Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "push hard"
-
Fucking intern.
While I was working next to her a couple weeks back, she spent half her time on social media, playing Candy Crush, or talking with her friend. She also left early almost every day.
I had given her a project to do (object crud + ui), and helped her through it. She made pretty abysmal progress in a week. I ended up finishing it for her by rewriting basically all of her code (every single line except some function names, lone `end` or `}` statements, a few var declarations, blank lines, plus a couple of comments she copied over from my code).
This week I gave her a super easy project to do. It amounts to copying four files (which I listed), rename a few things to be Y instead of X, and insert two lines of code (which I provided) to hook it up. Everything after that just works. It should have taken her ... okay, maybe a few hours because she's slow and new to the language. but it would have taken me five to ten minutes, plus five minutes of testing.
She has spent THREE FUCKING DAYS ON THIS AND SHE'S STILL NOT DONE. SHE'S BLOODY USELESS!
She has kept not pulling changes and complaining that things are broken. Despite me telling her every time I push changes that affect her work (on. my. branch. ergh!)
She keeps not reading or not understanding even the simplest of things. I feel like MojoJojo every time I talk to her because of how often I repeat myself and say the same things again and again.
Now she's extremely confused about migrations. She keeps trying to revert a drop_table migration that she just wrote so she can re-create the table differently. Instead of, you know, just reverting back to her migration that creates the table. it's one migration further.
Migrations are bloody simple. they're one-step changes to the database, run in order. if you want to make a change to something you did a few steps back, you roll back those migrations, edit your shit, and run them again. so bloody difficult!
`rails db:rollback && rails db:rollback`
Edit file
`rails db:migrate`
So. hard.
I explained this to her very simply, gave her the commands to copy/paste, ... and she still can't figure it out. She's fucking useless.
It took me ten minutes to walk her though it on a screen share. TEN FREAKING MINUTES.
She hasn't finished a damned fucking thing in three weeks. She's also taking interview calls while working on this, so I know she totally doesn't care.
... Just.
Fucking hell.
USELESS FUCKING PEOPLE!35 -
You know who sucks at developing APIs?
Facebook.
I mean, how are so high paid guys with so great ideas manage to come up with apis THAT shitty?
Let's have a look. They took MVC and invented flux. It was so complicated that there were so many overhyped articles that stated "Flux is just X", "Flux is just Y", and exactly when Redux comes to the stage, flux is forgotten. Nobody uses it anymore.
They took declarative cursors and created Relay, but again, Apollo GraphQL comes and relay just goes away. When i tried just to get started with relay, it seemed so complicated that i just closed the tab. I mean, i get the idea, it's simple yet brilliant, but the api...
Immutable.js. Shitload of fuck. Explain WHY should i mess with shit like getIn(path: Iterable<string | number>): any and class List<T> { push(value: T): this }? Clojurescript offers Om, the React wrapper that works about three times faster! How is it even possible? Clojure's immutable data structures! They're even opensourced as standalone library, Mori js, and api is great! Just use it! Why reinvent the wheel?
It seems like when i just need to develop a simple react app, i should configure webpack (huge fuckload of work by itself) to get hot reload, modern es and jsx to work, then add redux, redux-saga, redux-thunk, react-redux and immutable.js, and if i just want my simple component to communicate with state, i need to define a component, a container, fucking mapStateToProps and mapDispatchToProps, and that's all just for "hello world" to pop out. And make sure you didn't forget to type that this.handler = this.handler.bind(this) for every handler function. Or use ev closure fucked up hack that requires just a bit more webpack tweaks. We haven't even started to communicate to the server! Fuck!
I bet there is savage ass overengineer sitting there at facebook, and he of course knows everything about how good api should look, and he also has huge ass ego and he just allowed to ban everything that he doesn't like. And he just bans everything with good simple api because it "isn't flexible enough".
"React is heavier than preact because we offer isomorphic multiple rendering targets", oh, how hard want i to slap your face, you fuckface. You know what i offered your mom and she agreed?
They even created create-react-app, but state management is still up to you. And react-boierplate is just too complicated.
When i need web app, i type "lein new re-frame", then "lein dev", and boom, live reload server started. No config. Every action is just (dispatch) away, works from any component. State subscription? (subscribe). Isolated side-effects? (reg-fx). Organize files as you want. File size? Around 30k, maybe 60 if you use some clojure libs.
If you don't care about massive market support, just use hyperapp. It's way simpler.
Dear developers, PLEASE, don't forget about api. Take it serious, it's very important. You may even design api first, and only then implement the actual logic. That's even better.
And facebook, sincerelly,
Fuck you.17 -
Navy story time, and this one is lengthy.
As a Lieutenant Jr. I served for a year on a large (>100m) ship, with the duties of assistant navigation officer, and of course, unofficial computer guy. When I first entered the ship (carrying my trusty laptop), I had to wait for 2 hours at the officer's wardroom... where I noticed an ethernet plug. After 15 minutes of waiting, I got bored. Like, really bored. What on TCP/IP could possibly go wrong?
So, scanning the network it is. Besides the usual security holes I came to expect in ""military secure networks"" (Windows XP SP2 unpatched and Windows 2003 Servers, also unpatched) I came along a variety of interesting computers with interesting things... that I cannot name. The aggressive scan also crashed the SMB service on the server causing no end of cute reactions, until I restarted it remotely.
But me and my big mouth... I actually talked about it with the ship's CO and the electronics officer, and promptly got the unofficial duty of computer guy, aka helldesk, technical support and I-try-to-explain-you-that-it-is-impossible-given-my-resources guy. I seriously think that this was their punishment for me messing around. At one time I received a call, that a certain PC was disconnected. I repeatedly told them to look if the ethernet cable was on. "Yes, of course it's on, I am not an idiot." (yea, right)
So I went to that room, 4 decks down and 3 sections aft. Just to push in the half-popped out ethernet jack. I would swear it was on purpose, but reality showed me I was wrong, oh so dead wrong.
For the full year of my commission, I kept pestering the CO to assign me with an assistant to teach them, and to give approval for some serious upgrades, patching and documenting. No good.
I set up some little things to get them interested, like some NMEA relays and installed navigation software on certain computers, re-enabled the server's webmail and patched the server itself, tried to clean the malware (aka. Sisyphus' rock), and tried to enforce a security policy. I also tried to convince the CO to install a document management system, to his utter horror and refusal (he was the hard copy type, as were most officers in the ship). I gave up on almost all besides the assistant thing, because I knew that once I left, everything would go to the high-entropy status of carrying papers around, but the CO kept telling me that would be unnecessary.
"You'll always be our man, you'll fix it (sic)".
What could go wrong?
