface{}) error
Contains(...interface{}) (bool, error)
The library should also contains stuff like stacks and queues, so datastructures, that dont fit that interface perfectly.
So should i write a weird implementation of the interface for them, like Remove for stacks (high pitched internal screaming), or should i just say fuck it, and dont implement the Collection-Interface for these specific types ?1 -
I did not think that making a serverless Discord bot would be such a learning experience. The code itself was easy. The hard part was the infrastructure, because I decided to automate it all with Terraform and deploy it on AWS.
Before this project, I had no idea how API Gateways worked. Now I still have very little idea how they work but I managed to build one anyway. Eventually. And then I had to figure out how to automate the deployment of a lambda layer and function that would both still be managed in the Terraform state, with any code changes triggering a rebuild and update for the resource.
And then I had to untangle a dependency mess because API Gateways have some weird issues where two resources that have no explicit dependencies on each other will throw an error if they don't deploy in the right order.
And then I went the wrong way with Github actions trying to conditionally chain multiple workflows together before I realized I could just put multiple jobs with conditions in a single workflow.
And now after all that work over the course of 2 days, I have a bot that does this:
2 -
LINUX. I'm sure everyone heard this term. But I still don't know why do people want to give up their life and try this piece of crap. I know many of you might be offended, but, to hell with that. When I heard about the Linux, and everyone was praising it about it, I thought that I should give it a try. So, I installed Ubuntu (obviously, because I was a beginner) and the installation failed. I thought that I've made some mistake. Tried again, FAILED. So, I waited for next version. After downloading and trying to installing it, Voila. I installed it. Then comes the part when I actually started using it, for as simple as watching a video. I didn't play. It gave an error of some codec was missing. I installed the codec and then I payed the video successfully. Then, I want to install the Oracle Java Development Kit, and literally it was a pain to install. It took me half an hour to install and configure it. Then after using it for a couple of days, I found that my WiFi was acting weird. I booted up my Windows just to check it and it worked perfectly on windows. Then why the heck was it not working on Ubuntu. Don't know. On searching about it, I found that my WiFi adapter's driver was having some issues. Then after using it for more days, something very weird happens, the Ubuntu booted but with terminal only. No GUI, No Unity, nothing. I against searched for it, found some commands, ran it and it started normally. So, the point that I'm trying to make is that even for simple and basic tasks, I always have to search about it every time to get it working. I mean if their are so many steps to be taken for every simple task then why people keep on recommending it. With the Linux installed, I was very much distracted from my primary work. Instead of doing my work I was searching for installing JDK. I mean wtf. In Mac or Windows its as simple as downloading the file, installing it and you're done. But in Linux I don't know. And the whole Linux community thinks that Windows sucks. I mean on windows I was more relaxed and more focused on my work. Whenever we search for the Linux, many people say that Android is a Linux. I get it, but in Android, many developers have worked very hard to make it as what it is nowadays. But what about Ubuntu, Fedora or any other distribution. I haven't seen any distribution which makes me feel that I wanna use it again. None of them. So, Linux is not a great OS according to my experience11
-
Fk you Google!
My Samsung note 10 screen went dead near a week ago... it's a secondary line so waiting for parts wasn't the end of the world.
Ofc the screen (curved and incl a fingerprint reader thatd be a major pain to not replace) was integrated to the whole front half... back panel glued, battery, glued immensely and with all other parts out, about 6mm space only at the bottom to get a tool in to pry it out.
New screen (off brand) ~200... all genuine parts amazon refurb ~230... figured id have some extra hardware for idk what... i like hardware and can write drivers so why not.
Figured id save a bit of time and avoid other potentially damaged (water) components to just swap out the mobo unit that had my storage.
Put it back together, first checked that my sim was recognised since this carrier required extraneous info when registering the dev... worked fine... fingerprint worked fine, brave browser too...
Then i open chrome. It tells me im offline... weird cuz i was literally in a discord call. My wifi says connected to the internet (not that i wouldn't have known the second there was a network issue... i have all our servers here and a /28 block... ofc i have everything scripted and connected to alert any dev i have, anywhere i am, the moment something strange happens).
Apparently google doesnt like the new daughter board(i dislike the naming scheme... its weird to me)... so anything that is controlled by google aside from the google account that is linked to non-google reliant apps like this... just hangs as if loading and/or says im offline.
I know... itll only take me about the 5-10m it took to type this rant but ffs google... why dont you even have an error message as to what your issue is... or the simple ability to let me log in and be like 'yup it's me, here's your dumb 2fa and a 3rd via text cuz you're extra paranoid yet dont actually lock the account or dev in any way!'
