Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "why is it so hard"
-
I don't understand why every non-technical person who comes to do work in my apartment messes up my fucking router.
The cleaning lady - multiple times knocked the antennas partially off. Like fucking clock work. I don't get it, why is the cleaning lady attracted to my router antennas and why does she need to be so hard on them? Whatever.
The most ridiculous episode was today. And it wasn't the cleaning lady. I had a few people here doing some work today and the woman in charge who was here informed me before that they might have to move the furniture "a little."
I come home, and like a bad omen, the plastic parts on BOTH my router antennas are missing. Completely gone. It's just the the wires. Now, the router still works fine in my tiny apartment, but it is a fancy Asus router (I learned the hard way not to buy cheap routers) and I'd like it to not have fucking wires as antennas.
I email the woman (paraphrased):
Me: hey, it seems the antennas got knocked off my router, do you have any idea where they might have went?
Her: Apologies if we didn't put everything back (no shit you didn't, that's why I've had to email you). If we knocked the antennas off the router (fucking "if"???? I literally just told you in my email that they were knocked off) , they are probably somewhere by the window on the floor (they weren't).
And I still haven't found them. Why the fuck do these people seemingly attack my router? I can't figure out what it is about it. You would think people would be more careful around electronics but naaah. Anyway, going to go keep looking for my router antennas.43 -
So, since I hear from a lot of people (on here and irl) that Linux has a 'very high learning curve', let me share my experiences with the first time my dad touched Linux (Elementary OS) without me interfering at all! (keep in mind that he is very a-technical)
*le me boots the system* (I already did setup a user account for him and gave him the password).
Dad: *enters password and presses enter*
Me: "Hmm that went faster than expected."
Dad: "Uhm I know how to login son, it's not that hard and pretty obvious".
Me: "Alright, why don't you try to open up the default word documents editor on here! I'll be right back!"
Me: *Goes away and returns after a minute*.
Dad: *already a few test sentences typed in LibreOffice writer* it's going pretty well :)!
Me: "Oo how did you find that?!"
Dad: "Well, there's a thingy that says 'applications' so I clicked in and found it in the "Office" section, do you think I am blind or something?!"
Me: 😐. uhm no but I just didn't think you'd find it that quickly. Now try to install Chromium browser! *thinking: he'll fail this one for sure* I'll be right back :).
Me: *returns again after a minute or so*
Dad: *already searching for stuff through Chromium*
Me: "wait, how the hell did you do that so quickly, it's not the easiest thingy for most people".
Dad: "Jesus, it's not that hard! I went to the application browsing thingy, typed 'software' and then a sorta software store icon showed up so I clicked it and it opened a windows with a search bar saying something like 'search for applications/software'. clicked in it, typed 'chromium', saw it coming up, there was a very clear 'install' button, it asked for my password, I put it in and after a little it gave a notification that it was installed. Then I went to that application browsing thingy again and typed Chromium. Then I hit enter because it selected an icon called chromium...."
Me: O.o. Okay this is going very good, now open an email client and login to your email address!
Dad: *goes to application browsing thingy, types 'email', evolution icon shows up, dad clicks it, email address setup steps show up and dad follows them quickly. After about a minute, everything is setup.
I expected this to be a hard process for someone who dealt with Windows his entire life but damn, I underestimated it.
Asked him if he found it easy/what he liked about it:
"Well, it's very clear where I can find everything, default browser/email/word document editor programs are easy to find and that's about all I need so yeah, great system!"
I am proud of you, dad!77 -
So my actual job is being a nurse at the local hospital, with coding being just a hobby. However, the way some IT–Related things are treated here are just mind-blowing. Here are some examples:
Issue: Printer is not recognized by network anymore due to not being properly plugged in
Solution: Someone has to tell the house technician, if the house technician is currently not available, ask his assistant who only works part time and like twice a week. House technician took the printer (God knows why), came back 2 days later and plugged it back in.
Issue: Printer 1 of 2 on ICU has run out of ink and since all computers default to printer 1, nobody can print.
Solution: Call the house technician, blah blah, house technician comes, takes ink cartridge of printer 2 and puts it into printer 1.
Issue: Public WiFi is broken, can be connected to but internet access is missing. Probably config issue as a result of a recent blackout.
Solution: Buy a new router, spend 5 days configuring it and complain about how hard networking is.
Issue: Computer is broken, needs to be exchanged with a new one, but how do we transfer the data?
Solution: Instead of just keeping the old hard drive, make a 182GB backup, upload it to the main file server and then download it again on the new computer.
Issue: Nurse returns from vacation, forgot the password to her network account.
Solution: Call the technician who then proceeds to open a new account, copies all the files from the old one and tells her to pick an easier password this time. She chooses "121213".12 -
Not a specifically dev related story, but absolutely rant worthy.
Today I was working from home, and my wife called me to tell me that some awful person had thrown a young cat into the dumpster at her work.
To that person - you are a scumbag. You’re lucky no one left you alone in a hot car as a kid, let alone a dumpster. Seriously, why? Why is it so hard to take it to a shelter?
Anyway - I went and bought a whole bunch of cat stuff - I grew up with cats but I’ve never had one on my own. We’re at the vet now. I think we’ll name her Curry (after Haskell Curry, and lovely spicy dishes).22 -
WHY THE FUCK IS IT SO FUCKING HARD FOR THESE CUM SUCKERS TO UNDERSTAND THAT CHANGING REQUIREMENTS 2 DAYS BEFORE THE DEADLINE IS JUST GONNA BREAK EVERYTHING!?!?
I DOUBLE DARE ANYONE TO TELL ME ITS NOT WORKING TOMORROW...
STUPID MOTHER FUCKER PMS CANT PLAN ANYTHING6 -
This is just my token of appreciation for the Skype devs. Can't begin to say how much I hate it. Your android app is a joke even after a host of updates, your desktop client is an even bigger joke (atleast Linux Beta version, I know betas aren't supposed to be stable but this is ridiculous).
You have reinvented chat clients to be extremely bulky, cumbersome and very hard to sync across devices. And you have managed to make it "buffer" more than a YouTube video does on a 2G network. I for one, am blown over by how you did that. And to top it all, you can't close the client on Linux atleast! All you did is just override the close button so that it only minimises it. Brilliant piece of work right there!
Why the hell can't you just close the client and run it in the background the proper way like everyone else does? Why does it have to take 20 *** seconds to open a message? The only reason I am stuck with this is some wierdos in the office still only use this. Get your shit together 😡
Ahh.. I feel much better now.18 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
I hope you will forgive me for a third hand story, but I'm one of those evil developers, not a support per se. But I thought you'd enjoy this story anyway. So this happened to a colleague of a colleague:
$Hero - our hero. $Cop - A representative of our hard worked law enforcement agency.
So $Hero is happily speeding along in his car, running a few yellow lights a bit late, etc. Finally, the law catches up to him and pulls him over. Here's how the conversation went:
$Cop: Can I see your driving license, please?
$Hero (with smug grin): Certainly. Here it is, officer.
$Cop takes license back to motorcycle and speaks into radio.
$Hero: It's not going to help you any, though.
$Cop (with no reaction): What do you mean?
$Hero (with wider grin): The server you have to check it against is down.
$Cop (still no reaction): And why do you say that?
$Hero: Because I'm the guy they called to get on site and get it up again.
Our hero did not get a fine this time. Instead he got a police escort to his workplace.
Source: reddit r/talesfromtechsupport3 -
Uncle- What do you do?
Me- I'm a software engineer
Uncle- My brother's friend's son is also a software engineer.
Me- (so what am I supposed to do about it?) yes that's nice
Uncle- I have a great idea, u should implement, I'm just telling you, it is a revolutionary idea
Me- (oh fuck, not again) yes tell
Uncle- you should make a matrimonial site which tracks what people do on internet and tell their to-be-spouses about it
Me - (yeah, I'll get sued for breach of privacy, and it has got nothing to do with my current line of work, and will probably cause divorces before marriage) yes great idea uncle
Uncle- see I told you this billion dollar idea, u should do hard work and make it
Just WHY in god's name do all uncles think laptop is a magic box in which I just have to type their idea in and it will spit out a website/software in 2 minutes. I don't go around advising them about their line of work.11 -
PM: Please get this done by tomorrow. It's just a small change.
Dev: No its not that simple.
PM: Why is it not simple? Please explain so I can understand.
Dev after a hard thought finally explains: blah blah blah
PM: Well, we have promised the client so please do this by tomorrow, thanks.
Dev: *bangwall9 -
After weeks of hard work creating a website:
It looks so beautiful 😭
*opens in a different browser*
WHAT THE HECK! why is all my divs flying here and there !
*opens in mobile*
f*#k this9 -
All web developers should support up to IE9 without any problems.
Why? Because in Korea, it is normal.
Every person uses that damn Win7, which has either IE9 or IE10. Without IE support, no one will browse your webpage.
Now you would ask us, why don't you use other modern browsers?
We would then ask you, why would you install a new browser that is
1. Buggy
2. Heavy
3. Takes up ram
4. Has so many features
when you have an awesome minimalistic browser that is preinstalled, and works in all Windows? No thanks.
So, if you put a message saying you will soon drop support of IE, it means that you won't target Korea. Just after the support drop, there won't be traffic to your web site.
So what is the point of this rant?