I got my transfer with 1 week's notice. Panic struck. The CO was... well, he was less shocked than I expected, but still shocked (I learned later that he knew beforehand, but decided not to tell anybody anything). So came the most rediculous request of all:
To put down, within 1 A4 sheet, and in simple instructions, the things one had to do in order to fulfil the duties of the computer guy.
I. SHIT. YOU. NOT.
My answer:
"What I can do is write: 'Please read the following:', followed by the list of books one must read in order to get some introductory understanding of network and server management, with most accompanying skills."
I was so glad I got out of that hellhole.6 -
!dev
!!personal
!!abuse
I'm a victim of rather severe child abuse, both physical and mental. I've cut my mother out of my life on several occasions, and disowned her husband on father's day a few years ago. Whenever they're in my life they make things slowly but significantly worse.
They'd been using my previous hard times to push their way into my life again, and are now trying to buy their way in -- this time not into my life, but into my 2yo son's life.
I've done everything I could to keep his existence from them. I hid pregnancy from them, dropped any mew mannerisms and cute vocabulary when speaking to them, never let them see toys or hear sounds if I needed to call them, hid the carseat, etc. I did a perfect job. Out of necessity I've been hiding my life from them since I was 13, and I've never done better than this.
But they knew his name, sex, and age. This means they went digging, and a bloody lot. There is literally no public info relating him to me, and nobody that knows us would tell them, either -- they all know and understand.
For years I've refused to tell these people where I lived, too. We've been here for over five years, and three years ago they just randomly showed up at our door. I never gave them an address, and the house isn't in my name. I never had any privacy when I lived with them, either -- literally not even in the bathroom -- but now we have our own house and they still randomly intrude? asldhflakshdf
But. This Christmas Eve, we got two large boxes (fruit flats) stacked full of presents from them. A third for me, a third for my girlfriend, and a third for my 2yo. Name tags and all.
Why can't they just leave us alone? On Christmas of all holidays? Why do they have to ruin everything? Why can't they just go away?
I've made things abundantly clear, and they just. won't. stop. I feel so angry and exasperated and helpless and trapped. I went from listening to "die in a fire" to crying helplessly on the stairs. All I want is to be left alone and not harassed and blackmailed and manipulated and guilted and given expired food as "gifts."
and before you ever even think to defend them, please re-read my first three sentences.
Just.
Merry fucking Christmas.rant merry fucking christmas all i want is to be left alone child abuse i'm just done. personal why is that so much to ask?42 -
Lads, I will be real with you: some of you show absolute contempt to the actual academic study of the field.
In a previous rant from another ranter it was thrown up and about the question for finding a binary search implementation.
Asking a senior in the field of software engineering and computer science such question should be a simple answer, specifically depending on the type of job application in question. Specially if you are applying as a SENIOR.
I am tired of this strange self-learner mentality that those that have a degree or a deep grasp of these fundamental concepts are somewhat beneath you because you learned to push out a website using the New Boston tutorials on youtube. FOR every field THAT MATTERS a license or degree is hold in high regards.
"Oh I didn't go to school, shit is for suckers, but I learned how to chop people up and kinda fix it from some tutorials on youtube" <---- try that for a medical position.
"Nah it's cool, I can fix your breaks, learned how to do it by reading blogs on the internet" <--- maintenance shop
"Sure can write the controller processing code for that boing plane! Just got done with a low level tutorial on some websites! what can go wrong!"
(The same goes for military devices which in the past have actually killed mfkers in the U.S)
Just recently a series of people were sent to jail because of a bug in software. Industries NEED to make sure a mfker has aaaall of the bells and whistles needed for running and creating software.
During my masters degree, it fucking FASCINATED me how many mfkers were absolutely completely NEW to the concept of testing code, some of them with years in the field.
And I know what you are thinking "fuck you, I am fucking awesome" <--- I AM SURE YOU BLOODY WELL ARE but we live in a planet with billions of people and millions of them have fallen through the cracks into software related positions as well as complete degrees, the degree at LEAST has a SPECTACULAR barrier of entry during that intro to Algos and DS that a lot of bitches fail.
NOTE: NOT knowing the ABSTRACTIONS over the tools that we use WILL eventually bite you in the ASS because you do not fucking KNOW how these are implemented internally.
Why do you think compiler designers, kernel designers and embedded developers make the BANK they made? Because they don't know memory efficient ways of deploying a product with minimal overhead without proper data structures and algorithmic thinking? NOT EVERYTHING IS SHITTY WEB DEVELOPMENT
SO, if a mfker talks shit about a so called SENIOR for not knowing that the first mamase mamasa bloody simple as shit algorithm THROWN at you in the first 10 pages of an algo and ds book, then y'all should be offended at the mkfer saying that he is a SENIOR, because these SENIORS are the same mfkers that try to at one point in time teach other people.
These SENIORS are the same mfkers that left me a FUCKING HORRIBLE AND USELESS MESS OF SPAGHETTI CODE
Specially to most PHP developers (my main area) y'all would have been well motherfucking served in learning how not to forLoop the fuck out of tables consisting of over 50k interconnected records, WHAT THE FUCK
"LeaRniNG tHiS iS noT neeDed!!" yes IT fucking IS
being able to code a binary search (in that example) from scratch lets me know fucking EXACTLY how well your thought process is when facing a hard challenge, knowing the basemotherfucking case of a LinkedList will damn well make you understand WHAT is going on with your abstractions as to not fucking violate memory constraints, this-shit-is-important.
So, will your royal majesties at least for the sake of completeness look into a couple of very well made youtube or book tutorials concerning the topic?
You can code an entire website, fine as shit, you will get tested by my ass in terms of security and best practices, run these questions now, and it very motherfucking well be as efficient as I think it should be(I HIRE, NOT YOU, or your fucking blog posts concerning how much MY degree was not needed, oh and btw, MY degree is what made sure I was able to make SUCH decissions)
This will make a loooooooot of mfkers salty, don't worry, I will still accept you as an interview candidate, but if you think you are good enough without a degree, or better than me (has happened, told that to my face by a candidate) then get fucking ready to receive a question concerning: BASIC FUCKING COMPUTER SCIENCE TOPICS
* gays away into the night53 -
Doot doot.
My day: Eight lines of refactoring around a 10-character fix for a minor production issue. Some tests. Lots of bloody phone calls and conference calls filled with me laughing and getting talked over. Why? Read on.
My boss's day: Trying very very hard to pin random shit on me (and failing because I'm awesome and fuck him). Six hours of drama and freaking out and chewing and yelling that the whole system is broken because of that minor issue. No reading, lots of misunderstanding, lots of panic. Three-way called me specifically to bitch out another coworker in front of me. (Coworker wasn't really in the wrong.) Called a contractor to his house for testing. Finally learned that everything works perfectly in QA (duh, I fixed it hours ago). Desperately waited for me to push to prod. Didn't care enough to do production tests afterwards.