I think it's a toss up if google actually knows that it's doing this or they just have some giant glitch that showed up a couple times in testing and was resolved via the methods of my great grama- "just smack it or kick it a few times while swearing at it in polish. Like reaaaally yelling. Always worked for me! If not, find a fall guy."6 -
I'm sure this has been ranted about before because I can hardly be the only one.
Android development and the upgrade dance.
Things were worse in the bad old days of eclipse but it's not like they're peachy now, either. Android is one of many platforms I'm developing for - c++ back-end, running on lots of different platforms through a thin bit of platform specific glue.
That's all I care about - that this thin bit of glue just works. I want to write this stuff, forget about it and get on with solving what I feel are real problems, for me, in my code.
The trouble is, I'm never finished writing this and android is one of the worst. With every revision change, google changes *something*. New build system? Why not, you indie developers have *loads* of time and resources to waste on that, don't you? Some weird thing just stops working for no apparent reason? You guys love to drop whatever it was you were working on to figure out what the hell ' android.app.Instrumentation' does and why it can't talk to my main class any more, or why I even need it but nothing in that error message about what I might do to fix this arcane random error.
Google have all the resources in the world, I do not. Yet I have to dance for them, every time I upgrade.
Can you guys please funnel some of your practically infinite resources in to making this stuff 'just work'? -
There a times I love python for its quick way of writing things. But there are more times that python makes me angry or just frustrates me with its indentation logic.🤪
When the indentation in my project lets the code either accidentally run a million times more or a tab/spaces inconsistency that no tool warns me about except runtime error.
What about a language that combines pythons easy way with brackets on top?😪 I guess it already exists?😅
For my project C++ would be a viable alternative, but so far the language seems very weird to write.11 -
Heck yeah,
So an old Ionic 3 project wont work on the newest CLI.
I check around for the error, update some dependencies, sure enough it starts working again, all is great or so I thought.
Later something weird starts happening, upon pushing a new view on the navCtrl, the navParams are null on the next view.
I later find out that navCtrl is becoming navParams just on the first bit of the view loading, so I do a dirty fix just to keep working on the functionality from my browser, I know very well this will cause problems later on, this is just so I can keep working on functionality.
I finish all of the functionality and I'm ready to compile for android, I run my script, the dirty fix comes to bite my butt now.
I remove the dirty fix hoping for it to work just well on the apk.
Now gradle doesn't find ddmlib.jar, some 15 minutes of troubleshooting do nothing.
Fuck it, I'll just create a new project from the CLI and drag all the code there so that navParams work as expected.
Sorry Ionic, but the world is not our oyster when subtle changes in dependencies produce such unexpected behaviour, with some fucking view parameters!.
I'm looking forward to get done with all the current projects to jump back to native.1 -
LOL this showed up, the bar is a removed sign, the dot is an error sign, but together I got a "!" which makes it even more weird cuz the error is there because of those removed lines.
geez, I'm so silly
3 -
Day 3, still stuck with the same weird error message, Im using Ionic and I think I'll switch to React Native...3
-
Anyone else getting a bug with every opengl application on Linux? Gives me an error something like "X error of failed request: badvalue"
Weird- maybe happened in the latest kernel update? I'm using 4.147 -
I just started on a Laravel project for a customer. Damn I’ve got a hate/love relationship with that thing.
I fucking love how fucking fast development is it in, even for fairly complex tasks, amazing.
I fucking hate how goddamn fucking slow development is when you get an error, as that shit is near impossible to debug, and you keep getting weird exceptions that you just need to know what means. -
I really regret switching to manjaro. So many things keep breaking, like my laptop won't sleep anymore, it stays up, whenever I plug in another display I get an error thrown at me. Among other weird behaviors (all screen related) that I can't seem to fix and make the experience feel like I'm running a very clunky win-poop machine.
On the other hand, setting up a very custom sddm theme and installing certain software like hadoop, rust, gimp, xfce tweaks and other things was such a breeze D: just "yay hadoop" and 90% of the work was done.
Grhhh... Wondering if I should accept defeat, and maybe switch to Linux MX or spend hours fixing what probably is a display driver issue that's pissing me off 😠2 -
Let me rant! I don’t usually do this but this is just frustrating and draining. Please tell me if im wrong. We have authentication that needs to be refactored. I was assigned on this issue. Im a junior btw. I also attached an image of my proposals. The issue of the old way of our signup process is that when validation fails they will keep on accepting the TaC (terms and conditions) and on our create method we have the validation and creating the user. Basically if User.create(user_params) create else throw invalid end. (Imma take a photo later and show it you)which needs to be refactored. So I created a proposal 1. On my first proposal I could create a middleware to check if the body is correct or valid if its valid show the TaCs and if they accept thats the moment the user is created. There is also additional delete user because DoE told me that we dont need middlewares we have before and after hooks! (I wanted to puke here clearly he doesn’t understand the request and response cycle and separation of concerns) anyway, so if middleware is not accepted then i have to delete the user if they dont accept the TaCs. Proposal 2. If they dont want me to touch the create method i could just show the TaCs and if they dont accept then redirect if they do then show form and do the sign process.
