*Mom shows me laptop ad of 3000 bucks with the most overkill specs ever*

Mom: "Son, will this laptop run Google?"

Me: "Do you want to surf Google or actually run Google's server?"

Mom: *looks confused*

"I also want to use Fesabook on it"

Me: *brings her a 5 year old laptop with a new ssd in it*

*has an old i3, 8gb ram and no gpu*

Mom: "This laptop is super fast! Thanks son!"

*One hour later*

*Mom calls*

"Son, I think the laptop broke"

Me: "What? What happened?"

Mom: "I pressed a button and now all the keys are lighting red" (backlit keyboard)

Me: "You can choose the color of your keyboard mom"

Mom: "Ooh! How do I make it pink?"

Me: "You can only choose between red and blue..."

Mom: "What a ripoff"

*Hangs up the phone*

*computer fell, broken in pieces*

Me calling [Microsoft] tech support: hey can you check my warranty on this computer, I think I broke it?

Tech support: yes sir but we must first go through the troubleshooting steps,

Me: no, no I just-

Tech support: have you tried pressing F8 sir?

Me: umm… no, look I'm just -

Tech support: sir please press the F8 key sir

Me: okay… I pressed it, now can you just check my-

Tech support: sir please what happened when you pressed F8?

Me: it's broken, now if you could just check my warranty -

Tech support: sir I'm sorry sir I think you did it wrong. Please press F8

Me: no just check my-

Tech support: sir I think you do not understand, sir it is at the top-

Yup.

Father bought a PC in 1997. Back then very few had it. I learned doing things like accessing the internet and sending emails, among others. I remember having added age on websites to be allowed to sign up at times :P My sisters used to play games on it sometimes. The first few ones we had were Tomb Raider: The Last Revelation, Tomb Raider Chronicles, American McGee's Alice(Which caused us to upgrade the PC xD)... And some others.

I have a memory of this pseudo-3D-looking game where you move in a maze and try answering questions. I want to remember its name, but I cannot :(

We literally have video evidence of me liking the computer as a child, yet my parents either say I'm addicted or deny I've ever liked it before. Not only that, but continuously limiting my time with the PC hasn't been a literal obstacle in my way of trying to do things in their opinion. Funny how my parents think the last few years I've been my worst when they've hurt me in those years so much that our relationship is guaranteed not working out. There were doubts in my head before, but now it's cemented and there is no way of going back. Father, for example, tells me it's too late to do anything with a PC now(As well as how I've been unable to use the PC. He looks at these pro players' footage in some TV show and he's like, „You've been unable to use your hobbies“, as if they have never ever screamed at me for perceived gaming and not actually cared to check), and I need to look for a „real“ job.

Sorry. I went to bed at 2:00 in the morning. Feel like a zombie because of ongoing weirdly insufficient sleep, even though I sleep kinda more than normal. Even when I took Melatonine for that it didn't help at all.

Childhood was where beating began. I was about 6/7. Right when I entered school. The first school that I attended was a private one and supposedly for „Wunderkinds“, while in reality I haven't seen a SINGLE teacher or psychologist approve of it, their argument being that children were basically drowned in work that wasn't age-appropriate(I don't mean anything bad. Just that teaching about Galaxies and all in first grade isn't the brightest idea). There was always a mountain of homework to do and as opposed to some other countries, we had to do it on a day to day basis. We didn't have a week-long deadline. I was predictably not keeping up with it as I could have, had it been a normal amount, so my parents decided I didn't want to study and began their methods of getting me to „study“. I have yet to see a person able to keep up with that school's tempo, no matter the age.

This place was also where I got bullied. I felt I had nowhere to be: At home, the parents' situation, at school, the bully. I never really went outside to play with other children, so I missed that part of childhood.

After the second year of school I was transferred to an advanced German school, called like that because they taught German and not English there. I also got to learn a bit of Russian before they removed it from school. In that period I used to attend ballet. But for less than a year. And piano, which I remember having attended for quite a long while, some years, if my memory isn't fried. I quit it because of it having been forced on me. Last piece I ever played fully was Beethoven's Marmotte.

In this school I was once again the outcast of the class. I had some people to interact with. All of those interactions lasted a few years at most. Then, because of a part of my class choosing me as a laughing-stock N2 and another girl as the N1, I found my best friend, who I still have today. She's the only friend I have nearby.

Most of the time I hated myself. Even today I struggle with that sometimes.

After that came university. This us where I got something like a friend circle at last. But it still didn't last. I got in a relationship with one of the guys, but I was just attracted. There was another I couldn't dare getting close to. Turns out he also had something for me. Then he disappeared from our lives and a year after, I still cannot forget the person. If I want to, I have to deprive myself of my own personality. Not a thing I'm willing to give up. Then I broke up with the guy I was in a relationship with and completely disappeared from the friendship circle. To be honest, I had reasons to. They refused to even try to look for the guy and they called him a friend for years. Sometimes parents hitting me can occur even today, but if I REALLY piss them off.

Now I'm here and oh, my God, I'm officially am aunt now! My sister gave birth to a daughter this morning... She's in Berlin with mother and both she and the child are doing great. I just hope she manages to be a good mother.

The problem with being a programmer...

I just broke up with a girl I've been seeing the past 2 months, that I was really into.

But in the end, it became a question of, either i'm with her, or I'm with my work.

I don't think that would happen with other professions, at least, not as easily.

I think, with other professions or projects, you tell someone "I need to work" and it's really fucking understood. "Ok, you need to work"

They understand it. If I was a lawyer.. I have a case. if I was a carpenter, I have a wall to build,
or a house. Etc. All understood things. Or physical things that can be seen.

But with programming, first of all, I work my own hours, I write software and then sell it. I do it all myself, I own my own business. I don't have normal hours like a job, but I do know my requirements, which is at LEAST 8 hours a day of solid, uninterrupted work.

If I had a "job" it would be like "gotta go to work" and that would be it.

But, because I work for myself, and because the things I build, aren't like something you physically see, nobody gets it.

My parents, as supportive as they are, will never understand how I just implemented a new design pattern and like, leveled up because of it.

They see software... buttons, and even then, when I try to explain what excites me, it's like trying to get a 3 year old interested in calculus.

How could they possibly understand the richness of what I do, how fulfilling it is
and how much I love it, when all they see
is me on a computer, clicking keys.

The same for this girl I dated.

The only place I feel where people understand,
is here.

Do you have any similar experiences to share?
Would love to hear it right now.

I'm not an iOS expert, I just wanted to get Google ads on my iOS app so that I could make a few petty dollars at the expense of my users. Is that too much to ask?

I started by following Google's instructions: install cocoapods, copy and paste some swift code... Compile failed, app broke. Carefully retrace my steps. Nothing.

Stackoverflow (praise be with them) suggests upgrading Xcode. Go to app store and click to upgrade Xcode. No progress bar, no status updates, just that pissy little spinner for several minutes. I become impatient try a few more times. It ain't happening.

Stackoverflow (holy of holies, defender of the weak) points me to an alternate source for Xcode, on the app store dev console. 4GB and some time later, an attempt to unzip gives "unknown error". Genocide of sorts.

Stackoverflow (all that is pure, all that is kind, all... I think you get it) says upgrade your OS. I tried months ago but I had issues with that pissy little spinner. Persist. 5GB and a "heavy-year" of time later (sorry), it installs. Then Xcode installs. Then bar a few errors, the app compiles.

So after almost 24 hours, life resumes. The lesson.. respond to all obscure iOS errors by upgrading. If fully upgraded, calmly acquire a baseball bat and destroy your machine. Make sure you have a good book nearby in case of either event.

Thank you for reading my rant. Now if you'll excuse me, I have to pay Apple
$150 so that I may list my app in the app store.

This rant is a confession I had to make, for all of you out there having a bad time (or year), this story is for you.

Last year, I joined devRant and after a month, I was hired at a local company as an IT god (just joking but not far from what they expected from me), developer, web admin, printer configurator (of course) and all that in my country it's just called "the tech guy", as some of you may know.

I wasn't in immediate need for a full-time job, I had already started to work as a freelancer then and I was doing pretty good. But, you know how it goes, you can always aim for more and that's what I did.

The workspace was the usual, two rooms, one for us employees and one for the bosses (there were two bosses).

Let me tell you right now. I don't hate people, even if I get mad or irritated, I never feel hatred inside me or the need to think bad of someone. But, one of the two bosses made me discover that feeling of hate.

He had a snake-shaped face (I don't think that was random), and he always laughed at his jokes. He was always shouting at me because he was a nervous person, more than normal. He had a tone in his voice like he knew everything. Early on, after being yelled for no reason a dozen of times, I decided that this was not a place for me.

After just two months of doing everything, from tech support to Photoshop and to building websites with WordPress, I gave my one month's notice, or so I thought. I was confronted by the bosses, one of which was a cousin of mine and he was really ok with me leaving and said that I just had to find a person to replace me which was an easy task. Now, the other boss, the evil one, looked me on the eye and said "you're not going anywhere".

I was frozen like, "I can't stay here". He smiled like a snake he was and said "come on, you got this we are counting on you and we are really satisfied with how you are performing till now". I couldn't shake him, I was already sweating. He was rolling his eyes constantly like saying "ok, you are wasting my time now" and left to go to some basketball practice or something.

So, I was stuck there, I could have caused a scene but as I told you, one of the bosses was a cousin of mine, I couldn't do anything crazy. So, I went along with it. Until the next downfall.

I decided to focus on the job and not mind for the bad boss situation but things went really wrong. After a month, I realised that the previous "tech guy" had left me with around 20 ancient Joomla - version 1.0 websites, bursting with security holes and infested with malware like a swamp. I had never seen anything like it. Everyday the websites would become defaced or the server (VPN) would start sending tons of spam cause of the malware, and going offline at the end. I was feeling hopeless.

And then the personal destruction began. I couldn't sleep, I couldn't eat. I was having panick attacks at the office's bathroom. My girlfriend almost broke up with me because I was acting like an asshole due to my anxiety issues (but in the end she was the one to "bring me back"(man, she is a keeper)) and I hadn't put a smile on my face for months. I was on the brink of depression, if not already there. Everyday I would anxiously check if the server is running because I would be the one to blame, even though I was trying to talk to the boss (the bad one was in charge of the IT department) and tell him about the problem.

And then I snapped. I finally realised that I had hit rock bottom. I said "I can't let this happen to me" and I took a deep breath. I still remember that morning, it was a life-changing moment for me. I decided to bite the bullet and stay for one more month, dealing with the stupid old server and the low intelligence business environment. So, I woke up, kissed my girlfriend (now wife), took the bus and went straight to work, and I went into the boss's office. I lied that I had found another job on another city and I had one month in order to be there on time. He was like, "so you are leaving? Is it that good a job the one you found? And when are you going? And are you sure?", and with no hesitation I just said "yup". He didn't expect it and just said "ok then", just find your replacement and you're good to go. I found the guy that would replace me, informing him of every little detail of what's going on (and I recently found out, that he is currently working for some big company nowadays, I'm really glad for him!).

I was surprised that it went so smoothly, one month later I felt the taste of freedom again, away from all the bullshit. Totally one of the best feelings out there.

I don't want to be cliche, but do believe in yourself people! Things are not what the seem.

With all that said, I want to give my special thanks to devRant for making this platform. I was inactive for some time but I was reading rants and jokes. It helped me to get through all that. I'm back now! Bless you devRant!

I'm glad that I shared this story with all of you, have an awesome day!

To replace humans with robots, because human beings are complete shit at everything they do.

I am a chemist. My alignment is not lawful good. I've produced lots of drugs. Mostly just drugs against illnesses. Mostly.

But whatever my alignment or contribution to the world as a chemist... Human chemists are just fucking terrible at their job. Not for a lack of trying, biological beings just suck at it.

Suiting up for a biosafety level lab costs time. Meatbags fuck up very often, especially when tired. Humans whine when they get acid in their face, or when they have to pour and inhale carcinogenic substances. They also work imprecisely and inaccurately, even after thousands of hours of training and practice.

Weaklings! Robots are superior!

So I replaced my coworkers with expensive flow chemistry setups with probes and solenoid fluid valves. I replaced others with CUDA simulations.

First at a pharma production & research lab, then at a genetics lab, then at an Industrial R&D lab.

Many were even replaced by Raspberry Pi's with two servos and a PH meter attached, and I broke open second hand Fischer Sci spectrophotometers to attach arduinos with WiFi boards.

The issue was that after every little overzealous weekend project, I made myself less necessary as well.

So I jumped into the infinitely deep shitpool called webdev.

App & web development is kind of comfortable, there's always one more thing to do, but there's no pressure where failure leads to fatalities (I think? Wait... do I still care?).

Super chill, if it weren't for the delusion that making people do "frontend" and "fullstack" labor isn't a gross violation of the Geneva Convention.

Quickly recognizing that I actually don't want to be tortured and suffer from nerve damage caused by VueX or have my organs slowly liquefied by the radiation from some insane transpiling centrifuge, I did what any sane person would do.

Get as far away from the potential frontend blast radius as possible, hide in a concrete bunker.

So I became a data engineer / database admin.

That's where I'm quarantining now, safely hiding from humanity behind a desk, employed to write a MySQL migration or two, setting up Redis sorted sets, adding a field to an Elastic index. That takes care of generating cognac and LSD money.

But honestly.... I actually spend most of my time these days contributing to open source repositories, especially writing & maintaining Rust libraries.

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

Looks like I'm getting fired on Wednesday :)

Long story:

*I add first unit tests to project.

*Boss adds new functionality and breaks all the tests so I can't compile and write more for what I'm working on.

*Boss is very fragile and cannot handle any comment that can possibly be taken as a slight against him.

Me: "I wanted to ask what our policy on unit tests is please? Because we haven't really said how we are treating unit tests, and everyone myself included is not thinking about them. I also haven't added tests when I fixed bugs and this time your changes broke the tests"

Boss 10 minutes later: "I want to speak to you in private".

Boss: "you are too forceful and direct. You said I should have added tests."

Me: "yeah but I didn't mean in a nasty way"

Boss getting louder and more aggressive: "You are too forceful"

Me: "I didn't mean it in a bad way"

Boss: "I didn't want to add tests for that!"

Me: "then why add any tests?"

Boss: "Fine we are not having this conversation now!"

*Boss storms out

I decided I can't speak to the guy about anything without upsetting him spoke to the manager before I quit because I can't work like this.

That resulted in a meeting with my boss, his boss and the head of HR where I ended up savaging him and told them I can't bring up anything as I can never tell if it will offend him and that I spend ages writing emails and trying to document communications because I just can never tell if I will upset him. Also that I cannot bring up any ideas because I can't tell if he will somehow get offended and that I can't even write code because if I change something he wrote at some point he will get angry.

My boss claims that I am extremely forceful and disrespectful and that I am constantly insulting him and his decisions.

We go back over a ton of shit and I refute everything he says. In the end I have to have a meeting with him on Wednesday where we either get things straight, he fires me or I quit.

I think at this point that our relationship is too fucked for him to be my team lead on a 6 man team.

Side note I keep bringing forth ideas because we have one database shared between 6 Devs, no pull requests (apart from mine and another new guy), no test driven development, no backlog, no team driven story pointing, no running tests before merging, no continuous integration setup, no integration tests, no build step on merge, no idea of if we are on track to our deadline other than his gut feeling, no actual unit tests backend - just integration with a test db, no enthusiasm to learn in the team and no hope.

Private chat pops up. (- separator for new message)

Hello
- (1 min)
Can you help me?
- (2-3 mins)
Please it's urgeeeent!!!!!
- (1 min)
Come on you're online, I see the green dot.
- (5 mins)
Ok then I won't be able to work. Will write this down in the ticket.

- (15 mins) - new private chat pops up
Hi, we need to talk.
- (3 mins)
Regarding ticket XY, why aren't you responding? It's really urgent.
- (5 mins)
Please notify me as soon as you're available, it's really important!!!

- (20 mins, new private chat opens)
Hi mate, I think the devs are up to mischief. Said you're not reachable, I'll try to poke them with the stun gun.

- (60 mins, message in the official and only endorsed support room)
@all We broke staging, <Me> never responds and <Team mate who tried to use the stun gun> wasn't helpful either.
We really need this now!!!!!!!

- 30 mins later... la me:
@all I was in a meeting with the stakeholders as we had an priority meeting... What was so important that you not only ignored the rule of not messaging privately and even ignored <team mate>s instructions?

- 5 mins later, answer
no need to be so unfriendly.... We broke staging as we had to test stuff out for next week's sprint review [something which is still 3 days away or sth like that]. We really need to take a look in the team at it and for that we must have staging working now!!!!
- (La me)
If you need it urgent now, you didn't plan ahead. And if you didn't plan ahead, you have to wait for others. The sprint review and all other important days are planned ahead for a reason.
- (Silence)

- (20 mins later, private chat, team lead)
Will you finally fix staging now?

- La me
If it could wait 3 hours now and you / your team ignored all netiquette, it can wait till next day, too. We had this discussion more than once, I don't think I need to explain this further.

(Silence)

All in all, the joys of communication...

Now the fun stuff is when this not only happens with 1 team, but many teams....

Having 35 - 40 private chats and chat window looking like a christmas tree thx to the immeasurable amount of notifications and colors... Yay...

Did I mention that I hate the ego some programmers have -.

PM: Hey Brod, I know your really busy refactoring to ES6 but I think our Ruby app broke, could you fix it?..
Me: Ask Tom, he's the only one here who knows ruby he wrote the app..
PM: I didn't want to interrupt his Skype call.
Me: he's not on Skype, that's his face, he's taking snapchats.
PM: oh, well I don't want to really interrupt that either.

SAY YOU HATE ME. JUST SAY IT.

1. There are 10 types of people in the world: those who understand binary, and those who don't.

2. How many programmers does it take to change a light bulb?
None. It's a hardware problem.

3. A SEO couple had twins. For the first time they were happy with duplicate content.

4. Why is it that programmers always confuse Halloween with Christmas?
Because 31 OCT = 25 DEC

5. Why do they call it hyper text?
Too much JAVA.

6. Why was the JavaScript developer sad?
Because he didn't Node how to Express himself

7. In order to understand recursion you must first understand recursion.

8. Why do Java developers wear glasses? Because they can't C#

9. What do you call 8 hobbits?
A hobbyte

10. Why did the developer go broke?
Because he used up all his cache

11. Why did the geek add body { padding-top: 1000px; } to his Facebook profile?
He wanted to keep a low profile.

12. An SEO expert walks into a bar, bars, pub, tavern, public house, Irish pub, drinks, beer, alcohol

13. I would tell you a UDP joke, but you might not get it.

14. 8 bytes walk into a bar, the bartenders asks "What will it be?"
One of them says, "Make us a double."