My day afterwards: hey, this Cloudinary transform feature sounds fun! Oh look, I'm done already. Boo. Ask boss for update. Tests still aren't finished. Okay, whatever. Time for bed.
what a joke.
Oh, I talked to the accountant after all of this bullshit happened. Apparently everyone that has quit in the last six years has done so specifically because of the boss. Every. single. person.
I told him it was going to happen again.
I also told him the boss is a druggie with a taste for psychedelics. (It came up in conversation. Absolutely true, too.) It's hilarious because the company lawyer is the accountant's brother.
So stupid.18 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Wife: commit, and come to bed..
Me:
> git commit -m "wife wants me to go to bed"
> git push origin master -f16 -
Coworker: You've merged the wrong PR. It is broken.
Me: is it marked as broken? Is there a mail marking it as broken?
Coworker: yes. I wrote something in the chat.
Me: 🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕
I do NOT read and click every brain fart from the chat. I had the PR (as reviewer and dependent developer) open on my desk and waited for the coworker to fix his merge conflicts.
OK then, try to revert. Git reset hard. Push -f. Policy does not allow master modification. 🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕🖕
Fuck this company. Fuck the policies. Fuck them all with a chainsaw. Forced me to work 2 weeks more. 17.04 should have been my last day at this circus. Let 3 other guys go to vacation while I have fix their management's mistakes. Fuck. You. All. Eat shit and suffocate in piss.8 -
A while ago I had all these ideas for side projects, and I really wanted to create something. However, every time I started to work on it I usually started the IDE, wrote a couple of lines, and quickly lost motivation. This kept going for a while. I just wasn't feeling it and when there is little or no (visible) progress it can be hard for me to continue working.
Then one day I wanted to push through it, and decided to set a rule: I have to make at least one commit per day, no matter how small.
So I (re)started work on a side project, and by the time I was satisfied with what I'd want to commit I've made enough progress to want to continue working on it. This quickly turned minutes of coding into (late) hours. Now I have a couple of side projects going which are progressing quite nicely, and I feel motivated to work on them again.
I don't know if there are any other people on here who've had this feeling, but if you did maybe this'll help you :) I'd love to hear from you how you keep yourself motivated!10 -
My coworker requested I add a bunch of tracking to our product.
I've previously tried explaining to him (and honestly the rest of the company) about privacy issues stemming from tracking, such as by their beloved Venmo. Venmo tracks absolutely fking everything you give it access to, from location data to your entire facebook, twitter, foursquare, etc. feeds, and sells ALL of it to third parties. It's scary. but! this guy simply does not understand, and/or does not care, and marches right on into all the surveillance, loudly singing the song of convenience to all who'll listen. (Nobody else in the company cared, either. :/)
ugh.
Anyway, I'm conflicted.
I have to install some tracking, but I can probably come up with an excuse to cut most of it out and gimp their surveillance. It'll still be useful to us, but it'll limit the amount of data the tracking company can sell to third parties.
but they'll push this guy pretty hard on it, and he's as technically-inclined as a smudged glass of warm, stale beer. "Better for your conversion!" they'll say. "How much tracking do you want?" he'll reply. "@ashkin, why can't you do this right now? What else do you need to make this happen?" he'll firmly inquire. and so I'll be forced to make it happen...
ergh13 -
Story time. My first story ever on devRant.
To my ex-company that I bear for a long time... I joined my ex-company 3 years ago. My ex-company assigned me and one girl teammate to start working on a brand new big web project (big one - two members - really?)
My teammate quitted later, I have to work alone after then. I asked if someone can join this project, but manager said other people are busy. Yea, they are fucking busy reading MANGA shit everyday... Oops, I saw it because whenever I about to leave my damn chair, they begin chanting some hotkey magic and begin doing "poker face" like "I'm doing some serious shit right here".. FUCK MY CO-WORKERS!
My manager didn't know shit about software development, and keep barking about Agile, Waterfall and AI shit... He didn't even fucking know what this project should look like, he keep searching the internet for similar functions and gave me screenshots, or sometimes they even hold a meeting of a bunch of random non-related guys who even not working on the project, to discuss about requirements, which last for endless hours... FUCK MY MANAGER!
I was the one in charge for everything. I design the architecture, database, then I fucking implement my own designed architect myself, and I fucking test functions that I fucking implemented myself based on my fucking design. I was so tried, I don't know what the fuck I am working on. Requirement changes everyday. My beautiful architecture began to falling off. I was so tired and began use hack fixes here and there many places in the project. I knew it's bad, but I just don't have time to carefully reconsider it. My test case began becoming useless as requirements changed. My manager's boss push him to finish this project. He began to test, he start complaining about bug here and there, blaming me about why functions are broken, and why it not work as he expected (which he didn't even tell my how he expected). ... I'm not junior developer, but this one-man project is so overwhelmed for me... FUCK MY JOB!
At this time, I have already work this project for almost 2.5 years. I felt very upset. I also feel disappointed about myself, although I know that is not all my entire faults. The feeling that you was given a job, but you can not get it done, I feel like a fucking LOSER. I really wanted to quit and run away from this shithole. But on the other hand I also want to finish this project before I quit. My mind mixed. I'm a hard-worker. I keep pushing myself, but the workplace is so toxic, I can feel it eating up my motivation everyday. I start questioning myself: "Is the job I am doing important?", "If this is really important project, didn't they should assign more members?", I feel so lonely at work... MY MIND IS FUCKED UP!
Finally, after a couple months of stress. I made up my mind that no way this project is gonna end within my lifespan. I decide to quit. Although my contract pointed that I only need to tell one month in advance. I gave my manager 3 months to find new members for project. I did handle over what I know, documents, and my fucked up ultra complexity source code with many small sub-systems which I did all by myself.
Well, I am with a new employer right now. They are good company. At least, my new manager do know how to manage things. My co-workers are energy and hard-working. I am put to fight on the frontline as usual (because of my "Senior position"). But I can feel my team, they got my back. My loneliness is now gone. Job is still hard, but I know for sure that I'm doing things on purpose, I am doing something useful. And to me that is the greatest rewards and keep me motivative! From now, will be the beginning for first page of my new story...
Thanks for reading ...12 -
"Well, how hard could it be to do it in this impossible deadline?"
Well ... HOW ABOUT I STICK A LAMP POST UP YOUR ASS? HOW HARD COULD IT BE? YOU JUST STAY STILL AND I PUSH HARD ENOUGH, RIGHT?!12 -
I hate my job. I am furious at my colleagues.