This whats weird (weird because he has a lot of experience and has master or phd) he proposes to create a method called validate (this method is in the same controller as the create, i think hes thinking about hooks) call it first and if it fails then response with error and dont save user, heres the a weird part again he wants me to manually check on each entity. Like User.find_by_email(bs@g.com) something like that and on my mind wtf. Isnt it the same as User.create(user_params) because this will return false if paras are invalid?? (I might be wrong here)
This is not the first time though He proposes solutions that are complex, inefficient, unmaintainable. And i think he doesnt understand ruby on rails or webdev in particular. This the first time i complained or I never complained because im thinking im just a junior and he hs more experience and has a higher degree. This is mot the case here though. I guess not all person who has a higher degree are right. To all self thought and bachelors im telling you not all people who went to prestige university and has a higher degree are correct and right all the time. Anyway ill continue later and do what he says. Let me know if im wrong please. Thanks
4 -
Two days ago on my linux partition python was being weird, and I couldn't fix it no matter what I tried. Logical option was to backup /home and then reinstall linux
Two days later I want to die, for whatever reason I can't properly boot from a live USB without getting "input/output error", and I've already erased my previous linux installation at this point.
Anyway, I still have windows, and I think that the problem might be faulty RAM (I get i/o errors with any live USB) so I booted into windows, let it do some updates and now I'm checking my memory
After this, I'm going to open up my PC and check that the RAM sticks are all in properly
9 -
Dude GoogleAuth is pure nonsense magic. On one line you get your auth-instance from gapi.auth2.init..
But then you render the auth-button with a static method aka gapi.signin2.render (which has some kind of success and error handlers, but don't worry, they fire randomly, they won't help you debug this api mess)
SOME-FUCKING-HOW this static signin2.rendershit knows of your auth2 instance and it works. But actually it makes no sense and is just a big mess of api-calls. Google, get your shit together, this ain't pretty.
Oh and forget your informative console.log.. this shit will get erased everytime you try something because of "Navigated to https://accounts.google.com/o/...". why ever the fuck this clears the console even tho it doesn't affect the top window. So preserve that fucking log and drown in a mass of bullshit.
In the end, as it is with everything, it somehow works. But FFS that's some weird api design Google has going on..4 -
I'm studying atm and I survived Haskell, SKI, ... now, in the second semester we started with Python (yeay ♡) and Java (that's fine).
One of the first exercises is about installing Jython ('cause it's good, right? /sarcasm off), using the lecturer's module and write some code for it. It's about painting some shitty graphics *gasp*...
I use PyCharm (not really necessary for these crappy exercises) and programming on Windows and/or Linux.
Downloaded Jython, installed it, set it as interpreter - works fine (win10, pycharm).
Some students got weird errors using linux - for me it's the same but meh Idc.
Today I tried using Jython on my notebook, too (win10, pycharm). Downloaded it from the Jython Project website. Can't update pip, can't run modules - error is about fckin charsets...
Some other student figured out - wrong version of Jython. The newer version has some bug fixes.
2.7.1 is the one and only - the download section of their website offers 2.7.0 as latest release...
So - how to know there is a version 2.7.1?
#1 version control website = Wikipedia
So... there is a blog, guy's writing about this release - this installer is hosted at maven central. Yeay. Obvious. Thanks.
Can't describe such stupidity - maybe it's the user again 😂 -
why... WHY do I always attract all sorts of weird problems...
I feel like it makes me look incompetent :/
Like this side-gig. I had a client who brought us essentially half a rack (20 blade servers, 7 units of network equipment) and asked us to spin it up. No passwords, no topology - nothing. It was my first such "project".
So I'm setting it all up, using chatgpt and notions of vlan theory from college years ago. I managed to make smth work. Went away for the rest of the day. Hours later I come back -- no longer can connect to ovpn running on a MikroTik router. wtf... connect to office router's vpn, winbox via mac to the router to see wtf. Everything seems alright, except when I try to `/ip route print` it just hangs there. Tried a few times. -- same result. As if routes just got borked while noone was touching it. Found someone who's working with networks wtf, he said he's NEVER seen this happening. A router reboot sorted this out. That's weird problem #1.