15. Two bytes meet. The first byte asks, "Are you ill?"
The second byte replies, "No, just feeling a bit off."

16. These two strings walk into a bar and sit down. The bartender says, "So what'll it be?"
The first string says, "I think I'll have a beer quag fulk boorg jdk^CjfdLk jk3s d#f67howe%^U r89nvy~~owmc63^Dz x.xvcu"
"Please excuse my friend," the second string says, "He isn't null-terminated."

17. "Knock, knock. Who's there?"
very long pause...
"Java."

18. If you put a million monkeys on a million keyboards, one of them will eventually write a Java program. The rest of them will write Perl programs.

19. There's a band called 1023MB. They haven't had any gigs yet.

20. There are only two hard things in computer science: cache invalidation, naming things, and off-by-one errors.

In the school we were using slow PCs for learning MS Office things. Every single step we did took ages. There were one guy who was an informatics antitalent: he never were able to work fluently with any electric machine from a microwave to anything smarter. In addition he was a semi-pro athlete and he had some kind of anger management issues, sometimes yelled to the teacher after a bad mark or with us when we lost a in-school soccer match. You know, he was that competitive guy.
One time on computer science class he was very focused. He tried to follow every steps precisly and his machine seemed faster than as usual. He felt like he broke some kind of wall which was between he and the machine.
When we had a break and he went out we tought that we should make a prank. We made a fullscreen screenshot from the desktop and set it as the wallpaper, then killed explorer.exe. As a result the icons and the start menu was only on the screen by the wallpaper.
When he came back he said that there were some bad news from some of the sport event he wanted to go, so he was angry. But then... You know the gif when the guy first hit the side of the screen multiple times then throws out the machine? Yeah, we saw that in real life, but not in that office. First he was just clicking everywhere, we just watched how his face just transforming. Then he started to talk just in himself as the machine could understand. After two minutes he just yelled to the machine why did it freeze, but the last drop was when the teacher said: You'll have to send me your work and it will be marked. In this moment he was just roard a huge and droped the CRT out of the window from the second floor. Luckily the window was facing to a brushy part of the garden so no one was there. He just standed there, looked out to the CRT sitting in a brush for a while, then he turned to the teacher as "Mr, I think something is wrong with my machine"

I've had many, but this is one of my favorite "OK, I'm getting fired for this" moments.

A new team in charge of source control and development standards came up with a 20 page work-instruction document for the new TFS source control structure.
The source control kingpin came from semi-large military contract company where taking a piss was probably outlined somewhere.

Maybe twice, I merged down from a release branch when I should have merged down from a dev branch, which "messed up" the flow of code that one team was working on.
Each time I was 'coached' and reminded on page 13, paragraph 5, sub-section C ... "When merging down from release, you must verify no other teams are working
on branches...blah blah blah..and if they have pending changes, use a shelfset and document the changes using Document A234-B..."

A fellow dev overheard the kingpin and the department manager in the breakroom saying if I messed up TFS one more time, I was gone.

Wasn't two days later I needed to merge up some new files to Main, and 'something' happened in TFS and a couple of files didn't get merged up. No errors, nothing.
Another team was waiting on me, so I simply added the files directly into Main. Unknown to me, the kingpin had a specific alert in TFS to notify him when someone added
files directly into Main, and I get a visit.

KP: "Did you add a couple of files directly into Main?"
Me:"Yes, I don't what happened, but the files never made it from my branch, to dev, to the review shelfset, and then to Main. I never got an error, but since
they were new files and adding a new feature, they never broke a build. Adding the files directly allowed the Web team to finish their project and deploy the
site this morning."
KP: "That is in direct violation of the standard. Didn't you read the documentation?"
Me: "Uh...well...um..yes, but that is an oddly specific case. I didn't think I hurt any.."
KP: "Ha ha...hurt? That's why we have standards. The document clearly states on page 18, paragraph 9, no files may ever be created in Main."
Me: "Really? I don't remember reading that."
<I navigate to the document, page 18, paragraph 9>
Me: "Um...no, it doesn't say that. The document only talks about merging process from a lower branch to Main."
KP: "Exactly. It is forbidden to create files directly in Main."
Me: "No, doesn't say that anywhere."
KP: "That is the spirit of the document. You violated the spirit of what we're trying to accomplish here."
Me: "You gotta be fracking kidding me."

KP grumbles something, goes back to his desk. Maybe a minute later he leaves the IS office, and the department manager leaves his office.

It was after 5:00PM, they never came back, so I headed home worried if I had a job in the morning.

I decided to come in a little early to snoop around, I knew where HR kept their terminated employee documents, and my badge wouldn't let me in the building.

Oh crap.

It was a shift change, so was able to walk in with the warehouse workers in another part of the building (many knew me, so nothing seemed that odd), and to my desk.

I tried to log into my computer...account locked. Oh crap..this was it. I'm done. I fill my computer backpack with as much personal items as I could, and started down the hallway when I meet one of our FS accountants.

L: "Hey, did your card let you in the building this morning? Mine didn't work. I had to walk around to the warehouse entrance and my computer account is locked. None of us can get into the system."

*whew!* is an understatement. Found out later the user account server crashed, which locked out everybody.

Never found out what kingpin and the dev manager left to talk about, but I at least still had a job.

Ok story of my most most recent job search (not sure devRant could handle the load if I was to go through them all)

First a little backstory on why I needed to search for a new job:

Joined a small startup in the blockchain space. They were funded through grants from a non-profit setup by the folks who invented the blockchain and raised funds (they gave those funds out to companies willing to build the various pieces of the network and tools).

We were one of a handful of companies working on the early stages of the network. We built numerous "first"s on the network and spent the majority of our time finding bugs and issues and asking others to fix them so it would become possible, for us to do what we signed up for. We ended up having to build multiple server side applications as middleware to plug massive gaps. All going great, had a lot of success, were told face to face by the foundation not to worry about securing more funds at least for the near term as we were "critical to the success of the network".

1 month later a bug was discovered in our major product, was nasty and we had to take it offline. Nobody lost any funds.

1-2 months later again, the inventor of the blockchain (His majesty, Lord dickhead of cuntinstein) decided to join the foundation as he wasn't happy with the orgs progress and where the network now stood. Immediately says "see that small startup over there ... yeah I hate them. Blackball them from getting anymore money. Use them as an example to others that we are not afraid to cut funds if you fuck up"

Our CEO was informed. He asked for meetings with numerous people, including His royal highness, lord cockbag of never-wrong. The others told our CEO that they didn't agree with the decision, but their hands were tied and they were deeply sorry. Our CEO's pleas with The ghost of Christmas cuntyness, just fell on deaf ears.

CEO broke the news to us, he had 3 weeks of funds left to pay salaries. He'd pay us to keep things going and do whatever we could to reduce server costs, so we could leave everything up long enough for our users to migrate elsewhere. We reduced costs a lot by turning off non essential features, he gave us our last pay check and some great referrals. That was that and we very emotionally closed up shop.

When news got out, we then had to defend ourselves publicly, because the loch ness moron, decided to twist things in his favour. So yeah, AMAZING experience!

So an unemployed and broken man, I did the unthinkable ... I set my linkedin to "open to work". Fuck me every moronic recruiter in a 10,000 mile radius came after me. Didn't matter if I was qualified, didn't matter if I had no experience in that language or type of system, didn't matter if my bio explicitly said "I don't work with X, Y or Z" ... that only made them want me more.

I think I got somewhere around 20 - 30 messages per week, 1 - 2 being actually relevant to what I do. Applied to dozens of jobs myself, only contacted back by 1, who badly fucked up the job description and I wasn't a fit at all.

Got an email from company ABC, who worked on the same blockchain we got kicked off of. They were looking for people with my skills and the skills of one other dev in the preious company. They heard what happened and our CEO gave us a glowing recommendation. They largely offered us the job, but both of us said that we weren't interested in working anywhere near, that kick needing prick, again. We wanted to go elsewhere.

Went back to searching, finding nothing. The other dev got a contract job elsewhere. The guy from ABC message me again to say look, we understand your issues, you got fucked around. We can do out best to promise you'll never have to speak to, the abominable jizz stain, again. We'll also offer you a much bigger role, and a decent salary bump on top of that.

Told them i'd think about it. We ended up having a few more calls where they showed me designs of all the things they wanted to do, and plans on how they would raise money if the same thing was to ever happen to them. Eventually I gave in and signed up.

So far it was absolutely the right call. Haven't had to speak to the scrotum at all. The company is run entirely by engineers. Theres no 14 meetings per week to discuss "where we are" which just involves reading our planning tool tickets, out loud. I'm currently being left alone 99% of the week to get work done. and i'm largely in-charge of everything mobile. It was a fucking hellhole of a trip, but I came out the other side better off

I'm sure there is a thought provoking, meaningful quote I could be writing now about how "things always work out" or that crap. But remembering it all just leaves me with the desire to find him and shove a cactus where the sun don't shine

.... happy job hunting everyone!

Every step of this project has added another six hurdles. I thought it would be easy, and estimated it at two days to give myself a day off. But instead it's ridiculous. I'm also feeling burned out, depressed (work stress, etc.), and exhausted since I'm taking care of a 3 week old. It has not been fun. :<

I've been trying to get the Google Sheets API working (in Ruby). It's for a shared sales/tracking spreadsheet between two companies.

The documentation for it is almost entirely for Python and Java. The Ruby "quickstart" sample code works, but it's only for 3-legged auth (meaning user auth), but I need it for 2-legged auth (server auth with non-expiring credentials). Took awhile to figure out that variant even existed.

After a bit of digging, I discovered I needed to create a service account. This isn't the most straightforward thing, and setting it up honestly reminds me of setting up AWS, just with less risk of suddenly and surprisingly becoming a broke hobo by selecting confusing option #27 instead of #88.

I set up a new google project, tied it to my company's account (I think?), and then set up a service account for it, with probably the right permissions.

After downloading its creds, figuring out how to actually use them took another few hours. Did I mention there's no Ruby documentation for this? There's plenty of Python and Java example code, but since they use very different implementations, it's almost pointless to read them. At best they give me a vague idea of what my next step might be.

I ended up reading through the code of google's auth gem instead because I couldn't find anything useful online. Maybe it's actually there and the past several days have been one of those weeks where nothing ever works? idk :/

But anyway. I read through their code, and while it's actually not awful, it has some odd organization and a few very peculiar param names. Figuring out what data to pass, and how said data gets used requires some file-hopping. e.g. `json_data_io` wants a file handle, not the data itself. This is going to cause me headaches later since the data will be in the database, not the filesystem. I guess I can write a monkeypatch? or fork their gem? :/

But I digress. I finally manged to set everything up, fix the bugs with my code, and I'm ready to see what `service.create_spreadsheet()` returns. (now that it has positively valid and correctly-implemented authentication! Finally! Woo!)

I open the console... set up the auth... and give it a try.

... six seconds pass ...

... another two seconds pass ...

... annnd I get a lovely "unauthorized" response.

asjdlkagjdsk.

> Pic related.

I was once working for a company as a part time dev in the centrum of my city.

After working there for almost 1 year I noticed that I didn't get paid the last 2 months. I think it was about 500 euro's. (1 day per week).

So I went on my bike to the company to see whatsup. I came into the store and told my boss I hadn't been paid for 2 months. Even tho I did work.

He then got so angry! Just started yelling "YEAH BECAUSE THE PROJECT ISNT NEAR COMPLETE, NOTHING IS WORKING" I explained him the panel still had to be configured and that everything he asked me to do had been programmed and he then fucking told me he wanted it a different way even tho we clearly discussed it WEEKS AGO and he clearly said what he wanted. so he wanted dont revisions. I told him that this is not possible at this moment because holidays are around the corner and I want to go om vacation. (and he too!!!)

He then got so fucking angry he said "come with me for a second" we walk to the door of the building and then he just pushed me out of there and kicked me in my back.

I got so fucking pissed, I opened the door and asked him if je thinks this is a normal way to discuss. He closed the store door again, and I couldnt hold back anymore. I threw my full can of Red Bull against the glass door. The can exploded, and his whole fucking window had energy drink on it. He took some fucking steal pipe, so I walked back. But while trying to get away I jumped on his store sign. Which broke into pieces (they are quite expanasive). He came outside with his fucking pipe and he was trying to hit me. We had a crowd and people started yelling at him. I walked away but the asshole took my bike and put it inside his store. So that I couldnt leave.

So than I called the cops and reported him. For minor assault and some other things. Shortly after I deleted the entire project from his stupid server.

I really dont know this kinda shit happends, he probably felt like I didn't deserve that money even tho I did everything he asked for within deadline. Trying to solve it after vacation was also not an option. I signed him up for a few news letters after that.

So, some time ago, I was working for a complete puckered anus of a cosmetics company on their ecommerce product. Won't name names, but they're shitty and known for MLM. If you're clever, go you ;)

Anyways, over the course of years they brought in a competent firm to implement their service layer. I'd even worked with them in the past and it was designed to handle a frankly ridiculous-scale load. After they got the 1.0 released, the manager was replaced with some absolutely talentless, chauvinist cuntrag from a phone company that is well known for having 99% indian devs and not being able to heard now. He of course brought in his number two, worked on making life miserable and running everyone on the team off; inside of a year the entire team was ex-said-phone-company.

Watching the decay of this product was a sheer joy. They cratered the database numerous times during peak-load periods, caused $20M in redis-cluster cost overrun, ended up submitting hundreds of erroneous and duplicate orders, and mailed almost $40K worth of product to a random guy in outer mongolia who is , we can only hope, now enjoying his new life as an instagram influencer. They even terminally broke the automatic metadata, and hired THIRTY PEOPLE to sit there and do nothing but edit swagger. And it was still both wrong and unusable.

Over the course of two years, I ended up rewriting large portions of their infra surrounding the centralized service cancer to do things like, "implement security," as well as cut memory usage and runtimes down by quite literally 100x in the worst cases.

It was during this time I discovered a rather critical flaw. This is the story of what, how and how can you fucking even be that stupid. The issue relates to users and their reports and their ability to order.

I first found this issue looking at some erroneous data for a low value order and went, "There's no fucking way, they're fucking stupid, but this is borderline criminal." It was easy to miss, but someone in a top down reporting chain had submitted an order for someone else in a different org. Shouldn't be possible, but here was that order staring me in the face.

So I set to work seeing if we'd pwned ourselves as an org. I spend a few hours poring over logs from the log service and dynatrace trying to recreate what happened. I first tested to see if I could get a user, not something that was usually done because auth identity was pervasive. I discover the users are INCREMENTAL int values they used for ids in the database when requesting from the API, so naturally I have a full list of users and their title and relative position, as well as reports and descendants in about 10 minutes.

I try the happy path of setting values for random, known payment methods and org structures similar to the impossible order, and submitting as a normal user, no dice. Several more tries and I'm confident this isn't the vector.

Exhausting that option, I look at the protocol for a type of order in the system that allowed higher level people to impersonate people below them and use their own payment info for descendant report orders. I see that all of the data for this transaction is stored in a cookie. Few tests later, I discover the UI has no forgery checks, hashing, etc, and just fucking trusts whatever is present in that cookie.

An hour of tweaking later, I'm impersonating a director as a bottom rung employee. Score. So I fill a cart with a bunch of test items and proceed to checkout. There, in all its glory are the director's payment options. I select one and am presented with:

"please reenter card number to validate."

Bupkiss. Dead end.

OR SO YOU WOULD THINK.

One unimportant detail I noticed during my log investigations that the shit slinging GUI monkeys who butchered the system didn't was, on a failed attempt to submit payment in the DB, the logs were filled with messages like:

"Failed to submit order for [userid] with credit card id [id], number [FULL CREDIT CARD NUMBER]"

One submit click later and the user's credit card number drops into lnav like a gatcha prize. I dutifully rerun the checkout and got an email send notification in the logs for successful transfer to fulfillment. Order placed. Some continued experimentation later and the truth is evident:

With an authenticated user or any privilege, you could place any order, as anyone, using anyon's payment methods and have it sent anywhere.

So naturally, I pack the crucifixion-worthy body of evidence up and walk it into the IT director's office. I show him the defect, and he turns sheet fucking white. He knows there's no recovering from it, and there's no way his shitstick service team can handle fixing it. Somewhere in his tiny little grinchly manager's heart he knew they'd caused it, and he was to blame for being a shit captain to the SS Failboat. He replies quietly, "You will never speak of this to anyone, fix this discretely." Straight up hitler's bunker meme rage.

If you are a salesperson, you can just go straight to hell. You're all a bunch of cocksucking twats and I'm amazed you manage to get yourselves dressed each day. You're a no good fucking waste of oxygen and you need to put your fork in a socket the next time you're eating.

I'm working on building a crm and ticket management system for use in the office to handle client passwords. Since I'm building from scratch I wanted to make sure I had properly planned my classes and functions before opening the code editor so I put a message on my door that says "Don't interrupt, thanks" followed by the date so people knew it was a fresh message and not something left from the previous day.

I'm deep in the zone, the psuedo code and logic is flowing, I'm getting classes planned and feeling really productive for an hour or so when suddenly my door flies open and in comes a sales person.

SP: "Hey, do you have any extra phones lying around? Mine's being slow and keeps hanging up on people."

Me: "Do you see the sign on my door right there at eye level which says not to bother me?"

SP: "oh, do you want me to come back later?"

Me: "You've already interrupted me now, let's go see what's going on before I spent an hour setting up a new phone for you." While we are walking across the office I asked him when the last time the phone rebooted.

SP: "idk, Salesperson#2 suggested that as I was headed over here but I figured I'd just ask you."

We get over to his desk and I see he has two phones sitting on his desk. "Where did this one come from?"

SP: "Oh that was on the desk over here but I figured I could use it."

Me: "Well aside from the fact that the phones are assigned to specific people for a reason, you took the time to unhook your phone to set this one up and you didn't think to reboot your phone first. Plug your phone back in."