1. We love IE. Lol
2. IE is lightweight, minimalistic, and the fastest browser in the world.
3. All websites should NOT drop support for IE.
4. We don't care whether web devs will have a hard time. We just think websites are built with Wix and Wordpress, and they work in IE, meaning, IE support is the number one priority.
5. If you ever start a business in Korea, and has a website, make sure to hire an senior Korean web dev who has worked with IE for a long time.
6. Here is the tl;dr
Hate us. Period.24 -
why is it so hard to convince people to start using slack chat and giving up sending internal emails?10
-
HoD in my college is a "22 year experienced C programmer" with a PhD in CS.
One day I went to him and told, it is very hard to work with TurboC, and it isn't needed as we can easily migrate to GCC.
He asked me why was I complaining. No other student has any problem. They have been using it ever since the college started and everyone was "comfortable" with it.
I stood silent. He then went on to say, even JVM was coded in TurboC. I nodded and left the office as i didn't have an argument.
He's the same guy who had earlier said, "printf returns an array of characters printed", so I guess everything works here.11 -
Yet another rant about crappy electronic designs.
Just now I was cleaning my desk and stumbled upon some old hard drive in a caddy that I still had laying around.. I figured, let's plug it in and see whether the drive still works. And to some extent, it does! Except that every few minutes it craps out on me. And after disassembling the caddy, I think that I know why.
Just as background information, hard drives work at 12V and generally require about 10W to spin their motor. Meanwhile USB operates at 5V. So a boost converter needs to be present in the controller to step up the voltage and power the drive.
Now what's a boost converter? It's an inductor, a capacitor, a transistor and a diode in a specific arrangement (if you're interested in the design, check out https://youtube.com/watch/...), along with feedback circuitry to stabilize output voltage. Now that transistor is important.. it switches at very high frequency, and its rise and fall times create heat. In the particular transistor used in that controller, it apparently causes the transistor to operate at 65-68°C. That's quite toasty IMO, and overheating may be why the controller is so unstable. But the Chinese manufacturers thought that it's just fine and okay to be sold without heatsink or some research into transistors with better rise and fall times.
So the hard drive craps out on me and yet again it's because of certified shitdesigns. MOTHERFUCKTURERS!!!!27 -
I hate this fucking front-end stuff so hard..
How DA FUCK is it possible that I set up the whole backend including DB connection, base controllers, models, base validation and stuff in an hour but don't get this fucking fucking retarded JS framework piece of shit to display a test string after ONE FUCKING HOUR!!!
Why do we need this shit anyway? Why does everything have to be shiny with some fucking animations???
It's about the information, isn't it? Then WHY DOES IT HAVE TO LOOK PRETTY???
I gonna travel back in fucking time to the early 80's!
Stupid front-end shit..23 -
- If I buy x amount of ram | hard drive space | cpu power I will never need more.
- No need for version control | Tests. This is a small project
- git commit -m "changes" (its a small change. I will remember why I did it)
- It is too obvious that I put a lot of personal time in this so my boss will definitely notice!
- Why comment this simple method? Anyone should know what it does. Especially me!
- "this should never happen"
- This call can't be from work. Everyone knows I am on vacation.
- I will back up next week. It's not like it is going to crush today.
- It’s 11:30 already? I will work on this for only a half hour more and then I will definitely go to bed!
- This project will take x amount of time!2 -
Working on a project where the coordinator is insisting on using OneDrive. Lost the link he sent out in an email so decided to:
- Google "OneDrive": Eventually brought me to "office.live.com/...." with a view of my settings and apps ... no OneDrive.
- Spent a while using a bit of logic to click around and find it, forgot logic doesn't work well with MS products and ended up on Outlook instead.
- Spent a while searching for the original email with the link, found it, brings me to "...sharepoint.com/....".
- Inside sharepoint (OneDrive?) the banner says "Office 365".
- But the browser tab says OneDrive.
Are Microsoft just afraid of consistency at this point? I mean seriously, pick a name and use it everywhere. Why is that so hard? why is that so complicated?6 -
Really, I hate this composer / bower / npm shitholes!
Why the hell is my app 300MBs?!? Because that shitty pudding composer decided to download the ENTIRE git including README.md, examples, 5 hours of assembly-giraffe porn, my granny's pajamas and two wraps of kebabs!
How hard is it to define the folder that contains the REQUIRED library so that our project might stay at 5MBs instead of 300?18 -
It's only day one of the year and I'm already pissed right off
Why the fuck do all clients expect you to come up with absolutely everything!?
All I ever get is we want a website. I ask well what do you want on it.. our products .. news? Contact maybe ... Urm our business information ... That kind of stuff.
Well what are they?
Pft.. I here is a name if our products. And other stuff
WE ARE SELLING IT WAT ARE THE PRICES AND INFORMATION DO YOU HAVE IMAGES
Yeah do you want them
Of course I do 😐
Great here's 2 of them we have 1100 so I'll get more to you soon.
😤 Thank you!
Holy shit it's always like talking to a fucking brick wall.. why do people have to make our jobs so hard it's already fucking tough
I have no time to plan your entire website by myself I don't know what you want on it. How could I possibly know that!? It's your fucking site10 -
So I've decided if I am invited to a school career day the what I'll do is this.
1. Start by handing out one of those logic puzzles that are like Sally lives 2 houses down from Bill, Bill is 3 houses away from Maggie where does Jerry live type of thing. Then I'll tell the kids they have 10 minutes to figure it out.
2. After about three minutes I'll tell them that they also need to figure out where Jerry lives and not give them enough information to figure that out.
3. 5 minutes in I'll start asking them why it is taking so long, and it shouldn't be that hard. I'll also ask about where Phil lives who was never mentioned before.
4. At 7 minutes I'll look for anyone who might be figuring it out and tell them there is a much more important high priority problem I need them to solve and give them a new puzzle and tell them I expect them both to be done on time.
5. At nine minutes I'll start yelling at them that they must not be that good and why they haven't finished yet if any of them complain I'll tell them they are just dumb.
6. At ten minutes I'll ask them to turn it in and then immediately throw it in the trash and tell them that wasn't what they were supposed to be doing, and tell them they did it wrong.
I figure that is a pretty good representation of what working in software engineering is like.3 -
Why do users find it so hard to understand short and clear error messages that are in place to inform them what's going wrong? Why do they instead waste my time when the message clearly says that the password is too short and hasn't got any special characters? FFS!4
-
I see many people being irritated when it comes to StackOverflow and If I were to be honest I thought the same a while ago. But I noticed that I was misjudging the main point of Stackoverflow. It's not a forum to help people with their programming problems. It's a huge self writing document to gather every programming related questions and answers under a single platform if possible. That's why they won't down vote you even if you ask a question that was obvious in a language's official document as long as it wasn't in Stackoverflow. That's why questions should also be formatted accordingly which is clear and also informative in itself. I understand why stackoverflow is such a harsh place to ask questions and most of the time I prefer looking things for my self instead of asking a question. And I edit and review most questions on stackoverflow because I enjoy it. That also made me realize that stackoverflow needs to be elitist to preserve it's current quality. Who would want to see unclear duplicate questions that veteran stackoverflow users need to answer over and over again right ?
Asking the right question is hard because we humans most of the time don't know what we don't know. And it makes it really tiring to format your question the way that is fitting for a document. In those times I prefer to ask my questions on a more relaxed and chat focused platform before writing my main question on stackoverflow.
So that was my opinion on stackoverflow and it's harsh environment. It's definetly a hard to get into community which I can't even say I'm really a part of it. But looking at stackoverflow as a document that's being written by ut's users, it's easier to understand it's elitist approach. I hope you had some enjoyment from reading it.6 -
I couldn't sleep. I was staring at the blinking cursor. A slow, comforting blinking. Like everyone else, I had become a slave to the JavaScript ecosystem. If I saw something like a new build system, or a new framework, I had to have it.
My client changed the requirements again. I'm in pain.
- "You want to see pain?" my colleague said. Go read Apple support forums. That's pain.
I became addicted. Every time I died and every time I was born again. Resurrected.
During the night, I was crying in the Apple forums for an official answer that would never come. During the day, I was surfing StackOverflow to fix my problems. You get "single-serving" friends there. They help you, you help them, and then you never see them again.
- "Then you install Stack and boom, you're done. It's that easy to go functional."
That's how I met him.
- "You know why they make so many javascript frameworks?"
- "No, why?"
- "So that they can distract you while they put backdoors in them. So that you don't have time to check all of their code".
- "You are by far the most interesting "single-serving" friend I've ever met"
Then, my hard disk died. Of course, I didn't have backups: nobody has enough space for all those node_modules folders. All my addictions, lost.
Then I wrote him. If you asked me now, I couldn't tell you why I wrote him. We chatted a lot.
- "It's late, I should really go search another hdd on ebay"
- "Ebay? You called me so you could have my old hard disk."
- "No, I..."
- "Come on."
He sent me his old hard disk. It was a 256MB hard disk, but it was fine for running Arch. Then he asked me to rant about my problems in front of him.
- "I want you to rant as hard as you can"
- "Are you serious?"
We ranted all night about our bosses and clients and their fucked up requests. We kept in touch, and after a while more people were ranting with us. Every week, he gave the rules that he and I decided.
- "The first rule of devRant is -- you don't talk about devRant. The second rule of devRant is -- you don't talk about devRant."