I finished reverse-engineering and re-setting up the networking, sketched a topology with patching scheme and asked colleagues to take it all to the DC. They did it, connected it all up. 5 nodes aren't accessible via network. So I connect remotely to the router's openvpn and try to see what's up. Indeed, some servers are reachable, others aren't; even though MT switch (router's downlink) sees those servers plugged in with link up, servers don't see the link. I noticed some ports aren't trunking some VLANs. I started adding those ports when the winbox connection dropped out of the blue. 5-4-3-2-1-reconnecting... it reconnected. Yayy!! But wait, where is everything...? All interfaces -- gone (physical ones too). All IPs -- gone. All routes -- gone. Everything's gone. Half a minute later I'm disconnected again. The switch IP is no longer pingable. Servers plugged into it aren't reachable either. That's weird problem #2.
Then I figured I might try to see whether I can see anything from the router level. Try to ssh to it -- attempt was dropped, as if 22/tcp was closed. wtf? It was working in the office. winbox into it -- yayy, that works. Try to open a terminal via winbox -- a dialog pops up "Terminal <1> - not permitted (9)". wtf..? I Google this error up, it says that user is a member of group that does not have telnet and ssh permission. Indeed, I loog into groups -- the group 'admin' does not have them. Try to add them -- also not permitted. And I'm the 'admin' user, a single user in the router after a factory reset. How the hell else do I change permissions if even admin is flipped a finger.
That's weird problem #3
And now I look like an incompetent prick with two left hands who is only breaking shit.
And it's been like that my whole career
Why... How... ffs, that's getting annoying. Maybe I should downgrade myself to a QA. Problems find me themselves, I don't even have to look for them2 -
Little addition on my rant about the enter and leave instructions being better than push mov sub for stackframes:
I had that debate with a friend of mine, who tried the same code ... and failed to get enter to be as fast. Infact, for him, enter was twice as slow, on his older computer even 3times as slow.
Mhh... pretty bad. basically blows up my whole point.
I tried the code on my computer... Can't reproduce the error.
Weird.
"Which CPU are you on?"
>"I'm on Intel"
Both of his computers are on intel. I use an amd ryzeni1600. Now this might be a bit of a fast conclusion, but I think that its safe to say that intel should atleast do better for SOME parts of their CPUs.9 -
I don't want too often about window but this....
I'm just trying to set the language from German to Dutch. I have changed everything from Germans to Dutch in the idiotic Settings and in the proper Control Panel. Still German...
Okay. Let's delete German all together and reboot... Still fucking nothing. Wth?
Eventually downloaded the package manually. Running LPKSETUP gives me the option to install it and remove German.
WHY THE FUCK WAS GERMAN THE ONLY LANGUAGE THERE AND WHY WAS IT STILL THERE?!
I FUCKING REMOVED THE LANGUAGE IN ALL SETTINGS AND CONTROL PANEL.
MICROSOFT CAN GET FUCKED IN THE ASS WITH A CACTUS FOR MAKING IT NEAR IMPOSSIBLE TO CHANGE LANGUAGES.
I still think it's weird because I could change my own Windows from Dutch to English just by changing it in the stupid Settings app
(while typing this rant an error occured. Just error. Nothing more. So Dutch still isn't installed. Fucking fuck)4 -
Maxi-Rant, rest in the first comment!
Yay, I've caught up with my "watch later" list on YouTube! Next thing: Just quickly go through my subscribed channels and add old videos that I haven't seen yet to the watch later list so that I have more stuff to watch the next months. The easiest way to do that is to go to the "all uploads" playlist of the channel (that is luckily always linked now, it used to be hidden sometimes) and use "add all to" to get them on my playlist. Then sort out the stuff that I've already seen and turn on automatic sorting by date, easy. Yeah...
Firstly, in the new design there's no "add all to", I have to go to the old design. For my own playlists, there's a handy "edit" button to do that, but on other pages I have to do it manually. Luckily I have set Ctrl+Shift+1 as a shortcut for "&disable_polymer=true" long ago.
Next surprise: On "all uploads" playlists, there is no "add all to" button. It's on every single other playlist on YouTube, including "liked", "watch later", "favourites" and so on, just not there.
Fine, I'll just abuse my subscription playlist script that I already have by making a copy of it, putting the channel IDs in it and setting the last execution date to 1.1.2001. Little problem with that: Google apps scripts can run for at most 5 minutes and the YouTube API restricts it to add one video per second. So it doesn't work for more than 300 videos. I could now try to split it up by dates, but I didn't write the script myself and I don't know how it sorts the videos to add, so I'll just google for another solution instead.
Found one: Go to the video overview of the channel in the old layout, Ctrl+Shift+I, paste this little Javascript thing and it automatically clicks all the little clocks that add the video to the watch later list. Yay, that works! Ok, i'm restricted to 5000 videos, because that's the maximum size of a YouTube playlist, so I can't immediately add all 8000+, but whatever, that's a minor problem and I'll sort out later anyway. Still another little problem: For some reason I can't automatically sort the watch later list. Because that would be too easy.