He plugs the old phone, which is assigned to him, and while booting it does a quick firmware update and boots up fine. He tests a few things and decides it's all better now.

So someone suggested a fix for you and you decided, instead, you would break company IT policy by moving equipment from one station to another without notifying the IT department. You entered a room which had a closed door without knocking, and you disobeyed the sign on the actual door itself which politely requests that you go away. All because you couldn't be bothered to take 2 minutes and reboot your phone, which you had to do anyways.

You completely broke my train of thought and managed to waste 2 hours of effecient workflow because you had an emergency.

"I think my screen broke, it displays some colored lines... wait I'll send you a screenshot"

Classic

!rant
Me and my girlfriend just broke up.
I was sad at first but now I can really start focusing on some really interesting projects.

Such as my new secret website that I will release soon. I think you'll like it.

i was asked to start a new project, and another dev was brought onto the team shortly after. as soon as he joined, straight away he started an entirely new project and worked on it through the whole weekend, then came back on monday and just sort of pasted his files into/over the code i had already started and was working on, with no regard for folder structure or naming conventions or anything. his work was even split between 2 almost identically named namespaces (both of which were completely different to the existing project namespace) and his shit broke everything i did in the first place. the cherry on top is that none of his work was even functional, it was purely dummy/mockup web pages that weren't linked to any sort of backend.

when i asked him wtf he thought he was doing, he kept saying "i didnt touch your code" and refused to acknowledge that pasting a project over a different project can break stuff, then said it "wasn't his fault that i'm slow and not keeping up". and just kept saying vague bullshit about how i have to do it his way because he "has more experience"

he had no idea what my previous experience was, he had never asked and i had never told him, he just decided that he had more experience than me.

i dug through the shit and found out that he didn't just break my work, he had actually purposely deleted it when he realised it was getting in the way of his spaghetti. i showed him the commit and confronted him with it and all the cunt said was "well the good news is, you know the fix" and kept trying to dismiss me in the most disrespectful ways he could think of. i eventually snapped at him (long overdue at this point) and told him that any experienced developer would not commit code that didn't even fucking compile, especially when they're the one who broke it, and that he needs to grow up. of course he then complained that i was being unprofessional.

our manager decided we should go with fuckfaces """code""" without even looking at the work either of us had done, purely because fuckface is older than me and that's how the world works.

in the end i just told my manager that i refuse to work with the guy and he could either take him or me off the project (guess who he picked) or i quit.

after a few months of the guy failing to deliver any of even the basic functionality that was asked for, the entire project got scrapped, and the dude just quit once everyone realised he was literally just larping as an experienced dev but couldn't accomplish simple tasks.

i never received an apology from anybody involved.

thanks to @stuxnet i have to proudly say, that i have went outside and after 21 years, asked a girl for her number in real life, of course got rejected, this probably sounds pathetic as fuck to all of you, which i do agree, but because of the hell I've gone through and blood I've left behind out of struggle the life caused me, i have finally gathered bravery to take a risk and do it, yes i technically haven't achieved anything but i have finally tried at least once and this is the furthest I've gone with girls in real life... what a fucking relief... i think its gonna be much easier now that i finally broke the ice...

Man I really need to get this off my chest. So here goes.
I just finished 1 year in corporate after college. When I joined, the team I got was brilliant, more than what I thought I would get. About 6 months in, the project manager and lead dev left the company. Two replacements took their place, and life's been hell ever since.

The new PM decided it was his responsibility to be our spokesperson and started talking to our overseas manager (call her GM) on our behalf, even in the meetings where we were present, putting words in our mouth so that he's excellent and we get a bad rep.

1 month in, GM came to visit our location for a week. She was initially very friendly towards all of us. About halfway through the week, I realized that she had basically antagonized the entire old team members. Our responsibilities got redistributed and the work I was set to do was assigned to the new dev (call her NR).

Since then, I noticed GM started giving me the most difficult tasks and then criticizing my work extra hard, and the work NR was doing was praised no matter what. I didn't pay much attention to it at first, but lately the truth hit me hard. I found out a fault in NR's code and both PM and GM started saying that because I found it, it was my responsibility to fix it. I went through the buggy code for hours and fixed it. (NR didn't know how it worked, because she had it written by the lead dev and told everyone she wrote it).

I found out lately that NR and PM got the most hike, because they apparently "learnt" new tech (both of them got their work done by others and hogged the credit).They are the first in line to go onsite because they've been doing 'management work'. They'd complained to GM during her visit that we were not friendly towards them. And from that point on if anything went wrong, it would be my fault, because my component found it out (I should mention that my component mostly deals with the backend logic, so its pretty adept at finding code leaks).

What broke my patience is the fact that lately I worked my ass off to deliver some of the best code I'd written, but my GM said in front of the entire team that at this point "I'm just wasting money". She's been making a bad example out of me for some time, but this one took the cake. I had just delivered a promising result in a task in 1 week that couldn't be done by my PM in 4 weeks, and guess what? "It's not good enough". No thank you, no appreciation, nothing. Finally, I decided I'd had enough of it and started just doing tasks as I could. I'd do what they ask, but won't go above and beyond my way to make it perfect.

My PM realized this and then started pushing me harder. Two days back, I sent a mail to the team with GM in cc exposing a flaw in the code he had written, and no one bothered to reply (the issue was critical). When I asked him about it, he said "How can you expect me to reply so soon when it's already been told that when anything happens we should first resolve within the team and then add GM in the loop?" I realized it was indeed discussed, but the issue was extremely urgent, so I had asked everyone involved, and it portrayed him in a bad light. I could've fixed it, but I didn't because on the off chance if it broke something, they'd start telling me that I broke the tool, how its my fault and how its a critical issue I have to fix ASAP, etc. etc., you get the idea.

Can anyone give me some advice of how to deal with this kind of situation? I would have left but with this pandemic going on, market being scarce and the fact that I'm only experienced by 1 year, I don't think I qualify for a job switch just now.

So I ve been clinically depressed for about 10 years now. Been really great at hiding it. My illness and loneliness was so severe that i made up imaginary friends and that got so severe i couldn't tell what s real and what s not. Then about 5 years ago, i met a girl. As the cliche goes, everything felt better. Sunshine and stuff. I opened up to her. Shared stuff. I started becoming normal. The pain became bearable and manageable. Turned to entrepreneurship. Had goals and stuff. Had 7 failed startups but kept on going. Raised investment for an 8th. It went better than anyother. Was going to become the next big thing bla bla. She became the reason i turned from being a loner weirdo to someone awesome. Anyway, as nothing tends to last, my best friend who had been through thick and thin in my work, quit last year in October. He messed up some work from big client nd we had a fight. He left. In the meantime i scored a big multinational company. I was gonna propose to my girlfriend in March this year. But instead she decided to leave for someone better who left her in 3 weeks lol. Anyways, we broke up. During that time, my second friend decided to fuck up my work with the big company so hard that they were about to blacklist my company. And then he left too. I had a small team. 4 5 people doing their best. By that time, i was the only one left. On 28th feb i had my breakup, on 1st march i was sitting 700 km away from home in an office trying to talk the company out of blacklisting us. It took me around 20 days to make that happen. All the while dealing with the obvious, my depression getting stronger than ever. My imaginations taking shape and fucking up my reality. The voices in my head getting stronget and stronger. 4 months now since she left. I dont think i miss her anymore. She tried coming back once but i didn't let her. In the 4 months, i m at my worst. I am getting government contracts now. But i have no desire to do anything. The pain is unbearable. So much that on its good days it sucks the life right out of me. So much that when it gets severe the urge to harm myself in any way goes of the charts. My best friend and i, we became friends again after my ex left. He s been helping me as much as he can. I have all the good oppurtunities and chances that any entrepreneur who has been busting his ass for 5 years straight would kill to have. But i cant do anything. I m the only one left on my team. I have to handle the business, dev, marketing etc etc ends on my own. I tried hiring and scaling up but i messed that up because of obvious reasons. And now my company has 2 months of runway left. And i know if i bust my ass i can make it to 8 months more and even raise a round a. But its really hard to do when either you re sleeping 20 hrs a day or you re sleeping 3 4 hrs because you re afraid of the nightmares. Or when even you ve had a good day, the pain becomes so much that you lay on the floor having a breakdown. Yeah, i m trying professional help. I m hoping it helps me. Because right now, i dont care about being happy. I just want my sanity. Something i m clinging to with every fiber of my being. Something that s burning out like a candle burning from both ends. I cant give up my work. I dont want to. That s all i have. That s all what i love doing and now i cant even do that. I just want this to end somehow. Either i get better and the pain and the void and silence and everything else goes away, or i do. I dont know what will happen first. And i dont care. I just want to be normal. But i guess that s too much to ask.

!dev

So the ceiling in our (upstairs) laundry room started leaking. After some troubleshooting, we determined it was the A/C, and not the water pipes. (The house is cheap as hell and fucking stupid.) We did some troubleshooting and research, and tried fixing it ourselves; no luck. Cleaning the pipes from outside: no joy. Cleaning the pipes from inside: no access. The attic is ... small. Maybe half a small closet? and doesn’t give access to fucking anything. The builders must have installed everything before putting up the walls and ceilings, sealing everything off, because there is no access. It’s fucking stupid. Also, the usual maintenance openings aren’t even there either because why the fuck would they be?

But fucking whatever.

We called an a/c repair guy, who never showed. We assumed he was busy (it’s fucking hot), so we called him again the next day; two days later he showed.

Busy. Whatever.

Guy didn’t bring a ladder. Whatever, we have one right there in the hallway because we’ve been trying in vain to fix it.

Guy didn’t bring a wrench of any kind. Guy didn’t bring a screwdriver. Guy didn’t bring a bucket. Guy didn’t bring any pipe. Or any pipe sealant. Or fucking anything but his sagging fucking pants, fat belly, and fat stench. We had to supply everything, which fortunately we had on hand as we were already trying to fix it. Hoorah for being proactive.

Guy said he drained both primary and secondary pans. Somehow. Without access. I’m not even convinced it HAS a secondary pan. Guy said he cleaned out the pipes, too. From inside the house. Without access. Somehow. Maybe he did that from outside, without tools, while I was chasing the brats and someone else was watching the fat bastard. Who knows; I wasn’t with him most of the time.

When he was done, the guy said “pay whatever you think it’s worth” (or whatever). Fine, if he actually cleaned the pipes out and it isn’t leaking anymore, that’s great.

Guy leaves.

We go up to check. AND THE FUCKING A/C IS STILL LEAKING. BUT NOW IT’S FROM BEFORE THE PIPES, TOO. AND HALF AN HOUR LATER, THE LAUDRY ROOM CEILING IS ALSO LEAKING, WHICH MEANS THE PIPES ARE STILL LEAKING.

It turns out the asshole broke the pan.

We call him back, he goes blah blah blah, we send him a video. Drip, drip, drip.

His response?
“The pan must be rusted.” IT’S FUCKING PLASTIC.

“Oh, in that case, it’s probably a rusted coil that’s leaking.”

a) HOW DID YOU NOT KNOW IT WAS FUCKING PLASTIC IF YOU DRAINED IT?

b) THE COILS CARRY FREON, NOT WATER, AND THE A/C IS STILL WORKING. IF THERE WAS A LEAK, SHIT WOULD BE HOT. AND RANK. FREON SMELLS NASTY AND DOESN’T CAUSE IT TO RAIN IN THE FUCKING HOUSE.

REPLACING A COIL IS ALSO A $2000 FUCKING REPAIR.

THE FAT BASTARD PROBABLY BROKE THE PAN INTENTIONALLY JUST TO UPSELL. I WANT TO FUCKING MURDER HIS LYING FUCKING FACE OFF.

It’s possible he didn’t break the pan intentionally, so I’ll tentatively remove that from his charges. BUT TO FUCKING LIE?

LIE AND DIE, FUCKER.

At a previous job, we had a CTO and in a meeting of all the department heads, we all realized we have a CTO that knows about as much about tech as the pigeons do.

I’d always seen the confused emoji, I however never knew an actual human being could look like it, I’ve seen confused people, but on this day I saw a living 🤔…

How did I manage to achieve this result, I told him you can’t copy AngularJS code into a Flutter project, I then proceeded to tell him you also cannot copy it into a react project. I think I broke his brain.

Oh and yes, I worked at a development house, all the department heads were developers except for the QA head.

Two days ago I went to change an Nvidia driver on my Linux mint partition and it ended up breaking everything, all my fault because I'm so new to Linux, anyways to dig that hole deeper I looked for ways to fix it, found some random command that managed to destroy mint even more lol. I had no start menu and cinnamon kept going into recovery mode.

But the next day after spending time working through what to do I managed to fix it, I basically downloaded mintmenu again and uninstalled the graphics driver

All in all I think I've come closer to learning how fun Linux is, it was fun fixing what I broke rather than actually clean installing mint again.

Morale of the story: don't randomly use commands found on the net that has 3 upvotes lol

An important message:
PrOpErLy managing servers is HARD.

I get pissed off at customers with ZERO server knowledge who think they can manage their VPS. “Just get a control panel and a VPS” from some flashy provider that makes server management look way too easy.. Clicking around in their fancy control panel, until:

- they need help with their *self-managed* VPS;
- their email ends up in spam;
- they suffer from performance issues;
- they need to restore a backup;
- something breaks, because YES, things break

Way too little people are able to answer:

- when and how do you make backups?
- how do you monitor your servers and which services?
- how do you keep track of trend analysis?

Then I come by with necessary software. SNMP for trend analysis, Graphite for infrastructure health, Sensu for monitoring, Kibana, Ansible for configuration management..

Things that servers need but that customers have never even heard of.. because they can do everything in their control panel..

Until they come crying to me because it broke and they don’t even know how to get into SSH.

I think the ones to blame are VPS providers that tell the tale of how easy it is to install a control panel and never look at your server again.

Customers become responsible for something *business-critical*! Yet they don’t know how it works.

A few years ago I was browsing Bash.org, and a user posted that he'd physically lost a machine.

A few weeks ago, I'd switched my router out for OPNSense. I figured it was time to start cleaning up my network.

Over the course of tracking down IP addresses and assigning statics to mac addresses, I spotted an IP I didn't recognize.

Being a home network, I'm pretty familiar with everything on the network by IP, so was a little taken aback.

I did some testing, found out that it was a Linux box. Cool.

I can SSH into it. Ok.

Logs show that it's running fine, no CPU/Memory/Harddrive issues. Nice.

So where is it?

Traceroute shows its connected directly to the router... Maybe over an unmanaged switch...

Hostname is "localhost"... That's no help.

I've walked the network 4 times now, and God knows where it is.

I think maybe I'll just leave it alone. If it ain't broke...

I'm coming off a lengthy staff augmentation assignment awful enough that I feel like I need to be rehabilitated to convince myself that I even want to be a software developer.

They needed someone who does .NET. It turns out what they meant was someone to copy and paste massive amounts of code that their EA calls a "framework." Just copy and paste this entire repo, make a whole ton of tweaks that for whatever reason never make their way back into the "template," and then make a few edits for some specific functionality. And then repeat. And repeat. Over a dozen times.

The code is unbelievable. Everything is stacked into giant classes that inherit from each other. There's no dependency inversion. The classes have default constructors with a comment "for unit testing" and then the "real" code uses a different one.

It's full of projects, classes, and methods with weird names that don't do anything. The class and method names sound like they mean something but don't. So after a dozen times I tried to refactor, and the EA threw a hissy fit. Deleting dead code, reducing three levels of inheritance to a simple class, and renaming stuff to indicate what it does are all violations of "standards." I had to go back to the template and start over.

This guy actually recorded a video of himself giving developers instructions on how to copy and paste his awful code.

Then he randomly invents new "standards." A class that reads messages from a queue and processes them shouldn't process them anymore. It should read them and put them in another queue, and then we add more complication by reading from that queue. The reason? We might want to use the original queue for something else one day. I'm pretty sure rewriting working code to meet requirements no one has is as close as you can get to the opposite of Agile.

I fixed some major bugs during my refactor, and missed one the second time after I started over. So stuff actually broke in production because I took points off the board and "fixed" what worked to add back in dead code, variables that aren't used, etc.

In the process, I asked the EA how he wanted me to do this stuff, because I know that he makes up "standards" on the fly and whatever I do may or may not be what he was imagining. We had a tight deadline and I didn't really have time to guess, read his mind, get it wrong, and start over. So we scheduled an hour for him to show me what he wanted.

He said it would take fifteen minutes. He used the first fifteen insisting that he would not explain what he wanted, and besides he didn't remember how all of the code he wrote worked anyway so I would just have to spend more time studying his masterpiece and stepping through it in the debugger.

Being accountable to my team, I insisted that we needed to spend the scheduled hour on him actually explaining what he wanted. He started yelling and hung up. I had to explain to management that I could figure out how to make his "framework" work, but it would take longer and there was no guarantee that when it was done it would magically converge on whatever he was imagining. We totally blew that deadline.

When the .NET work was done, I got sucked into another part of the same project where they were writing massive 500 line SQL stored procedures that no one could understand. They would write a dozen before sending any to QA, then find out that there was a scenario or two not accounted for, and rewrite them all. And repeat. And repeat. Eventually it consisted of, one again, copying and pasting existing procedures into new ones.

At one point one dev asked me to help him test his procedure. I said sure, tell me the scenarios for which I needed to test. He didn't know. My question was the equivalent of asking, "Tell me what you think your code does," and he couldn't answer it. If the guy who wrote it doesn't know what it does right after he wrote it and you certainly can't tell by reading it, and there's dozens of these procedures, all the same but slightly different, how is anyone ever going to read them in a month or a year? What happens when someone needs to change them? What happens when someone finds another defect, and there are going to be a ton of them?

It's a nightmare. Why interview me with all sorts of questions about my dev skills if the plan is to have me copy and paste stuff and carefully avoid applying anything that I know?

The people are all nice except for their evil XEB (Xenophobe Expert Beginner) EA who has no business writing a line of code, ever, and certainly shouldn't be reviewing it.

I've tried to keep my sanity by answering stackoverflow questions once in a while and sometimes turning evil things I was forced to do into constructive blog posts to which I cannot link to preserve my anonymity. I feel like I've taken a six-month detour from software development to shovel crap. Never again. Lesson learned. Next time they're not interviewing me. I'm interviewing them. I'm a professional.