I like to think this is how devRant started. This might also be the reason why we never see @trogus, only @dfox. A lot of shit still needs to happen.8 -
It was not me doing the screaming but one of my colleagues. He is a super programmer and joined our team early this year as my partner on frontend development.
We're a React/React Native dev house and he has always been uncomfortable with how loose it goes here because of dynamic typing. He has been advocating typescript and Angular since he started and I even allowed him to use typescript on one of the projects.
A month back I started to make jokes about how dead angular was (trigger alert) and he almost lost it. We are good friends so he as been taking it in good spirits.
Last week our boss allowed him a chance to propose a Tech stack for a new project. Naturally he started comparing Angular vs React. I chime in to trigger him again with "why would we work with a bloated zombie framework", he picked up his chair and almost threw it at me while screaming " React is just hacky ". I was laughing so hard and in the end we both did some research. We are proposing Jquery to our boss... (Evil laugh)1 -
Apple iPhone testing without being on the app store is so annoying, I had to sign up some people to test the app I've been working on and had issues on my end, it really is this whole security bullshit, really it isn't needed.
I couldn't get the team provisional certificate thing to show up because when I clicked the account the team certificate settings would disappear, only after right clicking and hitting help then clicking the team while it was selected could I go to the right window.
I don't see why it's so damn hard to do this crap.
Yet with Android, it's so easy.
I really have issues with the testing for this iPhone app, I went through so many different ways to try and get it to work.
Anyways all done, crashlytics is an awesome testing tool if you can get around that small issue I had.4 -
Why the fucking fuck is it so damn hard for me to draw a fucking curly bracket?!
All my sad attempts at it look like a 3 that was exposed to lethal amounts of nuclear radiation3 -
every day I get phone calls from some idiot to moan about something I fixed.
I had a job to copy a site and use it for another company, with everyone's consent. I do it and found the original was garbage. hard coded functionalities. limited control over which pages appear in the menu and so on.
problem is the site administrator doesn't understand the system and made pages visible on the menu that shouldn't be and so on. these never showed up before because it was broken.
now she phones every day because she setup her pages wrong originally and tells me stuff like, why did you change this, it worked before and crap.
I never expected she would have setup the pages incorrectly so I never thought this would happen.
lesson here is if it's broken and you're the only one that's noticed, just bloody leave it.1 -
My previous manager: "Your code should hard to read, so our work is cant stolen by everyone".
Me: "Why?"
My previous manager: "Just do it"
Me: "Okay"
So, anyone can answer my 'Why?' question?
P.S: My previous Manager is PHP Programmer14 -
Why is skids trying so hard when it comes to talking shit about Windows? Do they think that is it the only way to get accepted into the GNU/Linux community?
Personally, I think people who does that look stupid and dumb.7 -
SICK AND TIRED OF READABILITY VS. EFFICIENCY!!!!!!!
I HAD TO SEPARATE A 4 LOC JSON STRING, WHICH HAD AN ARRAY OF A SINGLE KEY-VALUE PAIRS (TOTAL OF 10 OBJECTS IN THE ARRAY).
ITS READABLE IF YOU KNOW JSON. HOW HARD IS TO READ JSON FORMAT IF YOU GET YOUR STYLE AND INDENTATION PROPERLY?!?
SO I HAD TO
BREAK THE POOR FREAKING JSON APART TO A FUCKING DIFFERENT YAML FILE FORMAT ONLY SO I CAN CALL IT FROM THERE TO THE MAIN CONTROLLER, ITERATE AND MANIPULATE ALL THE ID AND VALUES FROM YAML BACK TO MATCH THE EXPECTED JSON RESPONSE IN THE FRONT END.
THE WHOLE PROCESS TOOK ME ABOUT 15 MINUTES BUT STILL, THE FUCKING PRINCIPLE DRIVES ME INSANE.
WHY THE FUCK SHOULD I WASTE TIME AT AN ALREADY WORKING PIECE OF CODE, TO MAKE IT LESS EFFICIENT AND A SLIGHTLY BIT MORE READABLE?!? FML.5 -
I had a manager who scolded me in me in public on a non-IT floor because I used child classes and overloading of methods which "is too hard to read". Instead use "lots of ifs and else's". This is the guy that had a JSP so large (be cause he had so many ifs) that it couldn't be compiled even on a server.
The best karma happened a few months later. I was looking for a new job (wonder why?) and was very deep in the interview process - like round 5- of company A. I got talking to this jackass, who had no idea I was interviewing, said "yeah I applied to company A once. Couldn't get past the first round. Great benefits, though.". Me getting the job a week later was the best thing ever. -
DO !!!NOT!!!!! USE 'X' AND 'P' TO 'CUT AND PASTE' A LOT OF LINES ACROSS FILES IN VIM!!! HOLY SHIT I JUST PWNED MYSELF SO HARD I LOST SO MUCH CODE HOLY FUCK IT'S NOT EVEN FUNNY! WHERE DID AT ALL GO YOU ASK, WHY THE FUCKING REGISTER, OK LET'S CHECK THE REGISTER, COOL THERE IT IS, BUT WAIT, THERE'S ONLY LIKE 20% OF IT BECAUSE WE CUT A SHIT LOAD OF LINES AT ONCE, AND THE REGISTER OVERFILLED.... Ok let's calm down, doesn't Vim have a recovery option? Yes it does, but WAIT A FUCKING MINUTE, MY CHANGES ARE NOT IN THE SWAP FILE BECAUSE IT'S NOT LIKE VIM CRASHED OR ANYTHING, MY DUMB-FUCK-ASS WILLFULLY WROTE THE CHANGES WHEN I SWITCHED OVER TO THE NEW FILE, AND NOW, WELL THAT'S IT, YOU'RE DEAD KIDDO, YOU WROTE THE CHANGES TO DISK, NOTHING YOU CAN DO, AND I AM SO SCREWED I SPECIFICALLY MADE A DEVRANT ACCOUNT TO MAKE SURE NO ONE ELSE PWNS HIMSELF AS HARD AS I JUST DID HOLY FUCK16
-
Complete and total rant:
You know what fucking confuses the holy fucking shit out of me? DESIGN
I have MAD respect for motherfuckers that spend their days tailoring shit away in CSS, writing custom animations and toggles in JS and ensuring that their HTML is pristine as fuck. I really do and in my opinion they should b getting mad props from everyone, because if they so decide to learn GOOD server side scripting then they are most definitely on their way to create some awesome functional and beautiful shit.
But...
I am not a designer by any means of it. And I know that shit is supposed to look good and work across a multitude of devices. Doing something like that takes me a couple of lines of code (granted, after hours of work that is) that may take a designer way less.
But why oh why do I see THOUSANDS of lines of CSS code for shit that does not take me half the amount of work that it takes other people?
Like seriously. I am trying to emulate the menu that university of Chicago uses(as an example for a lil design practice cuz i suck at it) and looking into their CSS I see thooooousands of lines of code to do something that I did in about two hundred.
So wtf man, do I suck so hard that I am missing some serious shit? wtf is happening? This confuses me, because in my mind it should take me just about as much work as it takes them right?
AGAIN MAD RESPECT FOR DESIGNERS -- If you are a designer reading this please tell me wtf is happening14 -
Why is it so hard to read a 15 pages paper or article? I read hundreds of fiction pages or news in a day, but reading 100 lines of a scientific paper is a pain in the arse and I lose concentration by line 3.
Fak.9 -
Why is it so hard to just build machines that work without all this ideological bullshit? Code doesn't care if politics==true. The world is scary enough without you assholes making modern life a data minefield for even the most educated experts, and taking advantage of the ignorance of everyone else. Fuck you.
I just wanna <look at web pages> without having to consider, counteract, or silently assist some fucking regime. Why is EVERYTHING this way? Everything is a back door or a data mine or a political statement? This isn't a fucking art piece! It's not your espionage tool, fucking codes in invisible ink and tiny cameras and shit everywhere! It's a <web browser>, and if it does ANYTHING besides <browse the web> that I didn't explicitly tell it to do, you better better not be the one who made it. Because if you did, you are what's wrong with the world.6 -
What I don't understand is why it is so hard for some seniors to just let me jot my notes down, I get it you're busy but if you just let me write down certain key words, I will never ask you this question again, I am nervous cause I had to bug you for help so my mind is not taking anything in, its freaking out cause you're making it so clear I am a bother! So I'm gonna go back to my desk without notes and no idea of what you just tried to tell me.... It was never a problem for my first senior, and he even became my mentor! In a question of 6 months he could go on holiday cause I could handle all his responsibilities until he came back with my trusty note book in hand... So why are you telling me to stop making notes!! It works for me so leave me be!! - sits at desk, pondering why I exist - 😖16
-
Fuck Xcode!
Why does every single and small update need to be at least 5GB? And why am I required to update you so fucking often? You are not fixing anything, so don’t even pretend to! Most of the time it is just to support the latest .x update in iOS. Can’t be too hard to update the SDK without updating the entire shit IDE! 😡
And guess what: I JUST UPDATED YOU, SO WHERE IS YOUR FUCKING NEW VERSION??? HOW CAN I WAIT 45 MINUTES AND AFTER THAT YOU DID NOTHING!?! HOW CAN I HAVE THE SAME VERSION AS BEFORE??? NOW I HAVE TO DOWNLOAD YOU AGAIN YOU FUCKING PEASE OF SHIT 😡😡😡1 -
I was not having much respect for out front-end developer, as the UI is not so good., yea. I know it UI depends on the designer.