But whatever, I'll just use "add all to" from there to add it to my creatively named "WL" list. If that thing is restricted by the same rate limit of 1 video per second, it should be done in about 1½ hours. A bit long, but hey, I'm dealing with 5000 videos. Waiting 2 hours... Waiting 3 hours... Nothing happens. It would be nice if it at least added them one by one, but no, it waits an eternity and then adds all at once. At least in theory, right now it does absolutely nothing.
Shortly considered running it for more hours or even days on my Raspberry Pi, but that thing already struggles when using Chromium normally, I shouldn't bother it with anything that has to do with 5000 videos.
Ok, what else can I do then? Googling, trying out different things, mainly external services that have their own concept of "playlists" and can then add them to an arbitrary playlist later...
Even tried writing my own Java program with the YouTube API, but after about an hour not even the example program in the YouTube API tutorial worked (50 errors and even more open questions, woohoo), so I discarded that idea.
Then I discovered "DiskYT". Everything looked like it would work and I'm still convinced that I can do it with that little pile of shit. Why is it a pile of shit? Well, for example the site reloads itself after a while, so it can at most add 700 videos to a playlist. Also I can't just paste the channel link (even though it recognises those links, but just to show an error message that it can't copy from channels). I can't enter/paste URLs, I have to drag them. The site saves absolutely nothing (should in theory work, but in practise it doesn't), so I have to re-drag everything on every try. In one network, the "authorise YouTube" button (that I have to press again on every computer) does absolutely nothing ("inspect" reveals that there isn't even any action bound to the button), in another network the page mostly doesn't work at all or the button to copy from playlists is suddenly gone or other weird stuff. Luckily I have the WiFi at home, there it works in theory. But just on my desktop PC, no other device, wow. I tried to run it on my new laptop, but it's so new that it still has the preinstalled OS and there I can't deactivate going to standby when closing the laptop, so while I expected it to add 5000 videos, it instead added 4 and went to standby. But doesn't matter, because it would have failed at about 700 anyway. Every time I try to use this website, I get new problems, but it seems to still be the best option, because everything else just doesn't do anything. This page at least got to 700 before.
Continuing in first comment!4 -
So the saga of broken fucking everything continues at work, and I'm managing it, effectively, and doing it correctly on the first go-round. It's a long process though, because the two retards who preceded me were equally inept for completely different, yet equally disruptive and destructive reasons. The first dude was just plain psychotic, probably still is. I'd post some of his code, but I don't want anyone's face to melt off like those Nazi dudes at the end of Raiders of the Lost Ark. I can handle it because I'm constantly inebriated, which is not as fun as it sounds. If you have to ask yourself if you can handle it, you probably aren't, unless you've had to Uber to/from work due to still being fucking drunk. Anyway, enough about that, and it was only like twice. The rest of the times, I was more blazed than Jerry Garcia at a weed smoking contest. Moving along.
UPS shipping labels broke two weeks ago, I fixed it, but these fucking 10xers jointly decided to not only never implement anything resembling error handling, other than EMPTY GOD DAMN "try/catch"es (empty catch, wow so efficient), and instead of using COMMENTS, which I know are a new thing, they'd wrap blocks of code in something like: if 1 = 0 {} FUCK YOU DICKFACES. As I was saying before I got emotional again, they tied the success to all kinds of unrelated, irrelevant shit. I'm literally needle/haystacking my way through the entire 200GB codebase, ALONE, trying to find all the borked things. Helpfully, my phone is ringing all the time from customer service, complaining about things that are either nothing to do with the site, or due to user stupidity, 75% of the time.
A certain department at my company relies on some pretty specific documents to do their job, and these documents are/were generated from data in the database. So until I can find and fix all of the things, I've diverted my own attention as much as possible to the rapid implementation of a report generation microservice so that no one elses work is further disrupted while I continue my cursed easter egg hunt from fucking hell.
After a little more than two days, I'm about to lauch a standalone MS to handle the reports, and it's unfortunately more complicated than I'd like, because it requires a certain library that isn't available on Winblows, so I've dockerized the application. Anyway, just after lunch, I've finished my final round of tests, and I'm about ready to begin migrating it to the server and setting up (shitty fucking shit) IIS to serve it appropriately. At this point, this particular report has been unavailable by web for about 8 days.