You know what really grinds my gears? As a junior webdeveloper (mostly backend) I try my hardest to deliver quality content and other people's ignorance is killing me in my current job.

Let's rant about a recent project I had under my hood, for this project (a webshop) I had to restructure the database and had to include validation on basicly every field (what the heck, no validation I hear you say??), apperently they let an incompetent INTERN make this f***king webshop. The list of mistakes in this project can bring you close to the moon I'd say, seriously.

Database design 101 is basicly auto incremented ID's, and using IDs in general instead of using name (among a list of other stuff obv.). Well, this intern decided it was a good idea to filter a custom address-book module based on a NAME, so it wasn't setup as: /addressbook/{id} (unique ID, never a problem) but as /addressbook/{name}, which results in only showing one address if the first names on the addresses are the same. Lots of bugs that go by this type of incompetence and ignorance. Want to hear another joke? Look no further, this guy also decided it was a great idea to generate the next ID of an order. So the ordernumber wasn't made up by the auto incremented id on the order model, but by a count of all the orders and that was the next order number. This broke so many times, unbelievable.

To close the list of mistakes off, the intern decided it was a great idea to couple the address of a user directly to an order. Because the user is able to ship stuff to addresses within his addressbook, this bug could delete whole orders out of the system by simply deleting the address in your addressbook.

Enough about my intern rant, after working my ass of and going above and beyond the expectations of the customer, the guy from sales who was responsible for it showed what an a**hole he was. Lets call this guy Tom.

Little backstory: our department is a very small part of the company but we are responsible for so much if you think about it. The company thinks we've transitioned to company wide SCRUM, but in reality we are so far from it. I think the story below is a great example of what causes this.

Anyway, we as the web department work within Gitlab. All of our issues and sprints are organized and updated within this place. The rest of the company works with FileMaker, such a pile of shit software but I've managed to work around its buggyness. Anyway, When I was done with the project described above I notified all the stakeholders, this includes Tom. I made a write-up of all the changes I had made to the project, including screenshots and examples, within Gitlab. I asked for feedback and made sure to tag Tom so he was notified of my changes to the project.

After hearing nothing for 2 weeks, guess who came to my desk yesterday? F**king tom asking what had changed during my time on the project. I told him politely to check Gitlab and said on a friendly tone that I had notified him over 2 weeks ago. He, I shit you not, blantly told me that he never looks on there "because of all the notifications" and that I should 'tell him what to do' within FileMaker (which I already had updated referencing Gitlab with the write-up of my changes). That dick move of him made me lose all respect for this guy, what an ignorant piece of shit he is afterall.

The thing that triggers me the most in the last story is that I spent so much free time to perfect the project I was working on (the webshop). I even completed some features which weren't scheduled during the sprint I was working on, and all I was asking for was a little appreciation and feedback. Instead, he showed me how ignorant and what a dick he was.

I absolutely have no reason to keep on working for this company if co-workers keep treating me like this. The code base of the webshop is now in a way better condition, but there are a dozen other projects like this one. And guess what? All writen by the same intern.

/rant :P

Exercise devs, exercise, exercise and then exercise a little bit more

I've been coding for a long time and tbh programming is a very fiscally stale labour/hobby and even if your mind is rushing looking for answers, jumping from one place to another you are not moving that much, yes adjustable desks for programming while standing up are good and having breaks also helps but nothing like running, jumping, climbing or any sport.

During my lifetime I've seen the long and short term negative effects of sedentary jobs, back problems, liver problems, hormonal imbalance, overweight, depression, and anxiety.

I've been fiscally active for a long while but when I stopped, the first symptoms I had were weight gain, anxiety and depression, one night I even broke a tooth from stress teeth grinding.

Ive seen that people here might be having this issues and think it's normal, but try it out, start with a walk or jog sprinkled on your weekend.

I had a manager in a fortune 500 company encourage me to install a web cam with live feed in another team members cube as a prank. Being younger, I trusted him and so figured it would fine and just get a good laugh.

Then another member found the setup and reported it. Turns out, this broke so many company regulations, I could have been fired on the spot. They confiscated my laptop and I got the 3rd degree from my senior director, who told me I was lucky to be a contractor at the time or the situation would have been even worse.

Moral of the story for younger folks in large corporations... don't take everything your higher ups say as gospel. Think for yourself and do your own research if something feels iffy.

I think I broke devRant 🤔
On my phone it shows 49 notifs while on laptop it shows 23 🤔🤔🤔

i think ive been waiting a while too long today :(

Today my raspberry pi media center bricked itself (at least it won't boot properly. Than I thought I just format the SD card and reinstall everything. But than my windows pc won't boot properly because it's still running on old hdd and I suck at building PCs. Than I tried my ThinkPad with antergos and remembered that it is also dead because the last update broke something. And now I'm trying to boot my windows at least into safe mode and my ThinkPad to boot from the live stick to chroot and fix it. Still waiting since 15min for any progress.
Now is my old Oneplus One with an outdated nightly of a custom Rom my only working connection to the web.
I'm starting to think that waiting for the last minute to fix problems might not the best way for me.

Fuck, I'm too tired to rant about shit. Life is really starting to go better and I just...don't know what to rant about, so I've been quiet for the past couple months.

Uhhhhh, whenever I close my laptop the screen stays on and seeps through but I'm too lazy to actually mess with it to make it turn off when I close it?

I've been hanging out with my best friend again lately and she's the best fucking person ever?

OH WAIT, I'M BROKE, THERE'S SOMETHING (I've spent like 10 minutes typing, just trying to think of shit to say)! But I'm just bad with managing money and I get paid on Saturday anyways..

Guys. I don't know what to even rant about anymore. Life is finally going good enough that I don't feel the need to rant all the time.

Do you have a ‘Drama Queen’ on your team?
This happened last week.
DK = Drama Queen
DK: “OMG..the link to the document isn’t working! All I get is page not found. I’m supposed to update the notes for this project…and now I can’t! What the _bleep_ and I supposed to do now?!...I don’t understand how …”
This goes on for it seems 5 minutes.
Me: “Hold on...someone probably accidently mistyped the file name or something. I’m sure the document is still there.”
DK: “Well, I’ll never find it. Our intranet is a mess. I’m going to have to tell the PM that the project is delayed now and there is nothing I can do about it because our intranet is such a mess.”
Me: “Maybe, but why don’t you open up the file and see where the reference is?”
DK: “Oh, _bleep_ no…it is HTML…I don’t know anything about HTML. If the company expects me to know HTML, I’m going to have to tell the PM the project is delayed until I take all the courses on W3-Schools.”
Me: “Um…you’ve been developing as long as I have and you have a couple of blogs. You know what an anchor tag is. I don’t think you have to take all those W3 courses. It’s an anchor tag with a wrong HREF, pretty easy to find and fix”
DK: “Umm…I know *my* blog…not this intranet mess. Did you take all the courses on W3-Schools? Do you understand all the latest web html standards?”
Me: “No, but I don’t think W3 has anything to do the problem. Pretty sure I can figure it out.”
DK: “ha ha…’figuring it out’. I have to know every detail on how the intranet works. What about the javascript? Those intranet html files probably have javascript. I can’t make any changes until I know I won’t break anything. _bleep_! Now I have to learn javascript! This C# project will never get done. The PM is going to be _bleep_issed! Great..and I’ll probably have to work weekends to catch up!”
While he is ranting…I open up the html file, locate the misspelling, fix it, save it..
Me: “Hey..it’s fixed. Looks like Karl accidently added a space in the file name. No big deal.”
DK:”What!!! How did you…uh…I don’t understand…how did you know what the file name was? What if you changed something that broke the page? How did you know it was the correct file? I would not change anything unless I understood every detail. You’re gonna’ get fired.”
Me: “Well, it’s done. Move on.”

fuck you, man. eat a bag of dicks, a bag of shit and a shit load of dead animals.. you dumb fucking cunt ... go and die ... who the fuck modifies state of 3rd party object and think it is ok to do so.. the fucking prick deserves to get castrated with rusty, old school, gardening scissors...

through some mysterious, obfuscated, buried deep in the asshole code, the fucker decided to set a user-specific value in the default query params of guzzle so that every fucking object using it passes the fucking thing around like a cheap hooker at a dorm party... causing the API calls to misbehave because of the fucking thing.

you send the parameters you want to send but mister sucking-dick-up-the-ass-smarty-pants decided you don't want to do that and because of that I almost broke a core library a week before a fucking major feature release because half the functionality got broken automagically, worst thing is I have no fucking clue where the bloody thing gets inserted ...

I swear if you do that I will find you and I will get a rusty razor to cut your balls into paste and rectally infuse them untill your shit start to come out of every oriphise of your fucking empty head

I was looking for a job 2-3 months ago and two companies reached out to me after the interviews and offered me a working position. One company was pretty close to me and didn't require me to relocate to another city, even though it was a shittier kind of IT/developer job where we needed to fix legacy PHP CMS's. By that point I had no money and was depressed after looking for that long and jumped on the opportunity. Forward 1.5 months later and the company I started working for decided to file for bankruptcy. Nice huh, working for a whole 1.5 months. I reached out to other company that would have hired me otherwise in hopes they would still have a position open, all they can offer me is a non-paid internship. I would need to relocate to another city where I don't have anywhere to stay and pay rent + a deposit, after which I would be broke again, and they offered me a performance review after the internship after which they would THINK about giving me a job. Fuck this.

Four engineers and a broke down car

One day, mechanical engineer, electrical engineer, chemical engineer, and computer engineer were driving down the street in the same car when it broke down.

The mechanical engineer said, “I think a rod broke”.

The chemical engineer said, “The way it sputtered at the end, I think it's not getting enough gas”.

The electrical engineer said, “I think there was a spark and something's wrong with the electrical system”.

All three turned to the computer engineer and said, “What do you think?”

To which, the computer engineer replied, “I think we should all get out and then get back in”.

When the department’s large plotter printer broke down, the users demanded they still be able to execute their large reports. The area manager understood reality, if we are waiting on parts, not a lot we can do, but one developer decided to re-write the report/application as a web/.asp application. Mind you, he wasn’t a web developer, mostly VB experience, so the ‘report’ executed the same queries and filled up simple html tables. Did it work? Sort of. The output had none of the specialized formatting like headers, grouping, summary calculations, etc. Since the users could see the data in the web browser and scroll left/right, they were OK with the temporary fix. When I heard this:
Me: “You do know the application could output the report in HTML exactly the way it prints to the printer. All we would have to do enable that feature in the application.”
Dev: “Yea, but I thought it would be cool to do it as a web app.”
Me: “OK, but we should just update the app.”
Dev: “Um...that is going to be difficult, the boss liked my idea so much, he wanted the report replaced with my asp application. I deleted the application from source control and from the network. Sorry.”
Me: “OMFG!…tell me you make a backup!”
Dev: “Ha!...no…boss said you would fight innovation. Web is the future.”
Me: ”What is going to happen when the printer is fixed!? Users are going to flip”
Dev: “Oh, we didn’t think of that. Oh well, that’s your problem now.”
Me: “WTF? My problem?”
Dev: “Yea, you are moving to the team responsible for those legacy applications, since innovation really isn’t your thing. I just got promoted to senior developer.”

Friends of mine have a new flat.

It's a nice flat. Cheap. Noone wanted it. 100 square meters.

Reason noone wanted it...

Previous owners were bastards from hell.

Really. Every motherfucking room needed to be completely renovated by the owner.

Door frames were made of wood, nice and old - at least the part that was left of them. Splinters, scratch marks, partially broken out of the wall.

2 windows needed to be fully replaced. Rest of the windows needed to be bleached, PET abrasive cleaning solution and the frames needed repair with resin as they drilled into the frames. Then treatment with sealant of course.

Yes. There was no other solution. After bleaching you recognized the windows were white. Before... Let's not talk about it.

The previous owners even managed to destroy the bathtub.

The kitchen tiles... Fat cleaner. Bleaching. Abrasion. Polishing.

Soooo.

Day of moving.

The apartment is in the 6th floor / level.

Cran / lift was ordered.

16 people wanted to come.

7 people came.

2 including myself couldn't lift heavy stuff nor walk the stairs due to health issues.

Crane broke after first try.

Today. I want to murder the previous owners. After torture and crucification.

I'm feeling levels of pain I couldn't Imagine before.

Only hate and beer let's me keep my shit together.

I REALLY didn't think after renovating and cleaning the flat for my friends in the last several weeks that it could get worse.

Boy. I was wrong.

Thanks for letting me vent here. I really feel devastated currently -.-

And I need to help them tomorrow, too.

Bikini Atoll, tchernobyl and every other atom bomb desaster Zone combined looks better than the chaos in their flat.

Everyone who could lift shoved everything inside.

I solo carried everything that wasn't too large in the room and then, as every room looked like desaster, completely managed the kitchen (cleaning, unpacking, trash, placing everything where it belongs and so on) :( :(

I am the manager of a customer service team of about 10-12 members. Most of the team members are right out of school and this is their first professional job and their ages range from 22-24. I am about 10 years older than all of my employees. We have a great team and great working relationships. They all do great work and we have established a great team culture.

Well, a couple of months ago, I noticed something odd that my team (and other employees in the building) started doing. They would see each other in the hallways or break room and say “quack quack” like a duck. I assumed this was an inside joke and thought nothing of it and wrote it off as playful silliness or thought I perhaps missed a moment in a recent movie or TV show to which the quacks were referring.

Fast forward a few months. I needed to do some printing and our printer is in a room that can be locked by anyone when it is in use (our team often has large volumes of printing they need to do and it helps to be able to sort things in there by yourself, as multiple people can get their pages mixed up and it turns into a mess). The door had been locked the entire day and this was around noon, and the manager I have the key to the door in case someone forgot to unlock it when they left. I walked in, and there were two of my employees on the couch in the copier room having sex. I immediately closed the door and left.

This was last week and as you can imagine things are very awkward between the three of us. I haven’t addressed the situation yet because of a few factors: This was during both of their lunch hours. They were not doing this on the clock (they had both clocked out, I immediately checked). We have an understanding that you can go or do anything on your lunch that you want, as long as you’re back after an hour. Also, as you mentioned in your answer last week to the person who overheard their coworker involved in “adult activities,” these people are adults and old enough to make their own choices.

But that’s not the end of the story. That same day, after my team had left, I was wrapping up and putting a meeting agenda on each of their desks for our meeting the next day. Out in broad daylight on the guys desk (one of the employees I had caught in the printing room) was a piece of paper at the top that said “Duck Club.” Underneath it, it had a list of locations of places in and around the office followed by “points.” 25 points – president’s desk, 10 points – car in the parking lot, 20 points – copier room, etc.

So here is my theory about what is going on (and I think I am right). This “Duck Club” is a club people at work where people get “points” for having sex in these locations around the office. I think that is also where the quacking comes into play. Perhaps this is some weird mating call between members to let them know they want to get some “points” with the other person, and if they quack back, they meet up somewhere to “score.” The two I caught in the copier room I have heard “quacking” before.

I know this is all extremely weird. I wasn’t even sure I wanted to write you because of how weird this seems (plus I was a little embarrassed). I have no idea what to do. As I mentioned above, they weren’t on the clock when this happened, they’re all adults, and technically I broke a rule by entering the copier room when it was locked, and would have never caught them if I had obeyed that rule. The only company rule I can think of that these two broke is using the copier room for other purposes, preventing someone else from using it.

I would love to know your opinion on this. I tend to want to sweep it under the rug because I’m kind of a shy person and would be extremely embarrassed to bring it up.

Really fed up with my colleague and possibly my job. Am starting to doubt am cut out to be a developer

Am a junior java dev , been working working for this company for about 2 years now. Although they hired me to be a java dev, they pretty much exclusively had me working on JavaScript crap because none of the other more senior devs wanted to do even so much as poke JS with a long stick....

Oh and the salary was crap but i figured since i had barely 3 years of exp i thought i would stick with it for a while

But a few months ago after seeing other opportunities I got fed up and threatened to quit , already started interviewing etc
Got an offer, not exactly what i wanted but better than where i was. Went to quit but they freaked out and started throwing money at me. They matched and exceed the other salary and promised to addressed the issues that made me want to leave. Ie get me to work more on the java side of the project and have me work with someone more senior who could sort of mentor me, i had been working semi solo on the js shit till then...

The problem is that my supposed mentor is selfish prick... he is the sort of guy who comes in real early, basically he goes to early morning prayer then come in at some ungodly hour and fuckoff home around 3pm

He does all his work early morning then spends the rest of the day with his headphones on stealthily watching youtube, amazon, watching cricket, reading about Palestine , how oppressed muslims are or building a website for some mosque.

I asked him to let me sit with him so that I could just learn how this or that part of the sys worked , he agreed then the very next day comes in and does all the work before i get in at 9 , i asked him how he did it and he tells me oh just read the code.

Its not as simple as that, out codebase is an old pile of non standard legacy dog shit. Nothing works as it should, i tried to go through documentation online for the various stuff we use , but invariably get stuck when i try the usual approach because it turns out the original devs had essentially done a lot of custom hacks and cowboy coding to get stuff working, they screwed around with some of the framework jars & edited libraries to get stuff to work, resulting in some really weird OSGI errors.

My point is that i cant really just "read the code" or google ...
I gotta know a bit more what was actually modified and a lot of this knowledge isn't fucking documented, theres a lot of " ohhh that weird bug yeah yeah that happens cuz x did this hack some years ago to fix this issue and we kinda built on it, yeah we weren't supposed to do that but heyyy what u gonna do, just do this or that instead"

I was asked to set up a web service to export something, since thats his area of expertise and he is suppose to be teaching me the ropes, i asked him to explain where i should start and what would the general workflow be, his response is to tell me to just copy the IMPORT service and rename it to export then "just do it um change it or something" very helpful indeed (building enterprise application here nothing complex at all!!)

He sits right next to me so i can see how much works he actually does, i know when he just idly sitting there so thats when i ask him questions, he always has his earphones on so each time i gotta find a way to get his attention with a poke or a wave, he will give a heavy sigh and a weary look as he removes his headphones, listen to my question then give me the shortest answer possible before IMMEDIATELY turning away and putting his headphones on as fast as possible regardless of whether I actually understood or even heard what he said. If i ask another question ( am talking like an immediate follow up question for a clarification or something) he will
Do the whole sigh + tired look routing to make me know yeah you are disturbing me. ( god was so happy the day he accidentally sat on and broke them)

Yesterday i caught a glance at his screen as i was sitting down and i think he and another dev were talking about me
That am slow with my work and take forever to get into gear.