Last November I asked my colleagues (A and B) to help me learn to use something, let's call it Tool. They said okay and set a date for training. Next week they said that they had too much work to do so we'll have to postpone. And the next date was also postponed and the next one too, and so on.
Three months in, colleague C kept dicking around and being a complete jackass telling me that he refused to work with me for I don't use the Tool.
Not like I didn't want to learn to use the Tool, I simply couldn't. I have long before googled how to use the Tool but in no way can Google ever tell me about our own company workflow, our methods, habits and such.
I was furious, but I am also a the most fucking patient person ever so I let it slide. The Tool wasn't actually needed that much to do my job anyways. And I have known for a while that colleague C needed to push someone under him to feel good about himself.
A few more dates had been set but got cancelled for reasons.
Meanwhile both A and B started to look down on me for not knowing how to use the Tool. I started to feel depressed.
Today B held a "workshop" about the Tool. It took two hours. He was not prepared, had a hangover and generally had a hard time concentrating.
He used aliases that he set up only for himself to show the usage of the Tool instead of commands that a beginner would understand (or google). He kept mumbling and I hsd trouble understanding him. His lecture lacked direction and was all over the place.
I am devastated and furious. I had been waiting since November for this training and when the time actually came he pulled something out of his ass and called it a workshop.
I didn't even get answers for my questions.
Now I feel that I am actually in a worse position than before because while I still cannot use the Tool, they can tell me that there was a workshop and I should've paid closer attention.
I want to quit so bad.23 -
Code with syntax coloring fascinates my young nephew, so after I commit and push, I let him do his thing then later I do a
git reset HEAD --hard2 -
I started to get super pissed off to people saying you don’t need a college, masters degree to get an IT job. Instead go and gain practical knowledge, showing your practical certificates projects is much better than a having a degree that doesn’t prove if you can do the job or not.
Is a degree absolutely necessary to get a job? No, I agree on that. You can tear yourself apart to be known make projects loads of people contribute in GitHub spend maybe years on practicing and creating stuff for your portfolio..
But excuse me what do you think people do in college studying degrees? Are we getting it from the shop in the corner on a Saturday?
Respect people’s achievements and titles. Especially Masters degrees push you hard, make you sweat apart from loads of courses you work at least a year on a practical project, dissertation, thesis and only pass if it is your own opinion and findings. It is not like a multiple choice exam certificate or you study watch videos for few months and create a web page.
Don’t throw shit on people’s efforts and accomplishments without knowing how it is achieved just because you don’t have it.
Yes it is not necessary. Does it make you learn? Yes! Is it practical? Yes! Does it help you get a job? Hell yes! Why most companies look for degrees? Do you think they might know what it takes to get it and the skills and knowledge you gain?
Don’t come and say in IT degrees not worth it without even knowing how to draw UML. Without knowing IT management you go and be a leader later on, no clue on how to manage projects, people and soft skills sweeping the floor.
It doesn’t matter if you are a YouTube celebrity or a president. What does the title say? “Master” now go, respect and digest it! Don’t be a sour loser.
Ooh I am fierce today and not done yet12 -
//
// devRant unofficial UWP update (v2.0.0-beta7)
//
After "Active Discussions" (implemented in v2.0.0-beta5), it was time to implement the last missing app section, "Collabs".
This is the biggest update since the start of the public beta, over 100 changes (new features, improvements, fixes).
Changelog (v2.0.0-beta7):
- Support for Collabs
- Notifs Tabs
- & more... read the entire changelog here: https://jakubsteplowski.com/en/...
Microsoft Store: https://microsoft.com/store/apps/...
I'm really happy to announce that the unofficial UWP client has now 100% of the features available on the official Android and iOS apps (if we don't count Push Notifs 😝 but they will arrive soon too).
It took several months of hard work, but I made it... it's here, it reached the level I wanted to reach since the beginning of this project (May 2016) (if we don't count Push Notifs).
I did it a lot of times, but I think they deserve it everytime, I would like to thank all the people who made this possible, all the active users, who opened issues, suggested features, or just used my app and had fun, posted positives (and negatives, motherfuckers, just kidding, maybe) reviews on Microsoft Store etc.
The entire community who made me want to do this project.
You're amazing guys!
Of course this is not the end of this project, I want to bring the app out of the beta and support it until I will be able to do it, releasing updates almost simultaneously with @dfox and @trogus.
Planned to be done:
- Support for Anniversary Update
- Push Notifs
- Custom Themes
- Close the 15+ issues (features requests, fixes) on the issue tracker on GitHub
- Ranti by @Alice: Your devRant Assistant <- I really hope it will become a thing :)
- Your future suggestions -> post them here: https://github.com/JakubSteplowski/...
Thanks for the attention,
Good ranting!10 -
Okay guys, this is it!
Today was my final day at my current employer. I am on vacation next week, and will return to my previous employer on January the 2nd.
So I am going back to full time C/C++ coding on Linux. My machines will, once again, all have Gentoo Linux on them, while the servers run Debian. (Or Devuan if I can help it.)
----------------------------------------------------------------
So what have I learned in my 15 months stint as a C++ Qt5 developer on Windows 10 using Visual Studio 2017?
1. VS2017 is the best ever.
Although I am a Linux guy, I have owned all Visual C++/Studio versions since Visual C++ 6 (1999) - if only to use for cross-platform projects in a Windows VM.
2. I love Qt5, even on Windows!
And QtDesigner is a far better tool than I thought. On Linux I rarely had to design GUIs, so I was happily surprised.
3. GUI apps are always inferior to CLI.
Whenever a collegue of mine and me had worked on the same parts in the same libraries, and hit the inevitable merge conflict resolving session, we played a game: Who would push first? Him, with TortoiseGit and BeyondCompare? Or me, with MinTTY and kdiff3?
Surprise! I always won! 😁
4. Only shortly into Application Development for Windows with Visual Studio, I started to miss the fun it is to code on Linux for Linux.
No matter how much I like VS2017, I really miss Code::Blocks!
5. Big software suites (2,792 files) are interesting, but I prefer libraries and frameworks to work on.
----------------------------------------------------------------
For future reference, I'll answer a possible question I may have in the future about Windows 10: What did I use to mod/pimp it?
1. 7+ Taskbar Tweaker
https://rammichael.com/7-taskbar-tw...
2. AeroGlass
http://www.glass8.eu/
3. Classic Start (Now: Open-Shell-Menu)
https://github.com/Open-Shell/...
4. f.lux
https://justgetflux.com/
5. ImDisk
https://sourceforge.net/projects/...