Now the new design changed and our UI looks awesome.,
and I must say that my respect increased a lot when my pm asked him to fix the layout in UC Browser.
Fucking shit., in UC it is showing two lanes as one lane. I don't know why., he was working hard to fix that.
Massive Respect to him. I really happy by being backend dev.8 -
So I need to let off some steam, let me know if you think I need to calm down. Personally I'm just having a hard time understanding my team lead.
So I've been trying to update our codebase for the past two months so we run tests against the latest versions of each respective major browser. I've also been trying to cleanup our code and split it into logical modules.
Need I add, according to Bitbucket, I've written over 80% of our code on our 4 projects with 4 team members including myself.
He's out for a week, so I decide it's fine time to get some work done -- which is ridiculous in itself. I finish, add unit tests for crap I missed because he kept shutting down my PRs for shit he couldn't understand.
He tells me on Friday, when he got back, that he'll be declining my pull requests because my code is too complex -- my team lead -- thinks list comprehension and OOP in Python is too complex. Doesn't understand why we need to have pep8 lint tests, or why we can't just export one giant monolithic client package with over 3k lines of code.
Is it worth arguing or should I just let my department head know I can't work on this team anymore? He won't get talked to or fired, he's been at my company for 6 years and he's in the inner circle.6 -
Why is it so hard to build reputation on stackoverflow?? Can't upvote, can't comment til I get 50 reputation, can't ask for question clarification so I can answer a question except in a comment...6
-
SUNDAYS ARE THE WORST!!
Normally it’s the weekend but recently it’s just so stressful!
It’s like you can’t even relax because you’re supposed to be preparing for the week ahead!
It doesn’t feel like the weekend anymore!
Why is planning and prioritizing
So MF Hard for me!?!!!!
Why did my brain cope with stress and trauma by simply checking out & spacing out!?
I got so good at it that I find it hard to bring my focus back—it takes soooo much effort to do what i need to do
I’m So Freaking TIRED.15 -
Helping a friend who's a brilliant at mechanics and has his own patents, and got this question when downloading on his 10Mbit line:
"This was supposed to be a fast computer, so why is it taking so long to download?"
To explain the reason was surprisingly hard, considering that this is a guy who's been invited to give a lecture about innovation at a top tech university.1 -
WHY???
WHY THE FUCK ARE YOU SO FUCKING SURPRISED SHIT HITS THE FAN EVERY GOD DAMN TIME A CHANGE IS MADE IN YOUR LIMPING SYSTEM?
YOU GAVE NO FUCKING SPECIFICATIONS NOR ANY CARE TO DECIDE ABOUT WHAT THE FUCK YOU WANT IN IT.
EVERY TIME I SEE THE CODE I GET EYE CANCER, DEBUGGING THIS SHIT IS AS HARD AS FINDING THE FATHER IN A HOBO STREET ORGY
AND YOU FUCKING THINK ADDING FEATURES INTO THE SYSTEM UNDER THESE CIRCUMSTANCES IS SO GOD DAMN EASY.
I hope life's god damn dandy for you, get fucked with a pipe bomb.
Oh, hello DevRant, sorry for sitting on the fence for the past months.4 -
Me trying to take a screenshot with iOS 12:
*holds home and presses lock* (the only way I had found to reliably take a screenshot in previous versions): Siri
Fuck off Siri I want a screenshot!
*tries again same way*: Siri
Fuck OFF Siri!
*holds lock + home*: phone locks
Christ almighty.
*unlocks phone, presses home and lock at the exact same time*
Nothing happens.
*continues holding* I just want my fucking screenshot.
Phone powers off. Hard reset.
Fuck this shit.
How hard is it to monitor two buttons being pressed at the same time? And if it is so damn hard why make it the ONLY WAY TO TAKE A SCREENSHOT??!
Now whenever I want a screenshot it’s basically a crapshoot whether I will get a screenshot, Siri barging in, or my phone locking on me.
Couldn’t they have just used the volume buttons instead? 😡12 -
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA!
Okay, I'm feeling a bit better now.
How to stop being a lil bitch? Why does it seem like everyone got the "don't give a shit" patch except me? I'm working hard on getting my shit together, I've made MASSIVE progress, but everytime I'm feeling good and confident and ready to take the world head-on, I just kinda crumble again with the slightest mishap. This needs to stop. I'm really trying SO hard not to snap. Fucking hell, being aware of all this makes it even worse! It's like I'm two people, one is a downer and REALLY good in draining my brain power, the other is the guy who's typing this and knows that life shouldn't be taken this seriously, but doesn't stay in the cockpit for too long. I'm extremely tired and mad. I just fucking hate this.9 -
Why you should always backup.
Nearly a year ago I developed a whole project (iOS, tvOS, watchOS), but I never backed it up because I had a recent machine and thought the chance that something happens to the disk is so small I didn’t backup. But then my mac didn’t start correctly. So I needed to reset it. Lose the project, some other files but not much else. Then I recoded the project and backed it up on multiple places. But a little later, I was writing another app, again didn’t copy again... This time I deleted the wrong folder and deleted the trash, was gone too. So from then I learned to copy everything I coded. All projects I work on, I keep a copy of on an external disk, GitHub and Bitbucket. Assuming they wont crash all at the same time 😉.
So I recommend everyone to backup all your code. Even if it’s only 500 lines. Losing it is hard...3 -
To any and all family members, before requesting my help with the printer/computer/electronic device follow these steps to make sure I don't get irritated.
1. Make sure it's plugged in.
2. Turn it off then back on
3. Turn it off, unplug it for around 30s, turn it back on.
4. Request help
Why is this so hard to grasp? I don't want to stop my workflow with an issue that could be resolved in less than a minute!1 -
I don't get people..
He is a good person and and realy tries..
Tries what?! To annoy coworkers that have to fix every single thing he does?!
Some people will justify anything with 'he is a nice person and tries hard'. WTF?!
So if someone is a nice person, likes to talk a lot, has 'good' social skills but writes crappy code he doesn't test at all.. or tests and see that it's glitchy and still doesn't fix it.. so he is a good worker for that?! Dafaq?!
So if he is a 'lovable' person, he deserves to be here, doing more damage than helps.. he deserves to have a job, with same pay (or even more) than me?! WTF?! How?!
Why is this ok?! If we were heart surgeons and he killed a person or two due to lack of skills or negligence, what would happen?!
He'd get fired on spot!! Why can't it be the same with devs?!
Why on fucking earth do we need to put up with people who try their best and fail?! Especially if their best is lowest of all, lower than the 'I don't give a fuck, just doing sth so the boss stops nagging'?!
Fuuuuuuuu!!!!
But ok, some people are not cut out for some work, I get it.. but why the fuck do other people justify that with 'he tries'?! Dafaq?!
Maybe next time 'I'll try' to perfom brain surgery on you..and you'll end up a fuckin plant.. is that ok with you?! I'll be trying (not really) and do my best (well I will try not to use a chainsaw when cutting open your head).. will that be ok with you?!
Fuck!!5 -
WHY THE FUCK DO MY TEACHERS KEEP USING SHITTY TRANSLATIONS FOR PROGRAMMING CONCEPTS?! Like dude, everything related to programming is in english, just use the fucking terms in english for fucks sake. There are some words like "array" that fit into portuguese sentences without needing translation, so why translate it?
Why do you use acronyms in portuguese? People in the Database Systems class will later read a lot the acronym DBMS but won't know what the fuck that is because they teach the acronym SGBD, which is a translation.
It's so cringy and useless, so many terms the students will have to translate back to english when they get out to the real world because everything related to programming is in english.
"oh but what if the person doesn't know english" you don't even have to know english, just associate the concept (which will be explained to you in your language) with an english word. Also if you don't know english you'll have a very hard time, so I'd suggest taking english classes as your electives.
Ok I'm done, I got it out of my system.6 -
I'm planning on writing an open source (and much improved) version of my logger, but I'm stuck on picking a name :<
So, anyone have naming suggestions for a tagged and branching/nesting logging library? (ES6)
(I don't think "deforestation" is a good choice. sounds kinda bad.)19 -
Why the fucking hell is it so fucking hard to find an Android phone without a shitty ass UI slapped over it?
Holy fucking shit this is fucking ridiculous.18 -
To all frontend webdevs here:
Explain to me how do you cope with all this insane clusterfuckness of frameworks, tools and js libraries.
Why is it so hard for a beginner like me to learn webdev? Android and backend are much more logical and sane. Even Node.js is pretty dope.11 -
Fucking hell everything in java is so annoying, confusing and hard to get working. I just want to use JavaFX, why do you require me to sacrifice a lamb in order to do so? It might be my fault though, but c'mon, I don't want to spend 2-3 hours reading through shitty documentation in order to understand how maven works and what the hell Gradle is. Why can't it be as simple as adding a module name to a config file, like in Rust's Cargo? Even using intellij to acquire JavaFX and set it as a dependency doesn't work, it gives me some weird "JavaFX not configured" bullshit error. What the fuck, you're a library, you shouldn't need anything else ffs6
-
Why is Drupal so hard to learn?!!!!!!
It feels like you are learning an entirely new language. Yes it makes hard things simple, at the same time making simple things hard to accomplish.
And also modules are buggy, you would fix bugs instead of doing your tasks.