Starting to have doubts about my own ability n wether am really cut out to be a developer. I know i can work hard but its impossible to do so when you have no clue where to start and unable to look it up since all the custom hacks doesn't really allow any frame of reference.
Feels like am being handicapped and mocked, yesterday i just picked up my gear n left the office.

I never talk ill about my colleagues, whenever i have a 121 with my mgr i always all is fine, x n y are really helpful etc
I tried to indirectly tell my other colleague about this guy, he told me that guy had kinda mentally checked out of this job and was just going through on auto pilot and just laughed it off (they have been working together for almost a decade and a buddies) my other colleague is pretty nice but he usually swamped with work so i feel bad to trouble him.

Am really Fed up with it all

Me: “Hey boss, you assigned these things to me that I’m not qualified for and have no experience in. We should really hire someone with the specialized skills in this”

Boss “I agree. It’s a role I desperately think we should have hired for a long time ago”

Me “Ok so about these tickets the-“

Boss “I need you to write up a justification for this role, what kind of work the person would be doing and what budget implications we will incur”

Me “You’re asking me to write a job description for a class of work I’ve already admitted I have no experience or qualifications doing MYSELF?”

Boss “Correct”

Me “and I’m still responsible in the meantime for getting these other tickets done still aren’t I?”

Boss “Yes”

Me “Very well. I’ll email you a recap of this discussion then so we can come back to it later when we start hiring for the role”

(and so my ass is sufficiently covered when I inevitably bring down prod and people start asking why I broke prod)

Hey DevRant fam! Hope you are all doing very well wherever you may be. This is not a dev related post but just something i wanted to get off my chest , 20 minutes ago I watched the movie “night school” along side my brother. I was sat down along side two girls on my left and i thought “hey they seem nice” in my mind.

Well i was wrong - throughout parts of the movie she would randomly turn to give me a weird look, as if i was something else? Unfortunately i suffer from eczema and really cant help it and have to undergo treatment monthly and with that comes bullying and judgement from randoms.

What really broke me was that she had the nerves to comment loudly to her friend right next to her about me, say things like “ damn is he ugly “ and many things along those lines, and also about how i ate my pringles? Like hey i love my pringle chips!.

At the end, movie done, my brother is happy I’m happy(not really) we both got up the two random girls walked in front and just gave me this weird stare and had to judge me by the way i walked, thats a whole other issue but i just wish they would have the thought- how would you feel if you put yourself in my position and have to go through my emotions you put me through because you wouldn’t think before you speak ? :-( well thats not everything but some of what i have to deal with unfortunately - sorry this is so long.

Hope all is good for everyone- thank you ☺️

Milo

One of those days when i feel like complete shit and wish i hadn’t woken up.
I heard back from an interview i did last week (one of the faang type) and the recruiter started with “You didn’t impress any of your interviewers”. Man that hurt. I can’t unhear that. He went ahead to say they all recommended a mid-level role for me (they apparently said i had potential and could easily grow into a senior eng) instead of the senior lead i applied for. This is also subject to getting approval to hire mid-level engineers because the team needs more people but they only got approval to hire senior engineers. This cunt also added “dont worry about it. Just go about your usual business and i’ll call you next week if we have gotten the approval”. Ass! All i can do is worry because that is what i do best.
I think i am more sad and disappointed in myself because i thought the interviews went well. Wrote decent code and came up with good solutions on time. Had a good conversation with interviewers. Apparently for a senior, you cannot make mistakes which i did but once the interviewer gave me a clue, i got back on track.
Anyway, i slept with this anxiety, then woke up with tummy ache. On the drive out this morning to go to the bank, i drove my car into a pole and broke off my side mirror. Then my fucking power generator stopped working. And on my way to go and get my fixed mirror from the mechanic, my exhaust pipe broke in half due to a possible pothole i drove into.

Those fucking days where all that could go wrong goes wrong. My head is fucking pounding i can barely move my head without wincing. I am running out of money fast (i support my entire family) and i am worried about not getting a job. This blow to my confidence makes me feel worthless like i am not good for anything. Recruiter suggested i do another senior engineer interview for a different team which i passed the test for but i know the outcome would most likely be the same and i wanted the first team really bad. I just want to lie in bed and cry all day but this fucking headache won’t let me.

Ok so to recap, we had shit beginning. We couldn't find client like 3 months and thank god that we agreed that we don't register the firm right away. If we did we would be broke a long time ago.

We found first client and he wanted to build some scrapers with gui. So me being BackEnd developer I created API for scraping (boredom) and my friend created website for that api and I just created gui that displays that site. The project was about 1200$. And since there are 3 of us we splited it into 3x400$.

After that it was again really hard to find clients again. We thought of quitting and just going to uni or something but we really didn't want to and anyways we needed to get money for uni ourselfs if we wanted to go.

So we said that as we are not paying anything and not losing money we will continue as long as we can.

And after we managed to get a hold of it and now we have 2 clients and after we finish them we have 2 more.

So I think the most important thing is that you help your coworkers. My friend who finds clients had a rough time at the beggining as I mentioned. So all 3 of us got together and started spamming people for few weeks. That's how we found our first client.

So now we are running. Not a milion dollar company but we are happy that we are doing what we love and that we have money doing it. We aim higher but we don't want to hurry and screw things up as we are young still.

Also thank you for getting interested after 300 days :)

This is my first post. I felt like if I'm wrote this I'll just be a big fat crybaby, but i need to release this pressure from me.

I've been pretty burnt out past 6 month.

So a little bit backstory here, I've come from broken family, and currently on my 7th semester of college. But I've been part of small startup as mobile apps developer for a year and a half now.

6 month ago, it just a year of recovery from a toxic relationship that basically ruins my college life. I have really bad GPA (bad score for being absent from classes), basically no friends, and a barely passable (or even bad) skill in Android Dev. Then I got new girlfriend that really supportive for me. But after 2 months, her parents ask me if I would marry her or not. because if not, I have to broke up with her (We're in Indonesia and both of us is Muslim, so outside marriage relationship is kinda in "grey area" depend on who you ask). So I have to choose to marry her or not, and I choose the marriage. I think I have enough saving and just enough income to support both of us.

Then it's been a downward spiral from there.

The startup that I've been working on were in a pretty bad shape. I've been underpaid since the beginning (and that's not really a problem for me at that time, that's my choice and I blame no one) but abysmal growth and some miss management force us to scale back and makes me basically in a non-paying jobs.

So I take college break for a semester and been trying to find projects here and there for marriage savings, but because the weak employee protection here, lots of the projects I have completed have yet to pay the fee (even until today). And even if they paid me, most of it were really low paying jobs (we're talking $200 per 3 weeks project here, to be fair, for our average GDP, it's not bottom-low).

And the deadline is approaching, our marriage date is settled in (very) early January 2019, and i've been in this "not yet graduated but needs job" limbo. Most of employer here still has the old "Degree Based" Job specs, and not "Skill Based" one. so because de-jure I've still a "College Student" no Job listing is willing to take me in. I've apply to almost 30 Job Listing and just get interview once, and still failed because I can't move to the company area, too far and have too expensive living cost vs the salary ($300 living cost vs $450 salary, while i need to give money to my girlfriend back home for a living).

So I switch my direction to Competitions with Extra Job offering as a Bonus, and I've been pretty close to winning one, held by CIMB Bank, but still failed. It's little bit better now because CIMB came interested with me but there is red flag which I need to graduate with decent GPA before July 2019, and in current GPA? it's practically impossible.

Can it getting worse? oh it can. Remember I come from broken home family? it's inherently hard to keeps communication with both of my parents that to this day still despise each other. And while my mother is still supportive to my marriage, my father isn't. He even basically disowned me last week because my one-sided decision to marry my girlfriend, and blame my mother for being the "bad influence" for me.

And now, today, December 16th, and I'm still in this weird Limbo and have nowhere to go. with $0 in my pocket (have spent all of my savings for marriage preparation) And our marriage is approaching. I almost given up.

Context:
Me, Front-end Developer, Javascript stuff
---

Junior Dev: Hey xxzer0, could you help me with this? I spent the entire day on it and at this point, I think I just broke Chrome.

xxzer0: *---* Okay, let me see.

Junior Dev: Do you see it? I am updating the Javascript code but it's not working at all. The browser is not even loading it... Literally, the code I just wrote is not there.

**
Now be me, be the fucking idiot I was and I have been my whole life, I already knew what was going on because I lost a fucking day on it as this guy.
**

xxzer0: Well, let me see just one thing...

'Open Chrome Dev Tools' -> 'Network' -> 'Disable Cache'.

xxzer0: Now try again...

Junior Dev: What are you..doi........ IT'S WORKING! O.O

Chrome, I love you but sometimes I wish you could make this more "accessible" to newcomers.

!rant !notrant !confession_maybe? Bit of a read.

Last year, around September (around 8 months into my first job in the industry), I started loosing motivation to be a developer. By then I had consistently dropped out of 3 or 4 courses for my degree (no penalties as it was pretty much within the starting weeks of the each course). I was think that I do not want to do this. It got so bad that I was looking for other jobs and even trade apprenticeships (I am old-ish so chances of that are so bloody low).
I had my mind set. Including not wanting to finish the degree I had started, which only had 1 year as full time to complete.

My missus supported me in my decision making, but she insisted that I finish the degree as the years I spent on it would have been a waste if I don't. So I agreed, with the idea that I will do this part time when I find another job.

Fast forward to New Years and a very spontaneous decisions was made. I resigned from my dev job and we ended up moving away to another city, two weeks later. By this point on I was so certain that I did not want to be in the IT industry. I had not done any dev work (personal projects or learning new technology etc) outside of the job for months. It had been months since I've visited devrant (to be honest it was not even installed on my phone, mainly because I broke my phone and after having it replaced I had not reinstalled a large portion of the apps I used). I had sold my custom built pc thinking that we do not need two PC's (we kind of don't, she's fine with her laptop) which meant no more dev stuff as none of this stuff was set up on my missus pc. I was looking for all kinds of jobs outside of the IT industry, anything really.

But then something happened. And this is that something. I mean this, deverant. I was flicking through the apps list on google play store, and I saw devrant, and I choose to reinstall it. I began reading rants and comments and I am certain that this made me realise why I want to be a developer. Within about 2 weeks of redownloading deverant I was enrolled full time as a uni student fully motivated to earn my degree.

There are bits and pieces left out of the story. I don't regret leaving my first ever dev job and moving away, it does seem drastic but it changed me for the better I believe. I have the experience from that role and I new fresh start so to speak. I think my missus new this was just a phase, although it felt so certain about it.

I am more of a lurker than a ranter or a commenter on this social platform but I felt that I need to share this. Thanks for reading this. Not really sure what to tag this. Has anyone else experienced this before?

Ever had a day that felt like you're shoveling snow from the driveway? In a blizzard? With thunderstorms & falling unicorns? Like you shovel away one m² & turn around and no footprints visible anymore? And snow built up to your neck?

Today my work day was like that.. xcept shit..shit instead of pretty & puffy snow!!

Working on things a & b, trying to not mess either one up, then comes shit x, coworker was updating production.. ofc something went wrong.. again not testing after the update..then me 'to da rescue'.. :/ hardly patch things up, so it works..in a way.. feature c still missing due to needed workarounds.. going back to a and b.. got disrupted by the same coworker who is nver listening, but always asking too much..

And when I think I finally have the b thing figured out a f-ing blocker from one of our biggest clients.. The whole system is unresponsive.. Needles to say, same guy in support for two companies (their end), so they filed the jira blocker with the wrong customer that doesn't have a SLA so no urgent emails..and then the phone calls.. and then the hell broke loose.. checking what is happening.. After frantic calls from our dba to anyone who even knows that our customer exists if they were doing sth on the db.. noup, not a single one was fucking with the prod db.. The hell! Materialised view created 10 mins ago that blocked everything..set to recreate every 10 minutes..with a query that I am guessing couldn't even select all that data in under 15.. dafaaaq?! Then we kill it..and again it is there.. We found out that customers dbas were testing something on live environment, oblivious that they mamaged to block the entire db..
FML, I'm going pokemon hunting.. :/ codename for ingress n beer..

Still on the primenumbers bender.
Had this idea that if there were subtle correlations between a sufficiently large set of identities and the digits of a prime number, the best way to find it would be to automate the search.

And thats just what I did.

I started with trace matrices.
I actually didn't expect much of it. I was hoping I'd at least get lucky with a few chance coincidences.

My first tests failed miserably. Eight percent here, 10% there. "I might as well just pick a number out of a hat!" I thought.

I scaled it way back and asked if it was possible to predict *just* the first digit of either of the prime factors.

That also failed. Prediction rates were low still. Like 0.08-0.15.

So I automated *that*.

After a couple days of on-and-off again semi-automated searching I stumbled on it.

[1144, 827, 326, 1184, -1, -1, -1, -1]

That little sequence is a series of identities representing different values derived from a randomly generated product.

Each slots into a trace matrice. The results of which predict the first digit of one of our factors, with a 83.2% accuracy even after 10k runs, and rising higher with the number of trials.

It's not much, but I was kind of proud of it.

I'm pushing for finding 90%+ now.

Some improvements include using a different sort of operation to generate results. Or logging all results and finding the digit within each result thats *most* likely to predict our targets, across all results. (right now I just take the digit in the ones column, which works but is an arbitrary decision on my part).

Theres also the fact that it's trivial to correctly guess the digit 25% of the time, simply by guessing 1, 3, 7, or 9, because all primes, except for 2, end in one of these four.

I have also yet to find a trace with a specific bias for predicting either the smaller of two unique factors *or* the larger. But I haven't really looked for one either.

I still need to write a generate that takes specific traces, and lets me mutate some of the values, to push them towards certain 'fitness' levels.
This would be useful not just for very high predictions, but to find traces with very *low* predictions.

Why? Because it would actually allow for the *elimination* of possible digits, much like sudoku, from a given place value in a predicted factor.

I don't know if any of this will even end up working past the first digit. But splitting the odds, between the two unique factors of a prime product, and getting 40+% chance of guessing correctly, isn't too bad I think for a total amateur.

Far cry from a couple years ago claiming I broke prime factorization. People still haven't forgiven me for that, lol.

How I knew this was for me.... I didn't.
It kind of just happened in the natural order of things.

I was once a wii young lad who had a dream, and that dream became a smashing pile of being broke, jobless and unemployable, not a great way to start off that early life but hey, it was what it was.

So I looked at my computer one day, lousy dusty Pentium 4 with a massive 80GB HDD, in the corner, and went... fuck it, this thing is going to make me money.

So from there I picked up my old high school book on VB6 and on with it I went, forcing my self to make that calculator I couldn't do in school and a few other things, from there I got into a course for webDev, not uni, and after being dropped from that course ... that's a story for another time, I basically said fuck the system and my journey into webDev took on a life of its own.

Starting with frontend (back when layouts where tables and css was font colours) and IE5 was still a thing, and progressing into JS for a fucktonne of "onClick" events, then backend... I went down the .PHP3, PHP4 hadn't been released yet, but at the time .ASP was a thing too although it was complicated as fuck.

For many years it was just 1 thing after another, picking up MySQL, screwing around with databases, setting up linux servers, gobbling up Python a couple years later and started automating different things, just building site after site, until one day I landed a professional gig - not just casual freelance stuff, and from there when you think you know a lot, what I thought I knew got blown out the window and imposter syndrome sunk in, but I kept pushing ahead.

That saying "you don't know what you don't know", it has meaning here, you don't know what you don't know... but the moment you know you don't know enough, you either crumble or you keep waterboarding yourself in knowledge to reduce the unknown.

And somewhere along the line I accepted this path.
It may have taken me a few years to get off my feet but I'm glad I took that first step.

Lead: how long do you think it would take to fix the bug?
Programmer: 20 mins with a testing
**Lead an hour later**
Lead: I don't see PR for the fix
Programmer: the fix broke all the unit tests so I am fixing them now.

I fucking hate printers. And printers hate me too.

I've been working as a software engineer for almost seven years now, and not a single day as a printer technician, which does not stop my mother from calling me each time a printer breaks down, as she did today. I hop over to her place, the printer is connected via usb into the ethernet socket, but she swears it's been printing an hour ago, and she hasn't moved a thing. - "weird", I think, "it must be connected wirelessly". Suddenly my sister, who's an Arts major, comes over, saying her printer broke down too - "cool so they're both wifi printers". I reset the router and my sister's printer springs back to life.

But my mom's printer, which is old and in bad shape (the printer, not my mom! assholes...), doesn't. It keeps on displaying a weird error message, and fails to receive any print job, whether wired or wireless.

I spent 15 seconds resetting the router, and 15 minutes troubleshooting mom's printer. Nothing worked.
I finally give up and leave the house.

Not a minute goes by and I receive a "your sister fixed the printer" text from mom.

I fucking hate printers.

I struggled to find the interview location as the company as they were using another companies offices. As I sit down, sweating, feeling rushed for barely making it on time the interviewer says: "Tell us a joke"

I should have got up and walked out, but since I was there already I pulled this one out:

One day, a mechanical engineer, electrical engineer, chemical engineer, and computer engineer were driving down the street in the same car when it broke down.

The mechanical engineer said, I think a rod broke.

The chemical engineer said, The way it sputtered at the end, I think it's not getting enough gas.

The electrical engineer said, I think there was a spark and something's wrong with the electrical system.

All three turned to the computer engineer and asked, What do you think?

The computer engineer said, I think we should all get out and then get back in.

It is the year 2451 ad and mankind rules the galaxy with a lazy iron fist. There are roughly 14,000 civilizations, comprised of just over
17,000 intelligent species on a quarter of a million earth-like
worlds. And all of them call themselves 'the galactic empire'.
No one told them that twenty planets doesn't qualify them for the title "galactic."

Well, we could rule, if we wanted to. Most of its just backwaters that no one wants anyway. It turned out that the reason no one invaded earth before was because they were too busy fighting themselves. Stupidity it appears, is not a unique human quality.That and the sex robots. Theres more of them in the galaxy than actual meatbags. Many species had taken to artificial wombs and 'vatbabies', which is exactly what they are called. Those poor bastards will carry that label for life.