6. Kate
Enhanced text editor I like a lot more than notepad++. Aaaand it has a "vim-mode". 👍
https://kate-editor.org/
7. kdiff3
Three way diff viewer, that can resolve most merge conflicts on its own. Its keyboard shortcuts (ctrl-1|2|3 ; ctrl-PgDn) let you fly through your files.
http://kdiff3.sourceforge.net/
8. Link Shell Extensions
Support hard links, symbolic links, junctions and much more right from the explorer via right-click-menu.
http://schinagl.priv.at/nt/...
9. Rainmeter
Neither as beautiful as Conky, nor as easy to configure or flexible. But it does its job.
https://www.rainmeter.net/
10 WinAeroTweaker
https://winaero.com/comment.php/...
Of course this wasn't everything. I also pimped Visual Studio quite heavily. Sam question from my future self: What did I do?
1 AStyle Extension
https://marketplace.visualstudio.com/...
2 Better Comments
Simple patche to make different comment styles look different. Like obsolete ones being showed striked through, or important ones in bold red and such stuff.
https://marketplace.visualstudio.com/...
3 CodeMaid
Open Source AddOn to clean up source code. Supports C#, C++, F#, VB, PHP, PowerShell, R, JSON, XAML, XML, ASP, HTML, CSS, LESS, SCSS, JavaScript and TypeScript.
http://www.codemaid.net/
4 Atomineer Pro Documentation
Alright, it is commercial. But there is not another tool that can keep doxygen style comments updated. Without this, you have to do it by hand.
https://www.atomineerutils.com/
5 Highlight all occurrences of selected word++
Select a word, and all similar get highlighted. VS could do this on its own, but is restricted to keywords.
https://marketplace.visualstudio.com/...
6 Hot Commands for Visual Studio
https://marketplace.visualstudio.com/...
7 Viasfora
This ingenious invention colorizes brackets (aka "Rainbow brackets") and makes their inner space visible on demand. Very useful if you have to deal with complex flows.
https://viasfora.com/
8 VSColorOutput
Come on! 2018 and Visual Studio still outputs monochromatically?
http://mike-ward.net/vscoloroutput/
That's it, folks.
----------------------------------------------------------------
No matter how much fun it will be to do full time Linux C/C++ coding, and reverse engineering of WORM file systems and proprietary containers and databases, the thing I am most looking forward to is quite mundane: I can do what the fuck I want!
Being stuck in a project? No problem, any of my own projects is just a 'git clone' away. (Or fetch/pull more likely... 😜)
Here I am leaving a place where gitlab.com, github.com and sourceforge.net are blocked.
But I will also miss my collegues here. I know it.
Well, part of the game I guess?7 -
Somewhere in a lonely break room
There's a guy starting to realize that eternal hell has been unleashed unto him.
It's two a.m.
It's two a.m.
The boss has gone
I'm sitting here waitin'
This desktop's slow
I am getting tired of fixin' all my coworkers' problems
Yeah there's a bug on the loose
Errors in the code
This is unreadable
Rubber ducky can't help
I cannot debug, my whole life spins into a frenzy
Help I'm slippin' into the programming zone
Git push to the prod
Set up a repo
My hard drive just crashed
All my code is gone
Where am I to go
Now that I've broke my distro
Soon you will come to know
When you need Stack Overflow
Soon you will come to know
When you need Stack Overflow
I'm falling down a spiral
Solution unkown
Disgusting legacy, ugly code
Can't get no connection
Can't get through to commit
Well the night weights heavy
On my confused mind
Where's the error on this line
When the CEO comes
He knows damn well
To keep his distance
And he says
Help I'm slippin' into the programming zone
Git push to the prod
Set up a repo
My hard drive just crashed
All my code is gone
Where am I to go
Now that I've broke my distro
Soon you will come to know
When you need Stack Overflow
Soon you will come to know
When you need Stack Overflow
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow
When you need Stack Overflow, a ha
When you need Stack Overflow4 -
OH MY FUCKING GOD!!!!
HOW CAN SOMEONE BE A FREELANCER/WEB DEV AND TYPE SO FUCKING SLOW AND HAVE TROUBLE WITH FUCKING LETTERS ALL THE TIME?!
I'm gonna push this mother fucker so hard that he will learn not to "lie" in an interview never again and become a fucking dev.5 -
My teammate push 2gbs worth of CSV files into our repo.
He also merged all the other branches so, it's kinda hard to revert back without reworking a lot of stuff.3 -
Me: How can I delete pushed commits from origin?
Colleague: Just do git reset --hard and then git push -f
Me: But this is dangerous
Colleague: Wait, I'll do it myself
Colleague: Done
Me: But nothing happened
Colleague: Fuck. I just removed all changes on my own branch2 -
I was reading the post made by another ranter in which he was basically asked to lower the complexity of an automation script he wrote in place of something everyone else could understand. Another dev commented that more than likely it had to do with the company being worried that ranter_1 would leave and there would be no one capable of maintaining the code.
I understood this completely from both perspectives. It makes me worry how real this sometimes is. We don't get to implement X tech stack because people are worried that no one would be able to maintain Y project in the event of someone leaving. But fuck man, sometimes one wants to expand more and do things differently.
At work I came to find out that the main reason why the entirety of our stack is built in PHP is because the first dev hired into the web tech department(which is only about 12 years old in my institution) only knew PHP. The other part that deals with Java is due to some extensions to some third party applications that we have, Java knowledge (more specifically Spring and Grails) is used for those, the rest is mostly PHP. And while I LOVE PHP and don't really have anything against the language I really wonder what would it be of the institution had we've had a developer with a more....esoteric taste. Clojure, Elixir, Haskell, F# and many others. These are languages and tech stacks that bring such a forward way of thinking into the way we build things.
On the other hand, I understand if the talent pool for each of these stacks is somewhat hard to come up with, but if we don't push for certain items then they will never grow.
The other week I got scolded by the lead dev from the web tech department for using Clojure to create the demo of an application. He said that the project will most likely fall into his hands and he does not know the stack. I calmly mentioned that I would gladly take care of it if given the opportunity as well as to explain to him how the code works and provide training to everyone for it :D I also (in all of my greatness) built the same program for him in PHP. Now, I outrank him :P so the scold bounced out of the window, plus he is a friend, but the fact remains that we reached the situation in which the performance as well as the benefits of one stack were shadowed by the fact that it holds a more esoteric place in the development community.
In the end I am happy to provide the PHP codebase to him. The head of the department + my boss were already impressed with the fact that I was able to build the product in a small amount of time using a potent tech stack, they know where my abilities are and what I can do. That to me was all that matters, even if the project gets shelved, the fact that I was able to use it at work for something means a lot to me.
That and I got permission to use it for the things that will happen with my new department + the collective interest of everyone in paying me to give support even if I ever leave the institution.
Win.13 -
Worst exp. on a collab/group project?
Had a few, here is one.