I want to learn Drupal but I guess it is not friendly for beginners like me.12 -
Fuck google cloud platform. My server has been down for last 4 days. Stupid reason google gives me is that it does not have resources available in my zone. Why the fuck do you start a hosting company if you cannot provide RAM and CPU. On top of that their support is so bad that after 20 emails, 4 chat tickets, 3 phone calls nobody knows the issue I am facing. They just give the links to their ultra stupid documentarion.
Now all my 6 projects are down. Clients are getting impatient. I cannot do any work and googles support is the worst.
They dont even want to understand the issue, dont know how they will solve it.
I have created AWS instance now and migrated to AWS. But i have old backups which are useless on AWS. To get the latest backups i need google cloud instance to get started but stupid google does not have resources. How hard it is to add 1 CPU and 1GB RAM?18 -
I now know why I'm a developer and not a designer, it's so fucking hard like it's goddamn bootstrap that shit is basically built for me but it still looks like an egg took a shit on a toaster
-
Create a new project in Xcode Version 10.1 (10B61) - Single View iOS app.
Drag a button on to the screen. It shows in InterfaceBuilder
Launch app in simulator. Button shows, then disappears. Noob says WTF?!
Poor noob has to ask me why this is happening and I explain that Apple's Single View project is a single splash screen project. The button they placed on what they thought was the single "window" is really a splash screen named "LaunchScreen".
Apple Xcode team (aka fucktards) provide yet another shitty out of the box experience...
It is so hard to be positive when teaching others how to use Xcode. Thanks for DevRant for letting me vent.1 -
Fact, that I am making websites does NOT mean, that I will make a website for you for free. Why it is so hard for people to understand?2
-
I am working on an open source game project, and the most common way to draw things is using a class named ManagedSurface. The class is otherwise awesome, but it has a method called getBasePtr(x, y), which gives you a pointer to the requested coordinates. Fair enough (this is C++ without STL by the way).
But WHY THE HELL CAN I REQUEST ANY POINTER THAT I WANT, EVEN IF IT'S OUTSIDE THE SURFACE? Other cointainers have sanity checks, asserts and such, and the surface KEEPS TRACK OF IT'S WIDTH AND HEIGHT.
WAS IT SO FUCKING HARD TO ADD assert(x <= w); assert(y <= h);???
I spent 3 days on valgrind trying to find a heap corruption that manifested at random points in the code.
FUUUUCK!
On the bright side, I learned how to use valgrind (which is awesomely awesome).4 -
Why is whatsapp just AIDS?!
The privacy thing is big but let's take a look at the app.
It's the only messenger app I've ever used that forces you to save incoming images to your gallery if you want to see them, like wtf?
The UI looks like shit and it's kinda hard to understand from a UX perspective, for example read receipts which Messenger does beautifully. Facebook owns WhatsApp so A it's not really a better choice than fb messenger and B it basically has a shit quality application compared to Messenger. The messaging experience in sketchy Chinese dating apps is better.
Also it basically hacks your phone. It turns on notifications and permissions by itself even when I explicitly turned them off, and sends me notifications for muted conversations.
Speaking of notificatikns. Every time I get 1 notification, notifications from every single chat even an unread messages from 3 years ago gets sent to my phone.
It guzzles battery like a monster.
And they have basically formed a cult in the indian community, so now everyone thinks its the best and no one uses anything else because "it's so convenient" which it's NOT. It has a terrible interface, and the only thing I like about it is the fact that it being so shit gives me an excuse to uninstall it and ignore all the fucking spam on there.
Honestly, the app needs to die ASAP because it is frankly the shittiest of shittiest messaging applications.5 -
ŁEŊ@#fmęgwjnfčuÆ®ŊÆŁEŊ3ŋ4ħ€3łæŋ€4æł4ħæ4€ħ9æŋ98ł3ħŋ98↓łħ€9“→↓ŋħł93ŋ@38ŁŊ89ÆŁ4ĦŊ08ÆŁĦ093Đ3@09ŋæłęb„guwahęgawęgÆŁ$ĦÆEı$Ŋ(ÆŁ#Ŋ↑(łæ49↓ŋw
AAAAAAAAAAARRGGHHHHH!!!!!!!!!!!!!!!!!!!!!!!
I'm gonna break this laptop in half if I will not get a break from Windows!
I'm running it in a VM and STILL this fucker gets on my nerves SO FUCKING HARD!!!
1. CPU% 100%. Laptop fans are spinning so hard it's ready to take off
2. My hands are on the laptop. THey are HOT from the heat from inside. Hell that's uncomfortable!
3. ctrl+shift+esc to see why is cpu% 100%. It's something called WMI Host something. Kill that mthrfckr!
4. Process respawns immediately and goes up to 100% again. I have already increased handles limitation for that service a few weeks ago. Like 20x more than it was before!
5. website in IE
6. does not seem to be responding
7. hit f5. Nothing happens
8. Hit refrech buttong on the toolbar. Nothing happens
9. Place cursor at the address bar and hit ENTER. Nothing happens.
Meanwhile my hands are burning.
WHAT THE FUCK!!!
What kind of idiotic system is that!! My asshole is a better OS than this piece of SHIT!
AAAARGHHHHHHHHHHHHHHH#@ŦŊæ¶đ@#ĸogęq j
I'm super pissed. Better keep a 30-40 meters distance from me so the things I throw at you would not hit your ballz!
Now that I come to think of it, the only times I am THAT pissed is the times I am using windows. Srsly.7 -
My best code review experience?
Company hired a new department manager and one of his duties was to get familiar with the code base, so he started rounds of code reviews.
We had our own coding standards (naming, indentation, etc..etc) and for the most part, all of our code would pass those standards 100%.
One review of my code was particularly brutal. I though it was perfect. In-line documentation, indentation, followed naming standards..everything. 'Tom' kept wanting to know the 'Why?'
Tom: 'This method where it validates the amount must be under 30. Why 30? Why is it hard-coded and not a parameter?'
<skip what it seemed like 50 more 'Why...?' questions>
Me: "I don't remember. I wrote that 2 years ago."
Tom: "I don't care if you wrote it yesterday. I have pages of code I want you to verify the values and answer 'Why?' to all of them. Look at this one..."
'Tom' was a bit of a hard-ass, but wow, did I learn A LOT. Coding standards are nice, but he explained understanding the 'What' is what we are paid for. Coders can do the "What" in their sleep. Good developers can read and understand code regardless of a coding standard and the mediocre developers use standards as a crutch (or worse, used as a weapon against others). Great developers understand the 'Why?'.
Now I ask 'Why?' a lot. Gotten my fair share of "I'm gonna punch you in the face" looks during a code review, but being able to answer the 'Why?' solidifies the team with the goals of the project.3 -
I’m in a big company now. We have all the resources in the world. We promote best practice. We don’t even seem to have deadlines. We mob on everything so that we get the benefit of all our experience combined.
So if all that is true, why in gods name does the first class I open have shed loads of hard coded settings, IP addresses and GUIDs in it?
FML. How did I end up working in this shit.9 -
Why do so many online resources still change quote characters in the code for the curly ones? It's 2023, how hard is it to add a fucking rule to skip conversion inside the <code> blocks?8
-
So....
I was asked to transfer a spaghetti Android/iOS project to xamarin for a bank client yesterday because "that's what they use".
This is a crm/loyalty app that has been around for 2+ years now (you can imagine the mess). On top of that I have no knowledge of c#, .net or xamarin.
So I ask: "When is this supposed to be delivered?"
Boss: "It was scheduled for 2 weeks ago but let's say 2 weeks from now"
Me: "..... This is a huge remake it won't be even close to ready in 2 weeks"
Boss: "Let's check on the progress in 2 weeks and see how it goes"
Why is it hard for bosses to provide an actual timeframe???
He's been pulling the same crap with junior devs for years and of course they get nervous and create more spaghetti code...
Anyway long story short (not) I have an interview Monday!
Let's hope it's not more of the same!
P.S.: to junior devs: When you are given a deadline... IGNORE IT.5 -
This whole programming profession sucks! Programmers suck! Managers suck! Companies suck! Products suck!
Why is it so hard to organize your stupid code at least a bit?! No, it’s not deadlines, just write a block of code and give it a meaningful name, a function, a method, a comment, so many options, so little fucks given. Give things a meaningful name instead of whatever came to your mind that moment. There’s no excuse! No, just leave it to the next guy, and he’ll leave his trash for another one. And then we complain and make memes about it. Fuck you all!
There’s no purpose or vision of products, managers sweep problems under a rug, executives do whatever they do, as long as some money is pouring in, just keep pedaling semi-mindlessly. Spin the wheel you little hamsters until you drop, there’s enough hamsters out there.
It’s just a clusterfuck of small, selfish interests and egos, a mud of meaningless and unnecessary problems that need not be there.
It’s not the workload, it’s the stress! The stress of bullshit, and constant problems that can be avoided if everyone did their job at least half-professionally. Not just programmers, everyone!6 -
An online community I've been part of for years has seen a lot of popularity/hate overnight due to a new policy. The influx of new people who want nothing to do with us but just drop by to troll and be cunts is impressive. Also, a significant amount of bots. I want my online home back :( I'm for the new policy and very much against these new clowns who don't really have any reason to be on our page. Before anyone yells gatekeeping, it's a site about knitting and crochet. Why would you go there if you don't know either craft and have no desire to learn or talk about those? So disappointed. I hope it brought new crafters in and that the trolls will go away soon. It's been such a nice place for so long with barely any idiots because it was reasonably small.. And now look at this mess. I logged in to 20 friend requests from people I don't know and am almost certain aren't real people.