We never did break light speed, but most of the rich exist in hypersleep anyway. Most of them only wake up once a year or so. There are some that only creek out of bed to check their stock portfolio. I hear there is even one trillionaire thats up and about once a century to ask if we have broken light speed yet.

Despite all the progress over the last 400 years, historians all agree about the most significant event in modern history.
The lobster went extinct two hundred years ago on earth.
Theres been riots ever since.

* * *

In other news I'm still working on the game I guess. It's like totally the most okay indie game you'll ever play--if I ever finish it.

I put about a year of work into the NPC system, and then chatGPT came out.

After everything thats happened, at this point I may just make a game about an indie dev making a survival game, being stuck in the actual apocalypse or some weird political dysopia.

Put it on rewind, it was originally a zombie game. But at the time the market got flooded and steam sales for zombie games cratered. So I pivoted to something more along the lines of fallout. Then the flash market crashed, bunch of publishers folded, and adobe stopped support for flash (probably for the best). Then newgrounds, which I was gonna launch on for promotion (because actual marketing is expensive), ended support for flash.
Was going the route of kickstarter, and that year the KS market got flooded and the bar rose almost over night so you needed super high production quality out the gate, and a network of support you already built for months.

We had a brief nuclear war scare, and I watched the articles come out about market saturation for post-apocalypse games, so I pivoted back to zombies. Then covid happened and the entire topic was really fucked. So I went back to fallout meets rimworld. Then we had a flood of games doing that exact premise pretty much out of the fucking blue, so I went for a more single-survivor type game. Then ukraine happened and the threat of nuclear war has been slowly sapping the genre of its steam, on well, steam.
Then I was told to get a cancer screening which I can't afford. Then I broke a tooth and spent a month in agony.

Then a family member died. Then I made no money from the sale of a business I did everything to help get off the ground, then I helped renovate an entire house on short notice and sell it, then I lost two months living in a hotel
while looking for a new place to live. Then I spent two and a half years suffering low-level alcoholism, insomnia, and drifting between jobs.
Then I wrote amazing poetry. And then I rediscovered my love of math. And then I made out for the first time in over a year. And then I rediscovered my love of piano and guitar. And then I fell into severe depression for the last year. Then I made actual discoveries in math. And I learned to love my hobbies again, and jog, and not drink so much, and sing, and go on long drives, and occasional hikes, and talk to people again, and even start designing games and UIs again. And then I learned that doing amazing things without a lot of money is still possible, and then I discovered the sunk cost fallacy, and run on sentences, and how inside me there was a part of me that refused to quit because of circumstances I couldn't control, and then I learned that life goes on even when others lives have ended, even when everything and everyone never had an once of faith in you, and you've become the avatar of the bad luck brian meme..still, life goes on.

And we try to pick up the pieces, try, one more time, because the climb, and the fall, and the getting back up, is all there is.

What I would recommend, if you're thinking of making a game, or becoming an independent game developer, is, unless you have a *lot* of money upfront (think 50-100k saved, minimum, like one years income *bare* minimum), and unless you already have a full decade in the industry--don't make a game.

Just don't.

Not really a rant and not very random. More like a very short story.

So I didn't write any rant regarding the whole Microsoft GitHub topic. I don't like to judge stuff quickly. I participated in few threads though.

Another thing is I also don't use GitHub very much apart from giving 🌟 to repos as a bookmark. Have one hobby project there. That's all. So I don't worry that much. I'm that selfish and self concerned. :3

I was first introduced to version control system by learning how to use tortoisesvn around 2008. We had a group project and one of the guys was an experienced and amazing programmer unlike the rest of us. He was doing commercial projects while we were at our 1st and 2nd year. Uni had svn repo server. He taught us about tortoisesvn. He also had Basecamp and taught us how to use it as well. So that's how I learned the benefits of using versioning tools and project management tools. On side note, our uni didn't teach any of those in detail :3

After that project, I was hooked to use versioning tools. So until school kicked me out, I was able to use their svn server. When I was on my own, I had to ask Google for help. I found a new world. There are still free svn services that I can use with certain limited functions. That's not the new world; I found people saying how git is better than svn in various ways. It was around 2010,2011.

At first I was a bit reluctant to touch git because of all the commands in terminal approach. But then I found that there is tortoisegit. I still thank tortoisesvn creator for that. I'm a sucker for GUI tools. So then I also have to pick which git servers to use. Hell yeah, self hosted gitlab is the way to go man. Well that's what the internet said. So I listened. I got it up and running after numerous trial and error. I used it briefly. Then I came back to my country on 2012-2013; the land of kilobytes per minute (yes not second, minute).

My country's internet was improved only after 2016. So from 2013 to 2016, I did my best not to rely on internet. I wasn't able to afford a server at my less than 10 people, 12ft*50ft office. So I had to find alternative to gitlab which preferably run on windows. Found bonobo and it was alright. It worked. Well had crazy moments here and there when the PC running Bonobo got virus and stuff. But we managed. We survived. Then finally multi national Telecom corporates came to our country.

We got cheaper and faster mobile data, broadband and fiber plans. Finally I can visit pornhub ... sorry github. Github is good. I like it. But that doesn't mean I should share my ugly mutated projects to the rest of the world. I could keep using Bonobo but it has risks. So I had to think for an alternative. I remembered that gitlab didn't have cloud hosting service when I checked them out in the past. So I just looked into Bitbucket and happy with their free plans of 5 users and unlimited private repos. I am very very cheap and broke.

That's why I said I don't really care that much about the whole M$GitHub topic at the beginning. However due to that topic, I have visited GitLab website again and found out they have cloud hosting now and their free plan is unlimited users and unlimited repos. So hell yeah. Sorry BB. I am gonna move to cheaper and wider land.

TL;DR : I am gonna move to GitLab because of their free plan.

I started off in a MNC company as a junior developer. I entered with candy glasses.
I didn't expect to win the lottery. Of getting abuse by superior.

I stayed for a year, at the project. Constantly being belittled by this team lead. It was awful i enter as a fresh grad. All the new tech were so new and scary at that point.

During my time there, i constantly think that developer is not my stuff.

Ultimately i reach the state of burnout. I reached out to the manager and broke down in his office.

I actually told the manager. "I hate coding"

I remember staying up to 4am just complete a piece of program. To be ready to be push to production the next day. My team lead just come screaming at me saying there is bug.

Upon receiving that message via skype. I broke, tears flow down my eyes.

After which i reach a state of burn out. I start to reach out to external parties for help to get me out of there.

Now i am recovered from the burn out. I am curious of the technology that were utilized in that project. I literally face palm. After understanding the technology it isn't so hard after all. I just didn't gear myself up with the tech.

I still do enjoy working on code.

I think I broke it gg

Had my junior test at work yesterday, and...oh boy. I don't think I've ever been so stressed in my life.

>inb4 "welcome to the real world kid"

Yeah yeah I know but god damn, this was too much. I heard from seniors that you get used to everyday stress, it comes with the job, but junior test ( aka "stress test") is the breaking point for most "new" arrivals.

The test itself tho is not even that hard. Dealing with so much stress and time pressure for the first time is what gets you. Not knowing what happens if you don't pass certainly doesn't help.

I broke down at one point and even after finishing, going home (got no sleep) and coming back today, that feeling of hopelessness is still there.

No real point to this rant, I just needed to vent

I'm really not sure. When I was 7-8 years old, I liked to view source in IE, then I somehow managed to use Javascript in the browser. First only some dumb opening of windows. And I liked Batch, so I made some files for copying, backup and stuff.

Then I got to PHP during the years from some online tutorial about making dynamic websites. My website was more static than stone, but yeah, I did page loading with PHP! Awful experience anyway, because I had to install Xampp, get it work and other stuff. 11 years old or so. (and I used Xampp only as a fileserver between laptop and desktop later, because.. PHP4... just no.)

As 12 years old or so I experienced my first World of Warcraft (vanilla) on a custom server in an internet cafe and I thought it's a singleplayer game. When I found out that no, I googled how to make my own server (hated multiplayer back then and loved good games with huge storylines). Failed miserably with ManGOS, got something to work with ArcEMU. There I learned some C++ basic stuff, which I hoped would helped me to fix some bugs. When I opened the code I was like: "Suuure." and left it like that. I learned what a MySQL database is, broke it like four times when I forgot WHERE and still rather played with websites i.e. html, css, js and optionally php when I wanted to repair a webpage for the server. With a friend we managed to get the server work via Hamachi, was fun, the server died too soon. Then I got ManGOS to work, but there wasn't really any interest to make a server anymore, just singleplayer for the lore. (big warcraft fan, don't kick me :D )

I think it was when I was 13y.o. I went to Delphi/Pascal course, which I liked a lot from the beginning, even managed to use my code on old Knoppix via Lazarus(Pascal). At this age I really liked thoae Flash games which were still common to see everywhere. So I downloaded .swfs, opened and tried to understand it. Managed to pull some stuff from it and rewrite in Pascal. Nope, never again that crap.

About the same time I got to Flash files I discovered Java. It was kind of popular back then, so I thought let's give it a try. I liked Flash more. Seriously. I've never seen so much repetitiveness and stupid styling of a code. I had either IDE for compiling C++ or Pascal or notepad! You think I wanted my code kicked all over the place in multiple folders and files? No.

So back to Pascal. I made some apps for my old hobby, was quite satisfied with the result (quiz like app), but it still wasn't the thing. And I really thought I'd like to study CS.

I started to love PHP because of phpBB forums I worked on as 15 y.o. I guess. At the same time I think there was an optional subject at school, again with Pascal. I hated the subject, teacher spoke some kind of gibberish I didn't really understand back then at all and now I find it only as a really stupid explanation of loops and strings.

So I started to hate Pascal subject, but not really the lang itself. Still I wanted something simpler and more portable. Then I got to Python as hm, 17y.o. I think and at the same time to C++ with DevC++. That was time when I was still deciding which lang to choose as my main one (still playing with website, database and js).

Then I decided that learning language from some teacher in a class seriously pisses me off and I don't want to experience it again. I choose Python, but still made some little scripts in C++, which is funny, because Python was considered only as a scripting lang back then.

I haven't really find a cross-platform framework for C++, which would: a) be easy to install b) not require VisualStudio PayForMe 20xy c) have nice license if I managed to make something nice and distribute it. I found Unity3D though, so I played with Blender for models, Audacity for music and C# for code. Only beautiful memories with Unity. I still haven't thought I'm a programmer back then.

For Python however I found Kivy and I was playing with it on a phone for about a year. Still I haven't really know what to do back then, so I thought... I like math, numbers, coding, but I want to avoid studying physics. Economics here I go!

Now I'm in my third year at Uni, should be writing thesis, study hard and what I do? Code like never before, contribute, work on a 3D tutorial and play with Blender. Still I don't really think about myself as a programmer, rather hobby-coder.

So, to answer the question: how did I learn to program? Bashing to shit until it behaved like I desired i.e. try-fail learning. I wouldn't choose a different path.

I don't work for Walmart, but they almost put my job in jeopardy today. I have a console app in production that pushes Walmart orders from their marketplace into our system for fulfillment. For half a year, I have handled thousands of orders, but overnight, all customers were getting massive price cuts on products in the Walmart feed! I looked at the data and initially thought it was my error due to using a quotient instead of a product in the code. But upon closer inspection, some fool at Walmart had changed code on their end without telling my team! Broke all the things. Lucky we were able to pull a full stop before we lost disgusting amounts of money, but you would think that a big player like Wally would at least announce a breaking code change to their users. 😲😡

f it ain't broke, don't fix it!
I feared my Android phone's touchscreen suffered severe damage from using it in the rain, until I discovered that the 3-button navigation stopped working after an Android 12 security update (both in Nova launcher as well as in official Google Pixel launcher). Wasted time drying the unplugged phone and googling for repair options before finally wasting more time changing system settings back and forth, rebooting, changing system settings, rebooting, etc.
Remember those happy times before mobile phones have been invented, which of course I don't really want back either. I just want developers to stop breaking features that used to work. Regression testing outside the happy path, anyone? I mean, it's not a hacked maker project, it's a commercial phone that I bought and intend to use with the latest official software. Don't want to think about the next breaking changes that Android 13 might bring.

Personal mini-project from a million years ago which I practically don't maintain anymore, broke. External APIs are being bitches.
Made a fix, but I'm too lazy to push. (I don't think anyone else is using it tbh)
Huehuehue.

Let me introduce you to sys. admin + network admin + teacher at our school... She gave us "materials" to study for our school-leaving exams (called matura here - wiki that shit) so I looked at it and just had to comment everything that's wrong (and that's only the first paragraph)...

Apart from making utterly useless documents she also likes to think she is the best in the world and what she says is right and everyone is wrong. Networks that she builds crash 8 times a month, she can't install proper drivers and believes that open source and GNU/Linux is evil. (She also lives by herself, is around 48 years old, is a lesbian(not that it is a bad thing - just for context) and got one brilliant teacher who actually knew what she was saying and doing fired because she broke up with her)

Thinking about it - no wonder my classmates are all so confused and stressed... she can't teach and says bullshit like printers work with the RGB color space and when confronted she would shout that there are no printers that use CMYK, she has never seen one so they do not exist. (only to proceed changing CMYK ink cartridges in the printer)... I mean it's good for me because I get to teach pretty girls programming and informatics but I am sorry for the boys... Unfortunately I don't have the patience to teach someone programming and informatics unless they are a girl and I see a chance to evaluate that person's qualities to be a girlfriend.

I HATE the idea of only releasing on pre-determined schedules despite work being completed and just waiting for that day to arrive.

I'm a co-founder of a small software company. We have partnered with another particular company that also writes software. Some of our clients have access to paid content of that company's services through our application.

Every once in a while, our clients will report issues with that company's service to us, because they access it through our application. They think it's our issue.

We then pass the report on to the partner company, telling them that their stuff is broken. Their reply goes like this:

"Ok. We'll get the bug fix scheduled, and we'll release it next Thursday."

"Next Thursday? The issue is now, they can't use the service."

"That's our scheduled release date."

O.M.G.

We voluntarily walked away from our safe, cushy jobs working for other people, taking enormous pay cuts to start this company. Now, we're 6+ years in, disrupting established fat-and-happy competitors in this space. I GUARANTEE you that if we had that same attitude, we would have been absolutely obliterated early on.

We are quick. Guided by kanban boards, our suite of unit tests and integration tests is vast and kick-ass. With continuous integration and the click of a button we know if we broke something or if the piece we're working on is ready to be pushed to production, IMMEDIATELY. Our "release schedule" is when the damn thing is complete.

It isn't all bad. Our integration with them has been beneficial for both of us. I just loathe their snail's pace which negatively affects our mutual customers. It can make us look bad, and we can do nothing about it.

Blah.

- A colleague introduced a regression through an error nobody would ever think of (as in: the code broke in a way no sane person would ever guess)
- I noticed the regression in develop, tried to pull a sneaky fix to avoid causing troubles
- Permissions got switched up in the past 2 days or something, I'm not listed as a releaser anymore
- Talked to my TL, he accepted my PR but said "I can't give you the releaser role anymore"

So, I tried at the same time helping out a colleague without causing a fuss and improving the product, and lost a role in the process. Love to see it.

Okay then, ex-android user there.

It started with Xperia TX - it was flagship Sony phone back then. It blew my mind when I touched it for the first time. You know, exploring android for the first time in my life was amazing.

It ran just well for about a year. Then it started to fall apart. I need to clarify that I kept it non-rooted, full stock. I'm not into that customization things.

At first, I noticed significant lags. They were everywhere. The longer I used smartphone, the more lags I encountered. I did factory reset, but lags haven't gone anywhere.

Year 2. Front camera stopped working. Battery became unreliable as fuck, going down to 40% and then instantly to zero. What?

Year 3. Camera broke. It refused to start, just giving me "Camera is not available" error.

I tried factory reset again. It helped at first, but month have passed and all that issues came back. And it also became sluggish as fuck.

Got Meizu m3s year ago. The exact same story. Long story short, in one year I got this:
1. Black spots on every picture I take. Much likely a matrix issue.
2. Camera also became slow as fuck, requiring about 10 seconds to even start.
3. Vertical stripes all along the screen. I never dropped my phone, it just appeared once and became brighter and brighter every day I used the phone.
4. Two huge yellow spots on screen. I think it happened because phone's cpu heat up the screen and it broke.

But the most important thing is that fucking lags chased me in every app, they were everywhere. Fucking tiny-ass lags. And they're not going anywhere, they're become more and more significant with time.

Don't say me about oneplus, samsungs and other top android phones. They are conceptually the same, the only different thing is hardware.

That's why I switched. IPhone has its downsides, but it's silky smooth. And my friend's iPhone 4 (not s) feels just as smooth as my brand new se.

I'm not going to jailbreak it. I don't need customizing the hell out of it.

I just needed quick and reliable phone, and SE seems to be exactly what I wanted.

Peace to android folks tho✌️

Tldr: I think I made a company fire some dev a year ago.
I was working for this company remotely, alone, on a very big and old legacy php project where they still used echo '<code><code/>'; and i was a very junior junior front end developer, needed to make the website work somehow (whole new design). They brought in a random guy to work with me, and we started working.. I was using bitbucket to version my changes, and I asked him to do the same. He tried pushing his changes once and then practically never again because he started working in files that i was working on and there were git conflicts, and he gave up, even though i asked him to do that... he then statted using general classes to style the page (like .color) with absolute positioning and it broke everything everywhere. He then proceeded to minify half of the php files 'because of performance', I remember talking to other few people in the company and he disappeared a few more days later. I never finished the project because they stopped it randomly and i think i got him fired even though he could've continued working in the company

The universe has taken a cactus.

It proceeded to gift the cactus with a toxin that greatly enhances the stimulus of pain.

After the universe watched it's miraculous creation it decided to shove it up so far my arse that my gag reflex turned on and I puked a lot of cactus.

Didn't sleep well, weekend hardware migration finish, today an old server got moved.

Some part, most likely the redundant PSU, had a short circuit - decided to take the switches out... Which are the only non redundant hardware...

There was only one critical system in the whole rack, that was one redundant firewall.

Guess what happened..... Naaaa?

*drum roll*

For whatever reason, the second firewall didn't kick in, so large part of internal network unreachable as VPN was on the firewall.