Worked with a dev team (of two devs) in Norway to begin collaboration on providing a portal into our system (placing orders, retrieving customer info, inventory control, etc)
They spoke very good English, but motivation was the problem. Start the day around 10:00AM...take a two hour lunch...ended the day at, if I was lucky, 4:00PM (relative to Norway time). Response time to questions took days, sometimes weeks. We used Skype, which helped, but everything was "Yea...I'll do that tomorrow...waiting on X....I have a wedding to go to, so I'll finish my part next week."
I didn't care so much, I had other projects to do, but the stakeholders pounded me almost everyday demanding a progress report (why aren't you done yet...etc..etc.)
The badgering got so bad I told the project owner (a VP) if he wanted this project done by the end of the year, the company would have to fly me to Norway so I personally push things along.
When real money was on the line, he decided patience was warranted.
A 3 month project turned into 9, and during a phone meeting with the CEO in December
O: "Thanks guys, this project is going great. We'll talk again in February. Bye."
PM: "Whoa...what! February!"
<sounding puzzled>
O: "Um..yes? It's Christmas time. Don't you Americans take off for Christmas?"
PM: "Yes, but not until Christmas. Its only December 12th. Your taking the whole month of December and January for Christmas?"
O:"Yes, of course. You Americans work too hard. You should come over here and see how we celebrate. Takes about a month so we can ease back into the flow of things."
<Jack is the VP>
PM: "Jack wanted this project completed by the end of the year, that is what everyone agreed to."
O:"Yes, I suppose, but my plane is waiting on me. Not to worry, everything will be fine."
<ceo hangs up>
PM: "Oh shit..oh shit..oh shit. What are you going to do!?"
Me: "Me!?..not a darn thing. Better go talk with Jeff."
<Jeff is the VP>
J: "This is unacceptable. You promised this project would only take a few months. I told you there would be consequences for not meeting the deadline."
PM:"But..but...its not our fault."
J: "I don't care about fault. I care about responsibility. I've never had to fire anyone for not meeting a deadline, but .."
Me: "Jeff, they are in Norway and no one is working this project for the next two months. You've known for months about them dragging their asses on this project. We're ready to go. Services have been tested and deployed. Accounting has all the payment routing ready. Only piece missing is theirs."
J: "Oh. OK. Great job guys. I guess we'll delay this project until February."
<leave the office>
PM: "Holy shit I'm glad you were there. I thought I was fired."
Me: "Yea, and that prick would have done it not giving a crap that it's Christmas."
<fast forward to Feb>
O: "Our service provider fell through, so I'm hosting with another company. You guys know PHP? Perl? I don't know what they called it, but it sounded so cool I bought the company."
PM: "You bought what? Are we still working with Z and B?"
O:"Yea, sort of. How's your German? New guy only speaks German."
PM: "Um, uh... no one here speaks German"
O:"Not to worry, I speak German, French, and Italian. I'll be your translator."
PM: "What? French and Italian?"
O: "On my trip to France I connected with a importer who then got me in touch with international shipper in Italy. I flew over there and met a couple really smart guys than can help us out. My new guy only speaks German, J only speaks French, and R speaks Italian, Russian, and a little English. Not to worry, I'm full time on this project. You have my full attention."
We believe the CEO has/had some serious mental issues, including some ADD. He bailed within the first month (took another vacation to Sweden to do some fishing) and left me using Google Translate to coordinate the project. Luckily, by the end, the Norwegian company hired a contractor from England who spoke German and hobbled together the final integration.3 -
When I was at university in my last semester of my bachelor's, I was doing a game programming paper and our last assignment was to group up and make a game. So I go with one of the guys I know and this other dude since his previous game was really neat. Then two randoms joined that from my first impressions of their games wasn't much at all (one guy made four buttons click and called it a game in Java when we had to make games in c++ and the other guy used an example game and semi modded it.
Anyways we get to brain storming, totally waste too much time getting organised because the guy that volunteered (4 buttons guy) was slow to getting things sorted. Eventually we get to making the game and 4 buttons guy hasn't learnt how to use git, I then end up spending 3 hours over Skype explaining to him how to do this. He eventually learns how to do things and then volunteers to do the AI for the game, after about a week (this assignment is only 5 weeks long) he hasn't shown any progress, we eventually get to our 3rd week milestone no progress from him and the modder, with only three classes left we ask them both to get stuff done before a set deadline (modder wanted to do monsters and help 4 buttons with AI) both agreed and deadline rolls up and no work is shown at all, modest shows up extremely late and shows little work.
4 buttons guy leaves us a Skype message the day of our 2nd to last class,, saying he dropped the paper...
Modder did do some work but he failed to read all the documentation I left him (the game was a 2d multiplayer crafting game, I worked so hard to make a 2d map system with a world camera) he failed to read everything and his monsters used local coordinates and were stuck on screen!
With about a week left and not too many group meetings left we meet up to try and get stuff done, modder does nothing to help, the multiplayer is working my friend has done the crafting and weapon system and the map stuff is working out well. We're missing AI and combat, with our last few hours left we push to get as much stuff done, I somehow get stuck doing monster art, AI is done by the other two and I try to getting some of the combat and building done.
In the end we completely commented all of modders work because well it made us look bad lol. He later went to complain to my free claiming I did it and was a douchebag for doing so. We had to submit our developer logs and the three of us wrote about how shitty it was to deal with these two.
We tried out best not to isolate ourselves from them and definitely tried to help but we were swamped with our other assignments and what we had to work on.
In the end leaving and not helping right when the deadline is close was what I call the most shittiest thing team mates can do, I think sticking together even if we were to fail was at least a lot better.3 -
Always back up your data.
I came to my computer earlier today to find it on my Linux login screen. This could only mean one thing: something went horribly wrong.
Let me explain.
I have my BIOS set up to boot into Windows automatically. The exception is a reboot or something horrible happens and the computer crashes. Then, it boots me into Linux. Due to a hardware issue I never looked into, I have to be present to push F1 to allow the computer to start. The fact that it rebooted successfully, without me present, into *Linux*, could only mean one thing:
My primary hard drive died and was no longer bootable.
The warning was the BIOS telling me the drive was likely to fail ("Device Error" doesn't really tell me anything to be fair).
The massive wave of panic hit me.
I rebooted in hopes of reviving the drive. No dice.
I rebooted again. The drive appeared.
Let's see how much data I can recover from it before I can no longer mount it. Hopefully, I can come out of this relatively unscathed.
The drive in question is a 10 year old 1.5 TB Seagate drive that came with the computer. It served me well.
Press F to pay respects I guess.
On the bright side, I'll be getting an SSD as a replacement (probably a Samsung EVO).8 -
Disclaimer: This is not a Windows hate rant as this problem has been solved by Microsoft(partially).