Why is it so hard for humans to accept that some people may disagree with them and that's okay?16 -
Short rant: I hate xcode, I hate Swift, I hate Apple.
After 3 weeks of intensive work (I'm an apprentice, part-student, part-worker), I was happy to go back to school and was like "Oh we're going to learn iOS, sounds cool !".
It is now friday, I have homicidal tendencies growing inside me, I want to cry whenever I hear xcode or swift.
Why in the hell I can't use a string argument when I'm calling a function NEEDING a string arg ?
Why do xcode take so long to tell me that there is a problem, why is the error message not explicit AT ALL ?
Why dictionaries so hard to manipulate, EVEN IN JAVA IT'S SIMPLIER.
Why putting our API call in specialized files make them run AFTER EVERYTHING ELSE and the solution that is given to us is deprecated since 5 years ?
Why is a classic c-style for loop is now deprecated ?
These are just a drop in the ocean of WHAT THE FUCK IS THAT that we came across this week.
Fuck Swift, fuck xcode.7 -
Microsoft owns github
Microsoft owns windows
Microsoft owns powershell
Why then, why exactly, is it so fucking hard to get ssh private keys for github, up and running on windows powershell.
I tried to change permissions on files but then it broke the git-bash implementation 😭.
Fuck it !! 😭😭9 -
Before I decided to learn C, I had heard tell of pointers being "hard to use". Of course I thought "maybe so, " after all, that was basically the only thing I heard about pointers, "they are hard!".
And so, when I learned C, and I got to the part about pointers, I was expecting at least some trouble (I can't know everything) and it was just... easy? Maybe the trickiest thing was how * has two different meanings based on the context (declare/dereference) but that was easy too.
Why the hell is all I hear from people about pointers is that they're difficult?11 -
A story from around 2005:
Customer laying out specifications: “We expect this software to need to last 25 years or so, and it will need to keep historical file processing data by dates for at least that long, assume storage is no issue.”
Devs at the time: “look best I can do is support that start with 200 or 201, anything else is really too much to ask. Also understanding how to work with dates at all and not just string manipulation is waaaaayyy hard yo.”
Fuck you lazy motherfuckers. This is why people thought Y2K would be a problem. -
Ah, shit. First, I get downvoted a bunch, by a rogue jester bot I assume, then the retoornuke goes off, and with her account, even more of my hard-earned updoots lost into the ether.
How is this important? It isn't. I'm merely annoyed. Needed only a couple more to get myself a pet, I was so fuckin close maan. Now I need about 60 again, so not too bad actually, but if you see me shitposting at an increased pace, then you know why.11 -
So, for the past...what, week or so? I've been working on a side project with @gianlu. It's the PretendYoureXyzzy fork - our attempt to rejuvenate an old shitty piece of software.
I had started working on a fork alone, and then he asked to team up so I was like "Sure, I got nothing better to do." So, he's working on the backend (and hooking JS up to the backend) and I'm developing the frontend.
I don't know why I thought tech would stand still. Google says they're putting MDL on life support and replacing it with a much more complex successor, MDC. It's not hard to use, but what really bugs me is the lack of notice on getmdl.io. If you are switching to another project as your main focus, why the fuck wouldn't you advertise in the most places possible?
Granted, I don't do web design and/or development on the daily. Yes, I can do it, but I'm not always as up-to-date with web technologies as I'd like to be.
However, the screencap captured is the third time I've taken the knife to the UI. MDC is great tooling, at least to me. That dialog? Not something MDL would've had out the box on the first day. You'd have to work for that.
I don't have an issue with MDC, I have an issue with the lack of PR around it.6 -
Why am I sad, depressed, demotivated, you ask?
Because I was asked to create-react-app with nodemailer, it worked well on heroku, YAYYY MEE, "
"NOTHING GOES WRONG IN DEPLOYMENT FUCK YEAH"
Little did I know that was a "demo" for the business people, My superior / manager/boss wants me to deploy on 1and1 service provider,
> Okay 1 and 1 service provider does provide Nodej, so it shouldn't be hard.
> Turns out it is a Windows hosting server IIS 10 without URL Rewrite.
> *INTERNAL SCREAMING*
I went up to him to talk about this issue and requested to let me talk to 1 and 1, and get this sorted
> But bro, if we cannot fix it, I think they also cannot fix, probably.
*INTERNAL SCREAMING AT PEAK*
I just want URL Rewrite installed on IIS10 so that I can move on to the next project.
A little background for this project
> No support from him during development.
> I personally used HD Images, because why not?
> Website seems slow because of HD Images, and now he complains about it.
You fucking (managers) want a website to be scalable and fast and yet you choose to focus on B U S I N E S S instead of support the real guy.
I'm fucking sick and tired, it took me 24 hours figure out the issue because there is nothing on 1 and 1 support/ forum/help center.
Another 24 hours to try and fix, yet no luck.
I'm gonna finally point the domain name to heroku. Fuck, I'm so fucking done6 -
I feel guilty for using YouTube Vanced and being unable to support content creators.
Shouldn't there be a feature that allows you to toggle ads on certain channels you want to support?
I really want to support such folks who are creating valuable educational content but Google being the biggest piece of corporate shit, makes me angry when it comes to compensating the creators fairly when they make Billions off their hard work.
The world is a better place because of such teachers who spend time, energy, and efforts to create valuable and useful content for rest of the world.
Funnily, back in days when we had awesome stuff, the tech was shit to document all of it. Now when we have advanced and easily accessible tech, we have shitty TikToks.
Why can't the creators of good content get more visibility and why is the world so fucked?13 -
I think I might change my middle name to "I told you so"
Couple of weeks ago I proposed integrating a daily process job into an existing WPF application (details of what+why would be too long to explain) and the manager suggested I make the changes
Me: "I can do it, but Jay has the most experience with that application. I don't have his WPF skills"
Mgr: "How hard can WPF be? If it uses the MVVM pattern, it should be a snap."
Me: "Its nearly an 8 year old WPF project with several chefs in that kitchen. I pretty sure I could figure it out, but that is a difference between 2 weeks and 2 days. Integration is pretty straight forward, Jay could probably do it in a day."
DevA: "WPF is easy. MVVM makes it even easier. I worked on the shipping app."
Me: "That's was a brand new, single page app, but yea, it should be easy."
DevB: "WPF has been around a long time and the tools have really matured. I don't understand what is so difficult."
Me: "I didn't say anything would be difficult, I know with that application, there is going to be complexity we need to figure out."
DevB: "It uses the MVVM, so all we need is the user control, a view model, controller, and its done."
DevA: "Sounds easy to me."
Mgr: "If you need more time to work on the vendor project, I'll have DevB work on the integration."
<yesterday>
Me: "How is the integration going?"
DevB: "This app is a mess. I have no idea how they got the control collections to work. If I hard-code everything, I can get it to work. This dynamic stuff is so confusing. Then there is the styling. Its uses dark mode, but no matter what I do, my controls show up in light mode."
Me: "The app uses Prism, so the control configuration is in, or around, the startup code."
DevB: "That makes sense. Will it fix the styling too?"
Me: "I have no idea. When I looked at it, some controls loaded the styles from the main resource, other's have it hard-coded. Different chefs in the kitchen, I guess. How far have you got?"
DevB: "I've created invoice button. That is as far as I got"
Me: "I'm finished with the vendor project and I'll be wrapping up the documentation today. I can try to help next week."
DevB: "Thanks. I think we might have to get Jay to help if we can't figure this out."
Me: "Good idea"
Two weeks and only a button. A button? I miss Delphi.2 -
Subject: a rant for devRant
Hello,
Not entirely sure why or when exactly it happened, but after I joined mailing lists I have a pet peeve for people who don't use a proper subject line, or don't use email when I literally made a mail server for that purpose (some organizations really prefer calling apparently). Is it really that hard to summarize a message in one sentence? Hell half the time even the message itself is just a few sentences.
Also the greeting and salutation at the beginning and end of email messages. I find them so redundant. Has anyone ever gotten any meaningful information out of "Hello", "Greetings", "Dear", or something like that? Or "Best regards" or whatever. I get that it's just being polite but it's so meaningless! I really don't like using them anymore. Just a message block and who it came from, that's all it needs to me. Instead pour some effort into the damn subject, the title of whatever drivel you're putting out there! Or replying to an email *only* when the subject matter is still related! Or actually replying to the damn email if it's still that subject matter...
I probably sound like an old man, but seriously.. email isn't a hard concept once you "get it". Anyone can write a halfway decent letter, why isn't that the case for email?
Best regards,
Condor9 -
So, unlike normal people who just click on an mp3 file in windows explorer, I'm listening to music saved on my windows hard drive, accessed via an sshfs mount, using VLC running inside a HyperV linux VM and Xming/pulseaudio to make it show up inside windows like a normal window and play sound.
Why? Because this is my replacement for WSL which broke (Good Job on the updates as always, M$) and I'm celebrating that I got everything* to work.