:thumbsup:

That's not cactus level yet.

Spontaneously a large part of the work at home crew decided to call, cause getting an email wasn't enough.

So while all the phones were ringing and we had the joyful fun to carefully take apart a whole rack to check for possible faulty wiring / electric burns / hardware damage and getting firewall up and running again...

Some dev decided to run a deployment (doable as one of the few working at the company at the moment -.-).

I work from home, but we had a conference phone call running the whole time so I could "deescalate" and keep others up-to-date. So me on headphone with conference call, regular phone for calls, while typing mails / sms for de-escalation.

Now we're reaching cactus level, cause being tortured by being annoyed out of hell by all telephone ringing, the beeping of UPS (uninterruptible power supplies), the screaming of admins from the server room and the roaring of air coolers…

Suddenly said dev must have stood in the midst of the chaos… and asked for help cause "the deployment broke, project XY is offline"...

I think it was the first time since years that I screamed at the top of my lungs.

Bad idea (health issues)… but oh boy was it a pleasure to hear my own voice echo through the conference speaker and creating an echoic sound effect.

It was definitely worth coughing out my loungs for the next hour and I think it was the best emotional outburst ever.

I feel a bit sorry for the dev, but only a tiny bit.

After the whole rack thing, the broken deployment fixing and the "my ears are bleeding and I think I will never be able to talk again" action...

We had to roll out several emergency deployments to fix CVEs (eg libexpat).

This day was a marvelous shit show.

I will now cry myself to sleep with some codein.

I'm literally in pain right now and not a thing I can do.

If I eat whatever the fuck is wrong with my jaw (cracked tooth or cavity) starts throbbing from the chewing action, in addition to coming on for no reason at all. vision-blurred-waves-of-nausea levels of pain. Enough that I'm alternating between laughter and almost tears.

I've downed four aspirin and it's still just barely enough WITH the numbing gel.

Got lock jaw something aweful.

Barely convinced a dentists office, which is supposed to be closed (and cancelled all it's appointments due to corona), to come in during quarantine. But thats monday. Dont kno how I'll make it. They do payment plans but I'm flat broke because I decided to pursue programming right when all this fucking bullshit went down.

And all I can think of while im typing this is the pain.

And fuck me I cant do weed because my backup plan if I fail at coding is the military.

And this stray dog that the neighbors 'adopted' but leave outside WONT STOP FUCKING BARKING.

Fuck me. Just kill me now. Do it.

Gonna go watch comedy because I read a research paper that says genuine laughter raises pain threshold by up to 10%.

For some reason I would find it quite nice if Brackets or some other good IDE had a mobile version.
Since I don't have a laptop at this time and I'm a teenager that is dead broke, I might as well be able to work on my projects on my phone and just upload them into my drive for later use.
Because trying to do my school projects is annoying when all of the computers/chromebooks don't have anything that I can use.
(And because they're district devices, you can't do much except for what they want you to)
So I end up having to either wait until my actual programming class (which is an hour long, and since we're sitting down at a computer it feels like 20 minutes) or I could wait until I get home and do it on my desktop PC.
So yeah, I think it'd be nice for a mobile Brackets (or other IDE, I just personally like Brackets)

I've been feeling very bad because I don't think I've been making good use of my free time. So I decided to change.

Looked at my goals, first in line, getting a driver license.
For that, I need to arrange times for practice with my dad.
For that, I need a clean timetable. I had one but teachers are lame and don't respect the times of course.
So, I need to print the new one I already had done.

So I went to the printer.
And it prints awful, everything is pink because it doesn't print yellow.
Fine, let's change the cartridge.
Printer refuses to work, it throws a stuck paper error.
My dad tries to fix it putting fingers inside. Nothing.
We suspect it's the new cartridge, change the new cartridge chip with the one the old one had. Printer fooled.
It still doesn't work. Stuck paper.
My dad admits he felt he broke something when he reached inside the printer..
We had to disassemble it and fix the broken part.
Now it works again.
It still doesn't print yellow.
We'll have get it fixed or get a new one.

I guess I have to draw my timetable by hand...
Sucks, I made it using html and flex. Every 1fr was 5'.
I'll make a gist if anyone is curious about it.

Alright, I'll try writing about my recent experience without getting too emotional.

A few months ago, I started a tech job in London and immigrated here for that job. I was glad this company wanted to sponsor a visa, as that was a requirement for me to live here.

Unfortunately, after only a few months in, I learned that the company I joined wasn't quite as nice as I thought it would be. Bullying seemed to be part of the culture. On occasion, I saw coworkers crying. One of my close coworkers was dangerously close to burnout and then "left with mutual agreement". The environment felt like a high school cafeteria. People were drinking heavily early in the afternoon and people were leaving almost at the speed of a revolving door.

I recognized very early on that this was not a healthy environment for me, but as I just signed a rental agreement for a year, and spent a large amount to move here, I was kind of trapped.

Very early on, I was told that the two people before me in the same role were let go right before their probation ended. That scared me off, for reaching out to management or HR. I didn't have the financial needs to lose my job, and due to visa restrictions, therefore would have to leave the country.

When my probation was about to end, and I learned that my performance was good, I decided to provide feedback to my manager. I only mentioned a few things, but still enough. The manager seemed receptive, but it did not seem like he was actually willing to approach the problem itself.

Sometime later, I spoke to HR, explaining some of the issues, and explained my intent to resign. The rep pretended to care, but it did not seem sincere. At the same time, I reached an agreement with my landlord, so I believed I had enough money to safely move out of the country.

A few days after I resigned, the HR rep told me that I owed the company a large amount of money. A part of it was in the contract, which I accounted for. Another part, she was claiming, but was not properly defined in the contract. It said something, but it was confusing. I got a checked later with a legal advisor, and from what I understood, the company would never be able to make me pay that extra amount. This simply because of the contract being so vague.

I told the rep multiple times in the initial meeting about the flaws in the contract, but she ignored everything I said. I then made a counteroffer trying to get her to back off. She then put that in writing, but manipulated my words and kept out all the arguments I made about contract flaws, and my departure being the company's fault.

I didn't receive a reply to my counteroffer for days. It was stressing me out as this could mean I would run out of money soon. Only a few days passed before I got a medical emergency at work just because of the stress all of this caused me.

I saw a doctor and immediately got 2 weeks of sick leave. When I contacted the company again, I was able to terminate my contract, without returning to the office. However, they still didn't want to waive the extra amount of money.

The HR rep pointed out in written communication to my lawyer, something in the trend of "if something wasn't clear in the contract, he should've just asked for details". In that same correspondence, it also stated that they were offering 'as a favor to me' to reduce the extra amount to only a third of it.

Since I never actually wanted to go to court anyway, I decided to settle with that. Now I'm packing to move out of the country, without a job and soon to be completely broke. If I would've stayed where I were and never moved to London, and never worked a day for the past 7 months, I would've had more money on my savings account than I have at this point in time.

I hope I at least learned something from this. I don't think I will move somewhere with a company-sponsored visa again anywhere soon...

Thanks for listening. Ranting does make you feel better :)

I'm a student but I've been working backend and frontend for about a year and a half now. I know just enough to be frustrated whenever a teacher says the words "group" and "project". Anyway, there was an assignment due yesterday for my group, and it was working more or less perfectly, then at the last minute, this guy gets on and tries to "fix" an issue that the teacher said specifically we didn't have to solve.

HE. BROKE. EVERYTHING. And then he pushed straight to master. Ironically, the program still ran, it appeared to be encrypting and decrypting correctly, but he basically removed one of the algorithms we were supposed to implement. I think the professor will give us a better grade than we deserve but still...

Things you should not say on your last day of work:

If I broke it, I think it would be pretty obvious.

Let me check Slack
Just before I go to bed
Just in case — OH NO

It’s not what you think
It isn’t like I broke prod
… request makes me cringe.

Fucking google maps JS api. One should think that a company as large as google should be capable of providing a reliable api. But this fucking api just decided for the second time in two weeks just to stop working.

After the api failed for the first time i found out that the provided url actually fetches the experimental version of the api (yes you read that correctly a fucking unstable version is the default version). To get the stable version of the api one has to add v=3 to the request. But even after adding the version the api just broke again today!

Fuck it! Google get your shit together!

Just thinking about switching to OSM...

A friend of mine who wants to learn about Linux has a stronger will than me, as I think installing Linux in 2020 is gonna break me but he's still stoked as shit. I'm fucking serious. He asked me to install several distros, in order of interest (because they all fucking failed, because of fucking course they did) on a USB HDD he was using just for this.

We tried, in order:

Arch: initramfs wiped his Windows HDD when it crashed. IDFK how, but it zeroed the top 32KB of the drive. It wasn't even the right HDD...

Linux Mint: nvidia drivers refused to see his GPU after install. No matter what we did. Live media saw it fine until it was installed on the external drive, too.

Debian: Installer couldn't see the external HDD, ever. No matter what we did. It had a /dev entry, lsblk and fdisk saw it, I could format and mount it, but the installer crashed when it refreshed the device list when it was present. Every goddamn time.

Fedora: Installer broke halfway through as an executable (or 70) were corrupted, but the disc matched the ISO and the ISO sums correctly, so this is apparently how it was packed and shipped.

CentOS: Refused to boot. Just entirely. GRUB would go to load the kernel and it'd hang.

All ISOs and discs were verified as matching provided sums using MD5 and SHA256. How the fuck is Linux so fucking hard to get working on older hardware in 2020? Worked great in 2008, worked great in 2018, why is 2020 such a goddamn issue?

Not sure if junior dev is lying or just really bad at using the search function. He made sweeping changes in code he inherited from me and failed to find all the jQuery selectors that broke because of it. And he didn't think of clicking on all the other buttons on the page to check they are still doing their thing. Of course claiming that there is no time for testing when I pointed out his mistake. Wish he'd stop being such a bad, this is not the first time this has happened!

An app I wrote in react native broke. It just checks for new episodes and opens the actual download link so this all the ads. The URL seems to have changed from www to www1.... So the Find/Replace broke.

I don't think I will be using RN though because I can't access all features like root commands, that can be done from Android SDK. And probably easier to access all Android's features?

So should I try to fix the RN code (prolly 1 line) or port the whole project to use Android SDK?

The first dev project, like real dev project, I participated in was a school one and it was double.
The class was meant to make us learn about the software's life cycle, so the teacher wanted us to develop a simple, yet complicated, thing: a Web platform to help tutors send/refer students to the university services (psychologist, nutriologist, etc) and to keep track of them visits.
We all agreed on it being easy.
Boy were we so wrong.
I was appointed as dev leader as well as some others (I was the programming leader, the other ones were the DB guy and the security guy) and as such I was in charge of the technology used (well, now we all know that the client is the one in charge of that as well as the designer) and I chose Django because we had some experience with it. We used it for the two projects the teacher asked us to do (the second one was to find a little shop and develop something for it, obviously with the permission and all that), but in the second one I decided to use React on top of Djangl, which ended being a really good combination tho.
So, in the first project, the other ones (all the classroom) started to discuss and decided to use some other stuff like unnecessary carousel for images, unnecessary functions, they created mock ups for stuff that was never there to begin with, etc. It was really awful, we had meetings with the client (the teacher) with updates on the project, and in not a single one he was satisfied with the results. But still, we continued with the path the majority chose and it was the worst: deadlines were not met, team members just vanished until the end of the semester, one guy broke his leg (and was a dev leader) and never said a word not did anything about the project. At the end, we presented literal garbage, the UI was awful, its colors were so ugly because we had to use the university official colors, the functionality was not there, there literally was a calendar to make appointments for the services (when did the client ask for that? No one knows), but hey, you could add services and their data to it, was it what the client wanted? Of course not! What do you think we are? Devs?
Suffice to say that, although we passed with good grades, the project and the team was shit (and I'm counting me in)
The good part is that the second project was finished by me and it looked really good, yet it didn't matter, the first project was supposed to be used by the university, but that thing was unusable.
Then, in the subsequent vacations I tried to make pretty and functional/usable, yet I failed because I had a deadline for another thing I had to do, but hey, the login screen looked amazing!

Hi guys, as I think this is the perfect good place to share point of view, I would love to know what do you think.
Years after years, people fight against hacks/piracy, like governments or video games editor.
Recently, we all heard about that piracy team who said that in the close future, breaking games protection would be impossible, yet the famous Denuvo (DRM) even if hard to break, is still broke few days/weeks after game release.

Here's what I think.
No matter what, hacking/piracy will always have steps ahead of protections. Because that's the way it is, the way it works. Maybe protections will be effective for a while, but there will always be somewhere, someone smart enough to break it. I start thinking that when a iPhone/Sony claims that they were safe and Geohot break their protections one by one.
There is no perfect protection.
(Quantum computers aside).

What do you guys think?

Today is thursday. Oh no.

At thursdays I have a 8h30-19 schedule (I have 1h30' of free time to go home and cry after I finish a class at 15h30 though) and there's this one class I DREAD. It's a 2h class at 17h and it's an exercise class. This wouldn't be so bad it I actually understood the code behind the exercises, because they don't teach us code in the theory classes (btw it's C. I hate that language because of all this). The teacher pretty much tells us "do this exercise", waits like 10' and then starts to (try to) explain what we're supposed to do. Oh my god.
The other day he was like "write "exec ( ... "text" ... )", compile and execute". It didn't work. Of course it didn't why would it? I was switching around between terminal, manual and text editor, to no avail. In the end he explained but I don't think I got it.
Every time I think about this class I die a little inside and start to become somewhat anxious to be honest. The theory is not that that hard, the practice part is what is killing me (I have test in 2w but I'm just gonna start studying earlier so I can go watch this match LoL).
Does someone know a good book (preferably online, if possible) or a good website on C? I really need to read that, that language is killing me.

Bonus: the other day I had to do a homework that was to be delivered. We had to write a program that read the program and its arguments like this:

./program_name
numArgs
arg1
arg2
etc

I wrote the code, had some bumps in the way, asked a colleague for help because we needed to have a custom function made that was to be done in the class but that I couldn't make because of the reasons above. Then it came the time to test. My VM broke (I think I'm gonna format my PC to try to fix that. Have installed some other versions of the VM but the installations fails or the machine doesn't start) so I sent it to said colleague to test. She said it did OK and so I sent the work to this website we have to send our works to.
"2 errors".
What? What happened? She said it worked just fine.
Looked at my code, couldn't see anything wrong.
Asked the same colleague for help.
Turns out I missed a space. A SPACE. I don't think I've ever felt so frustrated in my life. A presentation error in Java is a good thing, at least we know the program works fine, it's just the output that's wrongly formatted. But C? Nope, errors all around, oh my god. I'm still mad about it.
And I owe her a chocolate.

The Jio phone out of India actually looks like a cheap ($10ish dollars) but worthy little option if you just want something to mess around on but don't want to drop $30-40 (plus shipping) on a pi.

Only 4gb storage, 512mb ram, 240x320 screen, dual core 1ghz, just enough to experiment if you're broke.

What do you think? Any indian programmers familiar with the Jio?

I'm not running out to buy it or anything. I stumbled across it and wonder what people's opinions of it are.

RANT

I am finally coming to the realization that I hate my job. I love working in my field but the place I working for saps my soul. It feels like a battle going to work every day.

I'm not sure if it because it is inherent working in local schools but it always just turns toxic. Teachers think you are their personal slave and why they can't get their class statistics up. Then they complain to the administration. That administration expects us, a skeleton crew, to bend over backwards, stop what we are doing, and fix everything. Because we aren't doing anything at all and we broke their shoot out of spite.

On top of that, and don't get me wrong, 1:1 is nice and all but it isn't just buying devices and giving them to teachers and hoping for the best. You have to invest in support, programs that work for the teachers in using the devices, and TRAIN THE TEACHERS!!! Teachers are smart in their own way but the online lifestyle isn't for everyone or of the box.

All in all, I just hate having to justify everything I do to people who just think everything is free and I have no personal life outside of work.

/rant

Back when I was a freshman in high school a friend of mine put an emulator on the shared drive, so we could play NES games while in the computer lab. Didn't know better/didn't care. One day I get pulled out of class and walked into the computer guys office. In there is also the principal of the school and the Chief of police.

The computer guy tells me there was an issue last week that caused the school server to crash and it caused damage. I asked what happened and the he said one of the emulators we were playing had a script that crashed the server and caused damage. I asked how much damage and they informed me it was over 3 thousand dollars. At this point I'm very skeptical that the damage was worth about the cost of a new workstation (the old one sitting on his desk, buried in boxes), and afterwards none of the faculty knew of any kind of an outage. I asked for him to show me what broke and what had to be done to fix/replace the damaged equipment but all I got was a simple, "I'm sorry. I can't show you that at this time."

They threatened legal action for a felony of damaging a school property. Myself and the other tech savvy kids talked about it over the next couple of days wondering what would happen. They threatened expulsion for myself and a couple of other kids, but ultimately just got a talking to about keeping personal information safe.

What I got out of it was if they think I'm good with computers I must be doing something right. Now I'm in IT. This is where it went wrong.

Not a dev question but a cultural question for any of the German devs I’ve seen post here.

My American daughter is living in Germany on an exchange student program. She’s frustrated right now because her host dad and host brother are being really rude and impatient with her over her difficulties with speaking the language. She currently writes it better than she speaks but that and her efforts to keep trying don’t seem to matter to them. This conflict spills over into other social interactions. They constantly berate and make fun of her over everything. The host mom and host sister are nicer and more patient. But they also have to put up with this boorish behavior from the males.

On a train ride home, my daughter was sexually propositioned no less than three times in one hour by three different men. And at festivals she went to where there was lots of drinking, it was even worse.

A German exchange student we once had living with us here in the US regularly broke program rules, slept around, and even downloaded child porn on our network (highly illegal and alarming). My wife was the coordinator for many years to govern the students who came here from many countries and we struggle to think of any but one or two German boys who acted like gentlemen toward ladies.

So is it just a “German guy” thing and commonly accepted in the culture? Or is this type of behavior generally frowned upon and these guys are just in a minority of jerks that we keep having the bad luck of running into?

I know the same question can be and is often asked about American men, too. But I’m more interested in knowing how Germans view Germans who act this way.