I went to a hackathon last year at an engineering college. It was not such grand hackathon as people have in USA or Europe. So I entered in this competition trying to develop a medical app which asks the user detail about his/her problems then asks questions to match the symptoms of diseases. So me and a guy(who isn't a coder) tried to develop that app. He provided the data of diseases, I tried to develop kind of AI app with those data but found that job too hard for one day hackathon. So I wrote an email for api medic for their api which I was going to use. I then coded continuously for 4 hours in Android studio for the android app. The event manager told us late in the day that repo had been made for the hackathon and we must push our codes before 12 that night. The event manager provided the repo very late that day maybe around 6. I did a big mistake not creating my own repo on github to save every code I had written from time to time.(After this e vent whatever I code I save it in a repo). I was running Windows 10 on one of my laptop and ubuntu on my another. Due to some divine badluck I was using my Windows 10 laptop on that hackathon. So around maybe 10 I was about to wrap up the day push the code to repo. I went to getself a cup of coffee and returned to find lo and behold fucking BSOD. I was fucked, it was my first hackathon so made another misatake of using emulator rather than my android phone. My Android phone was not responding good that day so I used the android emulator.
From that day on I do three things:
1. Always push my projects to github repo.
2. Use android phone after running some minor tests on emulator.
3. Never use windows(Happy arch user till eternity.)
You might be thinking even though BSOD, it can be recovered. But didn't happen in my case, the windows revert back to the time I had just upgraded from Windows 8.1 to 10.3 -
Lesson I learnt the hard way today: ticket every fucking task (including admin) to:
A. Cover your arse (if the tickets are not ready because they haven't given us enough information, push back on it before committing too much effort to doing it)
B. Better deliverable (what you output will probably be better quality because you worked out the requirements upfront + you know the audience)
C. You have something to show management when they want to try and overwork you some more4 -
git push origin stupid-long-feature-name
git pull origin develop
*Checks through all changes. No major conflicts. Accepts changes.*
npm test
*4 failing tests, none of them in pieces that I touched for my feature.*
*That's funny. QA was loaded from the develop branch, and everything works.*
*Actual data has dates from today. Expected data has dates from a week ago.*
*examines tests*
Why are all these expected dates hard-coded‽
tl;dr The external development team committed 4 tests that would only ever pass on the day they were written.5 -
trying to do anything on the PS2 is almost fucking impossible
i imagine a board meeting where they were designing the hardware
"how can we make this insanely hard to use?"
"let's make decentralized partition definitions, allow fragmenting of entire partitions, and require all partitions to be rounded to 4MB. If you delete a partition, don't wipe the partition out, just rename it to "_empty" and the system will do it for you, except it actually won't because fuck you"
"let's require 1-bit serial registers to be used for memory card access and make sure you can't take more than 8 CPU cycles to push each bit or it'll trash the memory card"
"let's make the network module run on a 3-bit serial register and when initialized it halves the available memory but only after 8 seconds of activity"
"let's require the system to load feature modules called "IOPs" and require the software to declare which of the 256 possible slots it wants to use (max of 8 IOPs) then insert stubs into those. Any other IOP you call will hang the system and probably corrupt the HDD. You also have to overwrite the stubbed IOPs with your own but only if you can have the stubs chainload the other IOPs on top of themselves"
"let's require you to write to the controller registers to update them, but you have to write the other controller's last-polled state or the controller IOP will hang"
of course this couldn't make sense, it's
s s s s
o o o o
n n n n
y y y y4 -
I propose that the study of Rust and therefore the application of said programming language and all of the technology that compromises it should be made because the language is actually really fucking good. Reading and studying how it manages to manipulate and otherwise use memory without a garbage collector is something to be admired, illuminating in its own accord.
BUT going for it because it is a "beTter C++" should not constitute a basis for it's study.
Let me expand through anecdotal evidence, which is really not to be taken seriously, but at the same time what I am using for my reasoning behind this, please feel free to correct me if I am wrong, for I am a software engineer yes, I do have academic training through a B.S in Computer Science yes, BUT my professional life has been solely dedicated to web development, which admittedly I do not go on about technical details of it with you all because: I am not allowed to(1) and (2)it is better for me to bitch and shit over other petty development related details.
Anecdotal and otherwise non statistically supported evidence: I have seen many motherfuckers doing shit in both C and C++ that ADMIT not covering their mistakes through the use of a debugger. Mostly because (A) using a debugger and proper IDE is for pendejos and debugging is for putos GDB is too hard and the VS IDE is waaaaaa "I onlLy NeeD Vim" and (B) "If an error would have registered then it would not have compiled no?", thus giving me the idea that the most common occurrences of issues through the use of the C father/son languages come from user error, non formal training in the language and a nice cusp of "fuck it it runs" while leaving all sorts of issues that come from manipulating the realm of the Gods "memory".
EVERY manual, book, coming all the way back to the K&C book talks about memory and the way in which developers of these 2 languages are able to manipulate and work on it. EVERY new standard of the ISO implementation of these languages deals, through community effort or standard documentation about the new items excised through features concerning MODERN (meaning, no, the shit you learned 20 years ago won't fucking cut it) will not cut it.
THUS if your ass is not constantly checking what the scalpel of electrical/circuitry/computational representation of algorithms CONDONES in what you are doing then YOU are the fucking problem.
Rust is thus no different from the original ideas of the developers behind Go when stating that their developers are not efficient enough to deal with X language, Rust protects you, because it knows that you are a fucking moron, so the compiler, advanced, and well made as it is, will give you warnings of your own idiotic tendencies, which would not have been required have you not been.....well....a fucking idiot.
Rust is a good language, but I feel one that came out from the necessity of people writing system level software as a bunch of fucking morons.
This speaks a lot more of our academic endeavors and current documentation than anything else. But to me DEALING with the idea of adapting Rust as a better C++ should come from a different point of view.
Do I agree with Linus's point of view of C++? fuck no, I do not, he is a kernel engineer, a damn good one at that regardless of what Dr. Tanenbaum believes(ed) but not everyone writes kernels, and sometimes that everyone requires OOP and additions to the language that they use. Else I would be a fucking moron for dabbling in the dictionary of languages that I use professionally.
BUT in terms of C++ being unsafe and unsecured and a horrible alternative to Rust I personaly do not believe so. I see it as a powerful white canvas, in which you are able to paint software to the best of your ability WHICH then requires thorough scrutiny from the entire team. NOT a quick replacement for something that protects your from your own stupidity BY impending the use of what are otherwise unknown "safe" features.
To be clear: I am not diminishing Rust as the powerhouse of a language that it is, myself I am quite invested in the language. But instead do not feel the reason/need before articles claiming it as the C++ killer.