* Nevermind the hours I wasted because I forgot to add a rule to the windows firewall allowing pulseaudio to connect and the fact that Xming can't handle vlc playing video7 -
!Dev
Sitting in a bus on 19 hour ride with my class to England a few things to rant about came to my mind:
Why the fuck do you have to blast shitty german rap music out of your fucking JBL boxes and why do you have to turn up the volume so much that I can still hear it although I am wearing headphones, listening to music and sitting 5 fucking rows in front of you.
Also why the fuck do clocks in buses never display the right time? How hard can it be to make the clock display the right fucking time?
Another thing: why does this bus which is especially made for long rides not have a fucking trash can?! Seriously wtf?
Rants aside I am really looking forward to staying in England for a week although I won't have a computer for the next week :(
Another thing: why the fuck is the coffee you get at pull-ins so fucking disgusting ?
Like srsly, it is made by a machine and still tastes like thrown-up.
And why the fuck does everyone look weirdly at you when you buy a can of red bull but everything is fine when someone my age drinks 3+ liters of beer and then throws up? What the fuck? People look at me weirdly when I tell them that I don't drink any alcohol, heck I am actually not even allowed to do so because I am 15 and not 16 (beer is allowed in Germany if you are 16+ but nobody really cares about that). Heck where I am from they even encourage you to drink beer? What the fuck??!!
Anyway looking forward to England and also sorry about the long non-dev related rant. Just had to rant about some people and society.
P.S. do you know any (preferably free) Android apps / games where you have to code or just solve problems with logic?14 -
Why is it so fucking hard for people to follow basic rules? FFS you're supposed to stay at home to limit contact between people, that doesn't mean you can play volleyball with your friends or go to the local park! And if you decide to go hiking, choose a place where you'll be alone, not the most popular trails around the city! You're the fucking reason government needs to make new quarantine regulations every day, not this virus, and you deserve no help if you catch it! Fuck you!15
-
How are you? I have burning open position, are you interested?
Are you open to the position?
Are you open?
ARE YOU OPEN?
Well how would I know? You didn't tell me literally anything. Why won't they start with tech stack and salary range instead of 20 "how are you messages". Why is it so hard? Why are recruiters so hopeless, I'm never gonna get this how and why this garbage ineffective way of working is tolerated by companies.1 -
Well what an adventure with this SSD...😑
my sis' laptop is from 2013-ish(?) and has/had a slow HDD in it. I wanted to speed it up, before her study, so I bought a new internal SSD (no new laptop wanted).
Created a bootable USB, exchanged the hard drives and install the OS on it. Seems easy enough...
The laptop restarts to finish its process ... laptop shuts down immediately, no warning whatsoever. 😳🤨
Start it up, loading screen, fan gets louder and louder ... instant shut down.😳🤨🤨.
Redo process, this time landing on blue-screen, error code critical process died? ... instant shut down again.🤔
Restart from old HDD, normal.😐
Retry with boot USB and reinstall SSD. Setup process copying files, meanwhile instant shut down.😳 Please don't tell me!😩 Since every part of the laptop was working, except the new inserted SSD, I thought "FUCK not a broken SSD!😣"
I had my own PC with internal SSD slot, so tried to find out, whether it would be broken...
All starting up fine??🤨🤨
Ok then? Finish the setup for the third time now ... everything up and running.😐🤷
Normal shut down, unplug, plug back onto laptop, it works. HOW?? WHY?? 😕
Why the fuck are you suddenly working? 😐🤷🤷🤷
That's some magic...5 -
The frustration that comes to each developer when he tries to write the code structured by thinking through each situations, and your team lead comes and tells you why r you doing so much validations just hard code them we need to release it today client is waiting. After 3-4 months the same team lead goes through the code and shouts at you telling why the he'll you hard coded all these, can't you write the code correctly by thinking through.3
-
So yeah XML is still not solved in year 2018. Or so did I realize the last days.
I use jackson to serialize generic data to JSON.
Now I also want to provide serialization to XML. Easy right? Jackson also provides XML serialization facitlity similar to JAXB.
Works out of the box (more or less). Wait what? *rubbing eyes*
<User>
<pk>234235</pk>
<groups typeCode="usergroup">
<pk>6356679041773291286</pk>
</groups>
<groups typeCode="usergroup">
<pk>1095682275514732543</pk>
</groups>
</User>
Why is my groups property (java.util.Set) rendered as two separate elements? Who the fuck every though this is the way to go?
So OK *reading the docs* there is a way to create a collection wrapper. That must be it, I thought ...
<User typeCode="user">
<pk>2540591810712846915</pk>
<groups>
<groups typeCode="usergroup">
<pk>6356679041773291286</pk>
</groups>
<groups typeCode="usergroup">
<pk>1095682275514732543</pk>
</groups>
</groups>
</User>
What the fuck is this now? This is still not right!!!
I know XML offers a lot of flexibility on how to represent your data. But this is just wrong ...
The only logical way to display that data is:
<User typeCode="user">
<pk>2540591810712846915</pk>
<groups>
<groupsEntry typeCode="usergroup">
<pk>6356679041773291286</pk>
</groupsEntry>
<groupsEntry typeCode="usergroup">
<pk>1095682275514732543</pk>
</groupsEntry>
</groups>
</User>
It would be better if the individual entries would be just called "group" but I guess implementing such a logic would be pretty hard (finding a singular of an arbitrary word?).
So yeah theres a way for that * implementing a custom collection serializer* ... wait is that really the way to go? I mean common, am I the only one who just whants this fucking shit just work as expected, with the least amount of suprise?
Why do I have to customize that ...
So ok it renders fine now ... *writes test for it+
FUCK FUCK FUCK. why can't jackson not deserialize it properly anymore? The two groups are just not being picked up anymore ...
SO WHY, WHY WHY are you guys over at jackson, JAXB and the like not able to implement that in the right manner. AND NOT THERE IS ONLY ONE RIGHT WAY TO DO IT!
*looks at an apple PLIST file* *scratches head* OK, gues I'll stick to the jackson defaults, at least it's not as broken as the fucking apple XML:
<plist version="1.0">
<dict>
<key>PayloadOrganization</key>
<string>Example Inc.</string>
<key>PayloadDisplayName</key>
<string>Profile Service</string>
<key>PayloadVersion</key>
<integer>1</integer>
</dict>
</plist
I really wonder who at apple has this briliant idea ...2 -
Why is it so hard to convice coworkers (other programmers) to use source control? Yes it's an extra step every day or so but it can be so helpful and save so much more time tracking down versions and when the bug first appeared. Also, piece of mind if your computer every gets hosed.7
-
That's it, where do I send the bill, to Microsoft? Orange highlight in image is my own. As in ownly way to see that something wasn't right. Oh but - Wait, I am on Linux, so I guess I will assume that I need to be on internet explorer to use anything on microsoft.com - is that on the site somewhere maybe? Cause it looks like hell when rendered from Chrome on Ubuntu. Yes I use Ubuntu while developing, eat it haters. FUCK.
This is ridiculous - I actually WANT to use Bing Web Search API. I actually TRIED giving up my email address and phone number to MS. If you fail the I'm not a robot, or if you pass it, who knows, it disappears and says something about being human. I'm human. Give me free API Key. Or shit, I'll pay. Client wants to use Bing so I am using BING GODDAMN YOU.
Why am I so mad? BECAUSE THIS. Oauth through github, great alternative since apparently I am not human according to microsoft. Common theme w them, amiright?
So yeah. Let them see all my githubs. Whatever. Just GO so I can RELAX. Rate limit fuck shit workaround dumb client requirements google can eat me. Whats this, I need to show my email publicly? Verification? Sure just go. But really MS, this looks terrible. If I boot up IE will it look any better? I doubt it but who knows I am not looking at MS CSS. I am going into my github, making it public. Then trying again. Then waiting. Then verifying my email is shown. Great it is hello everyone. COME ON MS. Send me an email. Do something.
I am trying to be patient, but after a few minutes, I revoke access. Must have been a glitch. Go through it again, with public email. Same ugly almost invisible message. Approaching a billable hour in which I made 0 progress. So, lets just see, NO EMAIL from MS, Yes it appears in my GitHub, but I have no way to log into MS. Email doesnt work. OAuth isn't picking it up I guess, I don't even care to think this through.
The whole point is, the error message was hard to discover, seems to be inaccurate, and I can't believe the IRONY or the STUPIDITY (me, me stupid. Me stupid thinking I could get working doing same dumb thing over and over like caveman and rock).
Longer rant made shorter, I cant come up with a single fucking way to get a free BING API Key. So forget it MS. Maybe you'll email me tomorrow. Maybe Github was pretending to be Gitlab for a few minutes.
Maybe I will send this image to my client and tell him "If we use Bing, get used to seeing hard to read error messages like this one". I mean that's why this is so frustrating anyhow - I thought the Google CSE worked FINE for us :/ -
Is apple a fruit? Yes.
Is orange a fruit? Yes.
Is apple an orange? No.
Does apple equal a fruit? No.
Does orange equal a fruit? No.
If you're capable of understanding this, then WHY IS IT IT SO DAMN HARD TO UNDERSTAND 0 == ""?11 -
Why is it so hard to find internships in india? !!
Aaaaaaaarg
If you're not from india, is it hard to find some there too?5 -
So I told my partner in not buying a Mac and that in buying a base model pixelbook instead, showed her the pricing and she nearly strangled me...