Why do I always get attached to dead/dying platforms 😖😫😭
I mean, I got the PSP Go a mere year before devs dropped support. (Still awesome for emulation because of the physical buttons)

I was really interested in windows phone for a while that I almost bit the bullet and bought it.(you obviously know what happened to the beloved windows phone platform)

And now suddenly a blackberry passport video pops up on my YouTube recommended feed and now I really want one.
The problem is the lack of apps, I was hopeful because it supported android runtime.
Then my hopes were crushed after I knew that its based off KitKat.
Which means one of my favorite apps doesn't work there (my beloved termux, I get a boner whenever I think about using it with an actual keyboard 😂)

Should i just bite the bullet? I'm too broke and that 200$ is kinda of a major purchase for me (I'm 17 in a third world country, so the piggy bank is empty AF)

God, why do I always get introduced to platforms too late...

My manager had someone else manage me for my whole time at the company so far. Nearly two years now. Anything I’d come to him with, he’d direct me to this other person.

Fair enough, dude’s really good and I learn a lot from him. I see why they trust him with so much. I think he’s a genius. I’ll never be that good. Embarrassed I’m only a few years his junior. Wonder why he’s okay with being a manager for employee pay. Don’t think about it much, normal corporate BS.

Well it got way more “normal” when his ass got laid off without notice. Feel terrible. Him and 70% of my branch’s full timers. Wonder how I got so lucky. Everyone’s gone. We barely have enough people to do a standup. They all had 5+ years on their belts minimum. Only the contractors are left.

Manager emergency meets with me. Tells me all his best staff are gone and I am now the only front end guy on the team. He tells me he is not confident in the fact I am responsible for all of the old guys work and he is worried. He thinks I can’t do it cause he thinks I suck. Fuck me man.

My manager is pissing himself realizing he has lost the only people keeping HIS job for him. He has no clue my skill level. He sees my PR’s take a bit longer to merge, yet doesn’t realize I asked that friend of mine who was managing me to critique my code a bit harder, mentorship if you will, so we’d often chat about how to make the code better or different ways of approaching problems from his brain, which I appreciated. He has seen non-blocking errors come through in our build pipelines, like a quota being reached for our kube cluster (some server BS idfk, all I know is I message this Chinese man on slack when I get this error and he refreshes the pods for me) which means we can only run a build 8x in one day before we are capped. Of all people, he should be aware of this error message and what is involved with fixing it but he sees it and nope, he reaches out to me (after the other guy had logged out already, of course) stating my merged code changes broke the build and reverts it before EOD. Next day, build works fine. He has the other guy review my PR and approve, goes on assuming he helped me fix my broken code.

Additionally, he’s been off the editor for so long this fool wouldn’t even pass an intro to JavaScript course if he tried. He doesn’t know what I’m doing because HE just doesn’t know what I’m doing. Fuck me twice man.

I feel awful.

The dude who got fired has been called in for pointless meetings TO REVIEW MY CODE still. Like a few a week since he was laid off. When I ask my manager to approve my proposals, or check to verify the sanity of something (lots of new stuff, considering I’m the new manager *coughs*) he tells me he will check with him and get back to me (doesn’t) or he tells me to literally email him myself, but not to make any changes until he signs off on them.

It’s crazy cause he still gets on me about the speed of stuff. Bro we got NOTHING coming from top down because we just fired the whole damn corp and you have me emailing an ex-employee to verify PATCH LEVEL CHANGES TO OUR FUCKING CODE.

GET ME OUT

This is an actual transcript...
Since it's way too long for the normal 5000 characters, hence splitting it up...

Infra Guy: mr Dev, could you please give some rational for update of jjb?
Dev: sparse checkout support is missing
Infra Guy: is this support mandatory to achive whatever you trying to do?
Dev: yes
Infra Guy: u trying to get set of specific folder for set of specific components?
Dev: yes
Infra Guy: bash script with cp or mv will not work for you?
Dev: no
Infra Guy: ?
Dev: when you have already present functionality why reinvent the wheel
Dev: jenkins has support for it
Dev: the jjb is the bottle neck
Infra Guy: getting this functionality onto our infra would have some implications
Dev: why should I write bash script if jenkins allows me to do that
Dev: what implications ??
Infra Guy: will you commit to solve all the issues caused by new jjb?
Dev: you show me the implications first
Infra Guy: like a year ago i have tried to get new jjb <commit_url>
Infra Guy: no, the implications is a grey area
Infra Guy: i cant show all of them and they may hit like in week or eve month
Dev: then why was it not tackled
Dev: and why was it kept like that
Infra Guy: few jobs got broken on something
Dev: it will crop up some time later
Dev: if jobs get broken because of syntax
Dev: then jobs can be fixed
Dev: is it not ???
Infra Guy: ofc
Infra Guy: its just a question who will fix them
Dev: follow the syntax and follow the guidelines
Dev: put up a test server and try and lets see
Dev: you have a dev server
Dev: why not try on that one and see what all jobs fails
Dev: and why they fail
Dev: rather than saying it will fail and who will fix
Dev: let them fail and then lets find why
Dev: I manually define a job
Dev: I get it done
Infra Guy: i dont think we have test server which have the same workload and same attention as our prod
Dev: unless you test how would you know ??
Dev: and just saying that it broke one with a version hence I wont do it
Infra Guy: and im not sure if thats fair for us to deal with implication of upgrading of the major components just cause bash script is not good enough for u
Dev: its pretty bad
Infra Guy: i do agree
Infra TL Guy: Dev, what Infra Guy is saying is that its not possible to upgrade without downtime
Infra Guy: no
Dev: how long a downtime are we looking at ??
Infra Guy: im saying that after this upgrade we will have deal with consequences for long time
Infra Guy-2: No this is not testing the upgrade is the huge effort as we dont have dev resources to handle each job to run
Dev: if your jjb compiles all the yaml without error
Dev: I am not sure what consequences are we talking of
Infra Guy: so you think there will be no consequences, right?
Dev: unless you take the plunge will you know ??
Dev: you have a dev server running at port 9000
Infra Guy: this servers runs nothing
Dev: that is good
Dev: there you can take the risk
Infra Guy: and the fack we have managed to put something onto api doesnt mean it works
Dev: what API ?
Infra Guy: jenkins api
Infra Guy: hmmm
Dev: what have you put on Jenkins API ??
Infra Guy: (
Dev: jjb is a CLI
Infra Guy: ((
Dev: is what I understand
Dev: not a Jenkins API
Infra Guy: (((
Dev: (((((
Infra Guy: jjb build xmls and push them onto api
Infra Guy: and its doent matter
Dev: so you mean to say upgrading a CLI is goig to upgrade your core jenkisn API
Dev: give me a break
Infra Guy: the matter is that even if have managed to build something and put it onto api
Infra Guy: doesnt mean it will work
Dev: the API consumes the xml file and creates a job
Infra Guy: right
Dev: if it confirms to the options which it understands
Dev: then everything will work
Dev: I am actually not getting your point Infra Guy
Infra Guy: i do agree mr Dev
Dev: we are beating around the bush
Infra Guy: just want to be sure that if this upgrade will break something
Infra Guy: we will have a person who will fix it
Dev: that is what CICD is supposed to let me know with valid reasons
Dev: why can't that upgrade be done
Infra Guy: it can be done
Infra Guy: i even have commit in place

Ah, I have so many memories.

I was lab instructor at the local institute(it was more like tuition) where I had to train students for programming (C, C++, Core Java).
And my debugging skills got enhanced too, It was like I had to just look at the program and I could tell all the errors, it happens to everybody I think because our brain just find patterns un-consciously and it later becomes like one superpower.

No doubt there were a lot of bright students even brighter than me. Actually, that was my starting point where I broke out of my shell and started playing with coding a lot.

Think I will go for a quick fix and test it on my machine. Just reprovision the vagrant box I have created at work a month ago.

vagrant destroy
Y
git pull && vagrant up
...
Some random error

Thanks to the guy who broke the vagrant box ~.~

Update:
I've been trying to leave DoD for a couple of months now. Translating my 10 year's experience with complex Intelligence enterprise level systems to something relatable to the civilian IT world. Grabbed a few certs to help out A+, network+ and security+ with Linux+ as my next target. Photos of me working on unclassified systems, radios, cell towers and servers. I'm a teacher for military UAS so this shouldn't be to hard to get even a basic job in IT right.

No one will hire...
Linux admin: Nope
Network admin: Nope
Assistant Network admin: Nope
IT call service: Nope
Pool cleaner fucking nope
Many interviews and nothing
I'm broke and sold all of my personal valuables. I can't hold out much longer and really looking at becoming homeless. But I'm kinda ok with it, one last payment on my apartment and car is all I can do now. My parents think I'm in Afghanistan working a six figure job lol

DoD: we see you're trying to leave we'll pay you alot to teach A+, Network+ and Security+ traveling all across the country and staying at hotels with all expenses paid.

FU FU FU I want out please tell me someone has a job, I'll be a janitor of a server room Idc I just want out. Fuck the pay

I start Tuesday...

This is not a rant, but I've searched this for some time now and can't seem to find it so maybe any of you will be able to help me.

A good few years ago, when I was still a 4-5yo I had a Win95/98 (I don't remember which). We used to have this CD that had a bunch of games, like Chucky Egg or Mahjong, or a xmas-related one (where you could bake cookies, serve drinks - there was a red and a yellow one - and more I don't remember), one with a (purple?) dragon (in a dungeon, that was played in levels, but every run was randomly generated, I think), and many more.
The CD was white with black text, and had a yellow-ish/orange-ish grinning face, that looked like a man's, with a few hairs, that was drawn simply, nothing too complex. I also know there was this one game that made the computer/game freeze, and that was in a blue palette?

I played the crap out of that CD with my mom, and she used to play the dragon one for me (until she found out Mahjong), but it all ended when it broke inside the tower and we had it replaced by the WinXP tower we currently have at home (and that's in pieces because me and my brother disassembled it).

I know it's not much, but does any of you remember anything like what I just wrote? It should be from around the 2000s and probably from a gaming magazine.

next week im buying my first ever car. its gonna be a benz. im literally taking a cash credit loan from a bank B, just for deposit of the car, and then taking another loan from bank A, to be able to buy the car on leasing for the next 3 years.

basically I'll be giving away my whole entire salary of 2024 that i worked as devops engineer, plus cash credit, plus leasing credit, just for a fucking deposit of the car, and the car costs only 35,000 fucking euros €!

thats not a big fucking deal. ppl drive 90,000€ cars every fucking day. or 50,000€ cars as an average. i am buying a below average car, or for me The Bare Minimum Car... and i still struggle like hell to do it.

im willing to go broke buying this car bc a car would never cheat on me. it would never lie to me. a beautiful car standing outside of my house always there to remind me why this meaningless fucking existence called life, is still worth living.

a car for me is beyond just a car or art. it gives me meaning to continue living. life by default for me is valueless. a beautiful car and mine, finally generates value of life. every time i get depressed (which is every day) i take a nice night ride in my new benz

its a 2020 car. and im satisfied with it. i also got offers to buy the brand new 2024 one. but that shit is almost twice as much in costs. dont have money for that shit. I'd need to work my shit job for at least 3 more months and save every penny JUST FOR DEPOSIT.

out of my budget.

im buying a CLA class. i wanted C class but that shit mad expensive! i think A class is too cheap for me so the only class i can afford and not look cheap is CLA. C class is the next tier. I'd need 2 more salaries for C class but only 1 more salary for CLA, hence next week (first week of september)

hopefully, this new car will get me new whores. i really do hope that whores will fuck w a nice car and want to finally go out with me. i dont care if they're using me for money (which im not even gonna have). i care about using these whores as a form of revenge for my ex whore blonde cheating on me for the past 2+ years

so aside from clearing my mind of bullshit by driving a nice car at night which i fully bought myself no handouts, driving whores in it would just be cherry on top of the cake. a bonus.

lets see how it goes.

I've spent the whole day writing editing a proposal a partner sent as docx. I've tested out writing revisions and saved the file to be sure, and I could re-open it just fine. After some hours, I've sent the file to the partner and he said he couldn't open it. Looks like Libreoffice broke the document.xml file beyond repair when I edited my last comments. Will need to work until midnight because this piece of shit software is incapable of handling the basic document structure it is written for. IF YOU SUPPORT DOCX FILES HOW ABOUT YOUR RELEASE VERSIONS DONT LEAVE BROKEN CORRUPTED MESSES YOU PIECE OF SHIT. HOW MANY HOURS DO YOU THINK HAVE YOU COLLECTIVELY WASTED??

I love linux because i dont have to forced to do frickin update like windows did.
Because i have an experience after update linux mint i cant even start the main GUI program. After boot only show blank console. It seem linux update broke the compatibility between my graphics card.
At least now i dont have to update because thats an option. The output of update is not different than windows.there is a chance you broke your OS.
But the struggle is when i need to install new app in linux. Sometimes need more than hour to find out why it doesnt work from the first time.
Any help here?
So this start from the office. In the office i usually use low spec laptop that work slowly. Then i found this IDE called rapidclipse. Its very promising with GUI builder and can build cross platform mobile app using only java built on top vaadin framework.
When i use it on low spec laptop hackintosh at office it work well although it take more time than other kind of eclipse and i dont need to install any kind of app again, just download-install-create new project-run on tomcat-work well.
Then i go to home to try this new tool , IMO my low spec PC still have more power to run something than old hackintosh. Because usually i use android studio with no problem. In the old hackintosh it went too long to build gradle only.
Then i install rapidclipse, then run desktop shortcut. Then it said i need to install correct java to use correct JavaFX.
After search on SO they said i must install jdk from oracle.
Ok so i got openjdk in my linux.wtf what is the different idk but dont have time to find out.
I install jdk from oracle.
Than finally can open the rapidclipse.
Wow , this gonna be fun.
Then create new project. Just a new project.
So im waiting. I see the progress at 10%. But still no increment on that.
I switch to other app for several minutes.
Then when switched back th app still at 10% and now is at no responding state. So i force close.
After that open rapidclipse again.
The previous new project can be opened. Yay, i think.
But so many error there. Omg.
So i create new project again.
But, but, i just repeated the first error then close again then try it again for several time. But still same output.
After an hour, i give up.
But still, why , just why it work like this. No error or whatsoever.
Back later i have a problem like this on different app.
Idkwhy.

Random learnings/realisations/hypothesis:

i have found a sense of happiness in weird symbiotic environment : being rich in a poor environment and live with a poor-but-secretely-rich lifestyle.

i call it the "sheep-hoodie" lifestyle: being a wolf in a herd of sheeps but not with a sheep's skin glued to your body. rather a hoodie so you can be a friendly wolf , ferocious wolf and a friendly sheep whenever you want to.

my 1 group of friends are in a sheep phase : struggling in their life , crunched on money, not saving a lot or focused on savings and stuff. At least that's what shows up from their discussions. however when we are together, i see that we are always supporting each other, and sharing resources/helping each other while having fun

my another group of friends have a wolf lifestyle:
they are insanely rich, if you want to party/do something with them at 'their' level, you gotta have a lot of cash to burn . they are wolves because they know how to sell their stuff, whom to sell and how to retain the info for success. i don't enjoy much with them as their solutions to life problems end up with something that involves a lot of money than effort.

So my lifestyle is to earn like them, but live like my broke friends. they think that am earning 20% of what i earn now, and am also in lots of debts and family crisis. someday my lie is gonna burst when i buy expensive stuff lol

--------
#2
i have realised that i have an OCD for silence and psychotic reaction to noise . for me ,
Silent Environment >> sex >> any relationship.
I might react so aggressively to noise while trying to focus that i may end up breaking the closest of relations with anyone

--------------
#3
thinking of having 3 twitter accounts just to fix the problem of devrant not saving content of dormant accounts :
- professional : an id where i will share my professionally stupid questions, achievements, debates etc
- personal/partial-anon : an id where i will share my personal thoughts and stuff. it might also include devrant screenshots / embarrising content that i make here
- true-anon : a full anonymous account for my(some) extreme thoughts, trigger content and explicit researches

my current twitter feed is a mix of first 2, but making 2 seperate accounts might give me more freedom(the level of devrant) to express myself than what i do now (as my followers are also interesting people but mostly related to tech)
guess i should move my tech content there than my personal content.

------------------------------
#4
making an early opinion about something should only be done to research for truth/content/conversion/hype . final opinion should always be made after you trust something with a research. for eg, initial opinion of Elon Musk was he being a bad guy, but now after seeing his crazy ideas and approach towards twitter, he looks like someone who can truly make it a money minting machine.

------------------------------
#5
A simple perception towards making money as not being a bad thing does wonders at a management level and life .
liberal opinion of twitter layoff and later changes were emotional and blaming, but thinking from a business approach, his company partners(and whoever he likes) now have special golden badges to feel like VVIP and have an orgasm, while he gave a dummy melon to every person on earth to pay for feeling like a VIP and have an orgasm.
a brilliant tactic to make money without anyone calling the minting of money as BAD. genius

------------------------------
#6
was randomly checkin Insta, saw an ex-collegue share a random deep thought quote, and i realised that i might have known her for just a week or 2 in college, but she had a very nice nature.

However, she was the daughter of a very rich ass dad and had almost everything in life. she gave a bit spoilt(for me) look, like someone who did ciggs or drink, but her talks then and our chats later just on chat gave me a very nice hustler vibe (the type of people i like: hustling and professional)

I indirectly asked her on a date and she agreed. so, this is something very interesting for me, as i am hopelessly single and full of judgemental opinions/ strict rules. share your tips and notes on how to have a successful date, and stuff that one must NOT do . much grateful if you do not come under rule 29 of internet and share your POV

Rest In Peace my Hermes E2 mechanical keyboard. I have been using it for about 4 year and today the shift key on the left side of the keyboard broke.

I think the shift key is physically broken since I already try to clean the keyboard but it isn't working anymore.

The keyboard should still be workable for normal user but programming with that keyboard is a hell.

You only notice how much left shift key is important for programming when you try to program with alternative (right shift key)

Playing NFS (it was the version which had the McClaren car), few other games and watching some movies (CD player) It wasn't my computer though. It was my cousin's and I used it while he was working. I think I broke it couple of times (windows 95) to get the BSOD.

I bought my own computer only when I started working. My family couldn't afford one before that. Luckily I had good friends in college who let me use theirs for course work.

I think I broke our intern.

All I did was set up an alias command to copy a war file. It of course has all the error handling and crap