A little after lunch, and with no forewarning of any kind, the manager of managers runs upstairs and screams at me to "work faster" and that "this needs to be back online RIGHT NOW", but I also know that this individual is going to throw a fit if things on this pdf aren't a pixel perfect match. So I just say "that's some amazing advice, I wish I'd had the foresight to just do it better and work faster". Silence for a good five seconds, then I follow up with "please leave and let me get back to my work". At that moment from around the corner, my "supervisor" suddenly, magically even, remembers that he has had the ability to print this crucial, amazingly super fucking important document all along, despite me directly asking him a week ago, and he prints it and takes it where it needs to go. In the time that it takes him to go to that other department and return, I deploy my service.
I spent the rest of the day browsing indeed and linkedin jobs, but damn this market is kinda weird right now, yeah?2 -
I don't usually do web development,
Today I said to myself I should refactor and improve my personal site. Like adding widgets and shit.
I remembered why I don't do web development. I hate it, I don't know much about it, I'm bad at it, and I can't do shit if I don't get spammed with error messages. I hate that when something goes wrong everything doesn't just crash and burn but it keeps going. I know that it sounds weird but I got used to having a single line wrong and all the project crashing. And I wouldn't know whats wrong if it doesn't give me constant feedback.
I guess I will just use Django for web development then..1 -
My final year taking a B.Sc. I'm writing up my Distributed Systems project, the day before handing it in. It's on top of Transis, and source code is "stored" in RCS (yes, I'm that old). The project is a reliable system administration tool, that performs the same action across a cluster with guaranteed semantics.
I'm very proud of the semantics, but cannot figure out why the subdirectory installation stuff works almost but not quite. Here's my sequence of actions:
1. Install across all machines.
2. Manually see it's broken.
3. "rm -rf *".
4. Repeat.
What in to discover is that the subdirectory installation always finishes off in a current directory 1 level higher than where it started. Oh, and the entire cluster sees my NFS home directory. Oh, and I'm running each cluster member in a deep subdirectory of my dev directory. Oh, and my RCS files live in a subdirectory of my dev directory.
All of a sudden, my 5 concurrent "rm -rf *"s were printing weird error messages about ENOENT and not being able to find some inodes. In a belated flash of brilliance, I figure out all the above, and also that I've just deleted my dev directory. 5 times, concurrently. And the RCS files.
That was the day a kindly sysadmin taught me than NetApps have these .snapshot directories. -
Finally an error I can understand with ease. Up until now, I’ve been getting these weird arbitrary errors that make no sense to me.
I tried to wake my MacBook and the thing hung. I have it some time, and it restarted, restored all windows, and let me know it was a “Sleep Wake Failure”.
Honestly I don’t mind getting an error occasionally. But when the error says “UNEXPECTED_KERNEL_MODE_TRAP” while I’m gaming on Windows, it annoys me.
Also having WebKit crash the webpage on me without telling me what happened also gets me mad.
TL;DR: Make understandable error messages.2 -
Today a colleague received a weird Excel message, it reads:
Unexpected error
Unfortunately a problem has occurred. Restart Excel, in case the problem persists.
Copy details
The action buttons are awesome!
Send frowns / Close :D
It'd be interesting to see what kind of frowns are being sent there... :D
4 -
Trying to build a ros workspace inside VMware...
Called up the teammate who put it together:
Me: hey the workspace isn't building for me, do I need to setup anything before I type "make"?
Him: nah dude just type make and ur good, why what error are you getting?
Me: *describes error*
Him: oh lol I never got that error before, idk maybe your machine is just dumb
Me: *uh ok sure dude* let me try some other stuff
*Boots to native install of Ubuntu*
*Build successful*
Me: oh huh that's weird it built on my native installation but not on the VM
Him: oh lol that's not my problem
Seriously dude? First off, screw you Ros for not being able to build in a VM. Secondly, it's entirely your problem! Linux is nice to use, sure, but it's a bit of a problem when the entire team runs off Mac!
😲😲😲😣😥😫😓 -
My god why are all parser combinator libraries in Rust so bad??
Is it too much to ask for to parse a normal ass programming language with error recovery???? That's like 99.99% of what people need a parsing library for and somehow error recovery is always some weird after thought bandaged on after the fact
For fucks sake, I'm finally getting over the urge to reinvent the wheel all the time, but now all the libraries suck ass so I have to. Arrghh!17 -
Last weekend I was working on a small project for a friend of mine: a dockerized webapp, plus API backend and DB. I had some problems with the installation on the vps and had to try out different images and never really did a complete setup of my usual dotfiles. Got it running on an Ubuntu distro. Everything great.
It was the first release so I still had to check that every configuration worked ok, like letsencrypt companion container, the reverse proxy and all that stuff, so I decided to clone the whole project on the server tho make the changes there and then commit them from there.
Docker compose, 10 lines of code, change the hosts and password. Boom everything working. Great... Except for the images in the webapp.