Why is it so hard to be a Google fan and have to import litteraly everything with an extra 400 AUD tacked on -,-12 -
I am so much stunned i cannot form a sentence on what to say. Lost 3 days trying to fix a bug on why socket.io was connecting to backend TWICE per user. I cannot fucking comprehend this. Backend works fine because via postman it doesnt connect twice. Everything works fine. 72 fucking hours waste d of my life just to find out i had to change
<React.StrictMode>
<App />
</React.StrictMode>
Into
<App />
When i tell you my jaw fucking dropped it fucking did. And it does not drop often or that easily for me. What the FUCK is react strict mode???? FUCK react. I fucking hate this piece of garbage framework. I even like nextjs better. React💩💩💩💩💩💩💩💩💩💩motberfucker WHY is strict mode fucking my code what use does it have who gives a shit why does it have anything to do with websocket connection FUCK react 💩💩💩💩💩💩💩💩💩 how does this piece of camel turd have anything to do with duplicate connection 💩💩💩💩MFKKCER this garbage doesnt exist in my beautiful angular or nextjs PLS why this cancer has to be so headaching i knew I'll get FUCKED if i dont go over a detailed course learning react from scratch. Now im suffering. Learning this garbage the hard way FUCK off4 -
So, by a cruel twist of fate I ended up on the front line of tech support for the app we've built. It's aimed at non-IT professionals, in general people who are not expected to know too much about computers but who should have at least two neurons to bash together in their pretty little heads.
No.
It really makes me drop my faith in humanity considerably. Clicking a confirmation link is too much. Filtering an excel sheet is too hard, despite it being their technically main work tool. Tickets are basically "shit's broken go fix". What is broken? How to reproduce it? Why do you expect the person on the other side of the screen to be a fucking diviner? I recently ran all out of dove guts to search for the answers of your questions.4 -
BielyApp, yeah, GOOOOOOOOD IDEA! I still can‘t understand how this works or why did a reasonable human being though that this would be a great idea! 🤔
Ok. There‘s a community that lives 4 or 5 hours from my my city. I don‘t want to offend anybody, so let‘s call them “Bielys” (just a random name, I don’t know if there’s actually a group or etnia with that name).
Bielys live isolated from modernity, they speak their own language and they don’t use technology.
A dev friend of mine was having a hard time (he got divorced and was almost in bankrupt). One day, a man asked him and another dev to work on a mobile app:
...
“BielyApp”.
...
It was supposed to be a movile app for commerce. Bielys could sell and buy biely stuff from another bielys. Well, at this point you can figure out why this was a bad idea. Anyway, they developed it. Even it’s on GooglePlay and AppStore 😱 I installed it to see if it was truth or not. Incredibly it was true. BielyApp exists and the worst thing is that you can log in with your facebook account. WTF?!
I asked to him “But why?! WHY?! They don’t even use smartphones!!!!”
And he answered “I know, but I needed the money”1 -
Why is it so hard for people (especially managers) to learn to work smarter not harder....
FIX THE GODDAMN PROBLEM CORRECTLY... THE FIRST TIME SO WE DON'T HAVE TO KEEP FIXING ITS BLOWUPS ON WEEKENDS....
AND STOP HIRING MONKEYS THAT JUST KNOW TO PRESS BUTTONS RATHER THAN DESIGNING FULLY FUNCTIONAL SOLUTIONS THAT DON'T BLOW UP OR LEAVE A TRAIL OF SHIT BEHIND THAT I NEED TO DECIPHER N CLEANUP....2 -
I don't get it.
I tried Kotlin on Android just for fun, and it doesn't support binary data handling, not even unsigned types until the newest version. Java suffers from the same disease.
How does one parse and process binary data streams on such a high end system? Not everything is highlevel XML or JSON today.
And it's not only an Android issue.
Python has some support for binary data, and it's powerful, but not comfortable.
I tried Ruby, Groovy, TCL, Perl and Lua, and only Lua let's you access data directly without unnecessary overhead.
C# is also akward when it comes to data types less than the processer register width.
How hard can it be to access and manipulate data in its natural and purest form?
Why do the so called modern programming language ignore this simple aspect that is needed on an everyday basis?10 -
Heh promotion? I only get fake promotion..
For two years, I was doing so many *free* overtime, manager is a big liar, he said that it will he considered on the yearly evaluation.. cool, the thing is there is no evaluation at all, just lying and lying.
Few months ago I took a vacation of 1 month (I am expatriate so I get one vacation per year, my home town is too far..) I talked to tye manager about salary taise and he said absolutely we will talk after I get back..
He called me during my vacation to do some urgent (as always) work, I worked about 5 days, and for free.
After I get back to work, he was angry about my *attitude* that I wasn't available more time.. oh and there was no fucking raise. always lying..
In this country, if you're an expatriate so you can travel outside the country without the validation of the employer (yeah like that) and the notes period is about 3 months, what makes very hard to find another job, no one will wait for 3 months, unless you vanish during a vacation.
So, why didn't I gave my resignation? well, life is hard when you have unemployed wife and a little baby, and the pay is, let's say OK comparing to costs here.
I am charged to learn and work with another language and framework, and when I asked for a raise they said no, so I will stop working in this language and let's see..
The problem is that other employees in thus company are literally bitches, they don't say no to anything, so I am the special guy here who does not a blowjob..
So, what do I do? I am hunting for a new job since a while but no luck.4 -
Stupid pipeline bullshit.
Yeah i get it, it speeds up development/deployment time, but debugging this shit with secret variables/generated config and only viewable inside kubernetes after everything has been entered into the helm charts through Key Vaults in the pipeline just to see the docker image fail with "no such file found" or similar errors...
This means, a new commit, a new commit message, waiting for the docker build and push to finish, waiting for the release pipeline to trigger, a new helm chart release, waiting for kubernetes deployment and taking a look at the logs...
And another error which shouldn't happen.
Docker, fixes "it runs on my machine"
Kubernetes, fixes "it runs on my docker image"
Helm, fixes "it runs in my kubernetes cluster"
Why is this stuff always so unnecessarily hard to debug?!
I sure hope the devs appreciate my struggle with this... well guess what, they won't.
Anyways, weekend is near and my last day in this company is only four months away.2 -
I used to be a sysadmin and to some extent I still am. But I absolutely fucking hated the software I had to work with, despite server software having a focus on stability and rigid testing instead of new features *cough* bugs.
After ranting about the "do I really have to do everything myself?!" for long enough, I went ahead and did it. Problem is, the list of stuff to do is years upon years long. Off the top of my head, there's this Android application called DAVx5. It's a CalDAV / CardDAV client. Both of those are extensions to WebDAV which in turn is an extension of HTTP. Should be simple enough. Should be! I paid for that godforsaken piece of software, but don't you dare to delete a calendar entry. Don't you dare to update it in one place and expect it to push that change to another device. And despite "server errors" (the client is fucked, face it you piece of trash app!), just keep on trying, trying and trying some more. Error handling be damned! Notifications be damned! One week that piece of shit lasted for, on 2 Android phones. The Radicale server, that's still running. Both phones however are now out of sync and both of them are complaining about "400 I fucked up my request".
Now that is just a simple example. CalDAV and CardDAV are not complicated protocols. In fact you'd be surprised how easy most protocols are. SMTP email? That's 4 commands and spammers still fuck it up. HTTP GET? That's just 1 command. You may have to do it a few times over to request all the JavaScript shit, but still. None of this is hard. Why do people still keep fucking it up? Is reading a fucking RFC when you're implementing a goddamn protocol so damn hard? Correctness be damned, just like the memory? If you're one of those people, kill yourself.
So yeah. I started writing my own implementations out of pure spite. Because I hated the industry so fucking much. And surprisingly, my software does tend to be lightweight and usually reasonably stable. I wonder why! Maybe it's because I care. Maybe people should care more often about their trade, rather than those filthy 6 figures. There's a reason why you're being paid that much. Writing a steaming pile of dogshit shouldn't be one of them.6 -
A new currency is emerging in our industry. It is called "blame".
Who is to blame if we don't meet the deadline?
Who is to blame if the rushed release has x bugs?
Who is to blame if nightly build breaks, because our CI-Server is an old hunk of junk and "management" didn't approve the upgrade?
Our customer blames the delay in HIS infrastructure on us, because our system requirements are too high.
Blame blame blame. This currency is the new idol of our management team. Everyone gets blamed. They manage their "blame" ledgers instead of approving the tools we need or give us reasonable deadlines. Why Lord, oh why are there SO MANY MORONS in managment? You know what, dear "managers"? FUCK YOU., FUCK YOU SO HARD YOUR MOM WON'T RECOGNIZE YOU. YOU COULDN'T POUR PISS OUT OF A BOOT WITH INSTRUCTIONS ON THE HEEL.4 -
Fucking hell! Why is it so hard to just create a simple websocket!
C#: Yeah, you should use ASP.Net with SignalR! But heres a totally undocumented mess of a lib to get it to work. J.k. Deadlock!
Rust: async while let OK((some)) = ws.create.unwrap_or_else().suckadick()
Why the fuck is Rust so fucking dense! I want one line that means one thing! If I would compress my code with gzip it would be less information dense than this!
Zig: Yeah, Its in Beta and shits semi stable. Atleast i got it to work? Nope!
I've ben fussing aound with these three Languages for more than a week now and can say: Just use an established way to webdev. Its not worth it to try and make it as simple as possible!15