WTF? Check the repo, here they are, all ok. I try different build tactics. Nothing. Even building the app on another docker always the same. Checked browser cache, all the correct ports are open. I even though that maybe react was still using some weird websocket I didn't know, but no.
Damn, I spent 5 hours checking why the f*** the server wouldn't make it out.
Then, finally, the realization...
I didn't install the f******* git-lfs plugin and all I was working with were stupid symbolics links! Webpack never even throw an error for any of the stupid images and the browser would only show a corrupted image, when decoding the base64 string.
Literally the solution took 5 minutes.
F*** changes on production, now I do everything on a fully automated CI. -
Day one of my first big project.
It felt weird but a little easy to grasp discord.py but I felt like I was just copying people as I read or watched tutorials on how to use things and how they work and while I was getting started In general. But I got the dice function working great. I had an error but I fixed it.
After I got it working I uploaded it to my friends server and they messed around with it and it felt so great because they were enjoying it and complimenting me and I’m not even done with it :)
I’m learning a lot but I’m also struggling with certain areas like finding good documentation or feeling like I’m just copying.. but I’m gonna keep doing these update things because I feel cool and official as I write these :^) -
Fuck those weird encoding issues with Python! I've read the HowTo Unicode 10 or 20 times and I still got those 'ordinal not in range error'!!!2
-
Scala lang is hard to learn(not saying that sucks), but first I don't want to learn this language, I just wanted to use some functions for a hobby project and this project I found on internet had all I need so I just wanted to translate it to Python, using an online Scala compiler I pasted the functions I needed anddddd error can't compile it it, because the functions had some extra things that were not part in the file where functions were, these things check for null values(?) so I was looking into the project where these "keywords" comes from and I can't find it, so after some grep in the project files I found the "keyword" I was able to compile it, also I weird thing about this language is that there is no return keyword
So yes I find this lang not that intuitive (for me at least)4 -
Fantasizing about stabbing SharePoint in the throat, I'm being forced to contact Microsoft tech support, so I need to obtain our software assurance account info.
Our company's rep sends me our SA account numbers (assuming that was all I needed) and the link to create an incident.
Step through Microsoft support ticket 'wizard' which ends with requiring a login with a Microsoft account.
Me: "What login account should I be using?"
Rep: "You shouldn't need one. Just use the SA account number and access ID I sent you."
Me: "There is no entry for those values. I step through a support 'wizard' and the final page redirects me to the Microsoft login page."
Rep: "Use your work email address."
Me: "I can, but I shouldn't have to use my personal outlook email address. Can I just send you the issue and you submit the ticket? After the ticket is created, all the correspondence will be through email anyway."
<30 min. later>
Rep: "I just linked your work email address to your company's account. You should be able to login now."
Me: "Same error. I think you're messing with me."
<30 min. later>
Rep: "Select the option to create an account with your own email."
Me: "Now I know you're messing with me. Already tried that and received the error 'You cant sign up here with a work or school email address'."
Rep: "Weird...I guess Microsoft changed their policy."
Me: "So now what?"
<1 hour later>
Rep: "You might have to send me your SharePoint issue and I'll get a ticket created. After the ticket is created, I'll change the contact email address to you."
WHY DIDN'T YOU DO THAT TWO HOURS AGO!
Whew! Thanks devRant...that's better. I put the knife down and now only want to punch SharePoint in the face.3 -
What the fuck is happening with Windows 10 after April 2018 update?
1. Opened my local github repo in external drive
2. Made changes
3. Try to stage, get this weird "error: unable to open object pack directory: .git/objects/pack: Function not implemented" error.
4. Googled it, says check drive for errors.
5. Scanned drive, fixed error, drive has no errors.
6. Opened my repo, all file sizes are "ZERO", including my changed work, gone, poof. -
how is it that the android emulator in android studio runs buttery smooth on my up-to-date linux ryzen setup with just few terminal commands to set up, while my up-to-date windows version has some bullshit problem with virtualization, even with SVM on, Hypervisor all good, and yet crashes with a WHPX(?) error?
i mean ok i don't have an intel at hand but still the problem should be fixed by now according to google docs. even the fixes provided by the internet didn't help. this twist between windows and linux is very weird on my machine.1 -
Weird error message from webpage: "Hello, my name is Inigo Montoya. You killed my webpage. Prepare to die".
It's a Princess Bride parody...
Developers get creative (or bored) these days with error messages.. Yes, one of those again.4 -
I have a weird problem ...
There’s an existing swift app, with Apple sign in implemented and working.
When I took over I had to revoke app certificates and create new one. Since then the Apple sign in stopped working.
I’ve tried clean rebuild etc , even tried renewing old profiles with the new cert but nothing is working.
When u do Apple sign in it says “sign up not completed” with no error msg.
Old dev says it happened last time when cert/profile was changed but fixed on proper rebuild. Not fixing for me.
Anybody else faced this?5 -
I'm not sure who the fuck implemented the error handling of spring boot but goddamn he/she needs to be fired. Why the fuck does the application return a weird error about a setting not being set when it can't connect to a database?? Wtf took an hour to solve and that's not the only thing I hate about spring boot. Why is the documention utter garbage, why do I have to rely on tutorials and can't I just read in the documentation how for example the http rest mapping works. Now I have to cross-reference multiple tutorials to find the best way because guess what there are multiple ways to do something in this framework and some tutorials don't even work.
-
I had seen a meme the other day about the "Application has stopped working" window, which always shows the same answer for all. Why? And why does it say "We'll notify you when there's a solution" when this doesn't happen at all?
-
can 2 modal which is static have a race condition error? I’m trying to fix a bug and when I showed it to my senior , I said maybe because of the first modal the style is not being applied on the second modal he then said “it might be a race condition” and I almost choked on my own saliva.
Ps: the first modal will show a loading text and a gif after that the second modal shows with some data.
I got confused how he think that it might be a race condition. We’re not doing webworks on the front end. Weird.2 -
#Suphle Rant 9: verbatim exception scare
In multiple rants, I've bitched about laravel stealing suphle features. By some very weird coincidence, it appears I've been given a taste of my own medicine. Let me explain:
We're having a chat this morning on a laravel group chat when someone says he uses their notification component a great deal. Curious, I ask him what he uses it for since I only used it sparingly during my laravel days. To pry an answer out of him, I ask whether he uses them for sending app error alerts to a slack channel, and he responds with an eerily familiar term. I quickly look it up and the results on the docs are chilling: errors can be sent to bugsnag (which suphle has an integration for), sentry and Co. Errors can either be broadcast or disabled. Specific kinds of errors can be caught. My heart sunk. My brother called for something while I was going through it and I was struggling to pull myself together
Their exception component is almost identical to mine and I'm only just realising. It's shameful that I'm just learning about functionality present since 5.8. I thought my creation was novel. BUT! The good news is, the implementation differs
Too many errors went unnoticed during my time there because error broadcasting is optional. Since none of my colleagues read that part of the documentation, we were firefighting by pulling and wrangling production error logs. This informed their abolishment in suphle altogether
A relatively minor difference is in the APIs –their philosophy makes significant use of global functions, violating SRP, etc.
But the most important difference, that still cheers me up, is that they only catch known errors. Suphle has a construct for isolating calls to a decorated service. Any unforeseen error to occur during its execution will do a series of things before control is returned to the caller -
//not a rant
Ok so weird bug. Fellow C# people, help me out.
//already made it work so no I don't need to post it on SO
I write a Switch Case block based on the user's combo-box selection id.
if id 0, add everything to the mainpage grid
if 1, a foreach loop filtering out the ones with a certain attribute of the object as false and adding em to the grid on the mainpage
if 2, similar scenario as 1.
Countless times I had a null exception with the "count" variable being the number of items in the post which, wasn't null. there was no other variable that was being initialized from within the block, so I had no idea what was causing it.
Moving to an if-else statement doing the same thing, same issue.
In the end I created 2 empty lists before the switch case and filled them up and then another loop filling the mainpage grid with the now-filled list.
In the end im doing the same thing, with no issues, but I don't understand why adding it directly caused an error, what was null?
I wanna understand the working that might be causing this.. if anyone else came across this, would be glad to hear from you8 -
I have been facing a weird error which is that I cannot import firebase, I tried compat, re-installing, etc.
If you know about it, please help me...
import firebase from 'firebase';
//import * as firebase from 'firebase/app';
//import firebase from 'firebase/app';
all of above does not work
the error is Module not found: Can't resolve 'firebase'
my firebase version is 9.1.24 -
To all the docker users in this platform, have you ever dockerized a spa with OAuth 2.0 Implicit grant?
I am getting this weird 404 error after I get the AT and redirection happens. This is so frustrating!!!! -
Are dev's pussies everywhere now ?
https://github.com/yellowfeather/...
Simple error.
He did what most people do and said 'oh this is already working. always was working, never would not work.'
add a fiddle indicating, 'no, whatever update was added for some reason most emphatically is NOT working'
get a 'code of conduct' suggestion, for mentioning the circular bs around and around in time when the original guy is probably dead.
betcha anything its not fixed :P
betcha he left the code in place :P
god its like overnight devs decided to be grumpy assholes in a sneaky way, like the faggot barry I described at one point, because they wilt when directly approached and emotion is added in besides their weird bug eyed, watery eyed, teary eyed, horrified because they're now all baby touchers, bullshit.18