I am currently heavily invested in C++ since I am trying a lot of different things for a lot of projects, and have been able to discern multiple pain points and unsafe features. Mainly the reason for this is documentation (your mother knows C++) and tooling, ide support, debugging operations, plethora of resources come from it and I have been able to push out to my secret project a lot of good dealings. WHICH I will eventually replicate with Rust to see the main differences.
Online articles stating that one will delimit or otherwise kill the other is well....wrong to me. And not the proper approach.
Anyways, I like big tits and small waists.14 -
First day of the academic year(CS):
(some uni official) - "And remember to become a good programmer you have to become an excellent mathematician first"
(Me): Oh shit.
Little did I know...
It is a second year now. And the only course I failed is the one that he lectured.
I had no fucking idea that people like this (mad)man exist.
Almost at every lecture he was introducing at leas one topic that was way beyond our program; as he thought they were interesting and "fun".
Many teachers at the University refered to him as a very 'ambitious' man. Then I didn't blame him he truly loved his profession and wanted to share as much knowledge as possible(I thought).
But two months ago he went to far. It was a second exam(for those who failed the first one). And believe me there were a few(60 out of 160 to be exact).
Only ~30 people showed up as the rest failed to many courses and would be kicked out of the uni anyway.
He was handing out the exams when I saw that whoever gets one slowly starts turning white.
I finally got my copy and immediately I realized that the tasks are from his favorite topics, the "fun" ones. 🤦
At this point I knew that it will be extremely hard to pass. But when I was reevaluating my life choices something draw my attention.
One of the tasks had a note below it: "Homework after the exam: It is a very interesting problem just assume x instead of y and try to solve it. PS: it is a lot of fun!"
At this point I lost it.😠 I don't care how much you love math, you should always assume that not everyone loves it as much as you do. So don't push it down the throat of people who clearly don't need a degree in this subject!
Now I'm preparing for the second semester with this guy. And I have a strong feeling that it will be hell of a ride... again.😐
BTW: Sorry that the rant is so long, it's the first one I wrote, and had to share it with someone 😀18 -
I wrote a node + vue web app that consumes bing api and lets you block specific hosts with a click, and I have some thoughts I need to post somewhere.
My main motivation for this it is that the search results I've been getting with the big search engines are lacking a lot of quality. The SEO situation right now is very complex but the bottom line is that there is a lot of white hat SEO abuse.
Commercial companies are fucking up the internet very hard. Search results have become way too profit oriented thus unneutral. Personal blogs are becoming very rare. Information is losing quality and sites are losing identity. The internet is consollidating.
So, I decided to write something to help me give this situation the middle finger.
I wrote this because I consider the ability to block specific sites a basic universal right. If you were ripped off by a website or you just don't like it, then you should be able to block said site from your search results. It's not rocket science.
Google used to have this feature integrated but they removed it in 2013. They also had an extension that did this client side, but they removed it in 2018 too. We're years past the time where Google forgot their "Don't be evil" motto.
AFAIK, the only search engine on earth that lets you block sites is millionshort.com, but if you block too many sites, the performance degrades. And the company that runs it is a for profit too.
There is a third party extension that blocks sites called uBlacklist. The problem is that it only works on google. I wrote my app so as to escape google's tracking clutches, ads and their annoying products showing up in between my results.
But aside uBlacklist does the same thing as my app, including the limitation that this isn't an actual search engine, it's just filtering search results after they are generated.
This is far from ideal because filter results before the results are generated would be much more preferred.
But developing a search engine is prohibitively expensive to both index and rank pages for a single person. Which is sad, but can't do much about it.
I'm also thinking of implementing the ability promote certain sites, the opposite to blocking, so these promoted sites would get more priority within the results.
I guess I would have to move the promoted sites between all pages I fetched to the first page/s, but client side.
But this is suboptimal compared to having actual access to the rank algorithm, where you could promote sites in a smarter way, but again, I can't build a search engine by myself.
I'm using mongo to cache the results, so with a click of a button I can retrieve the results of a previous query without hitting bing. So far a couple of queries don't seem to bring much performance or space issues.
On using bing: bing is basically the only realiable API option I could find that was hobby cost worthy. Most microsoft products are usually my last choice.
Bing is giving me a 7 day free trial of their search API until I register a CC. They offer a free tier, but I'm not sure if that's only for these 7 days. Otherwise, I'm gonna need to pay like 5$.
Paying or not, having to use a CC to use this software I wrote sucks balls.
So far the usage of this app has resulted in me becoming more critical of sites and finding sites of better quality. I think overall it helps me to become a better programmer, all the while having better protection of my privacy.
One not upside is that I'm the only one curating myself, whereas I could benefit from other people that I trust own block/promote lists.
I will git push it somewhere at some point, but it does require some more work:
I would want to add a docker-compose script to make it easy to start, and I didn't write any tests unfortunately (I did use eslint for both apps, though).
The performance is not excellent (the app has not experienced blocks so far, but it does make the coolers spin after a bit) because the algorithms I wrote were very POC.
But it took me some time to write it, and I need to catch some breath.
There are other more open efforts that seem to be more ethical, but they are usually hard to use or just incomplete.
commoncrawl.org is a free index of the web. one problem I found is that it doesn't seem to index everything (for example, it doesn't seem to index the blog of a friend I know that has been writing for years and is indexed by google).
it also requires knowledge on reading warc files, which will surely require some time investment to learn.
it also seems kinda slow for responses,
it is also generated only once a month, and I would still have little idea on how to implement a pagerank algorithm, let alone code it.4 -
I'm going on vacation next week, and all I need to do before then is finish up my three tickets. Two of them are done save a code review comment that amounts to combining two migrations -- 30 seconds of work. The other amounts to some research, then including some new images and passing it off to QA.
I finish the migrations, and run the fast migration script -- should take 10 minutes. I come back half an hour later, and it's sitting there, frozen. Whatever; I'll kill it and start it again. Failure: database doesn't exist. whatever, `mysql` `create database misery;` rerun. Frozen. FINE. I'll do the proper, longer script. Recreate the db, run the script.... STILL GODDAMN FREEZING.
WHATEVER.
Research time.
I switch branches, follow the code, and look for any reference to the images, asset directory, anything. There are none. I analyze the data we're sending to the third party (Apple); no references there either, yet they appear on-device. I scour the code for references for hours; none except for one ref in google-specific code. I grep every file in the entire codebase for any reference (another half hour) and find only that one ref. I give up. It works, somehow, and the how doesn't matter. I can just replace the images and all should be well. If it isn't, it will be super obvious during QA.
So... I'll just bug product for the new images, add them, and push. No need to run specs if all that's changed is some assets. I ask the lead product goon, and .... Slack shits the bed. The outage lasts for two hours and change.
Meanwhile, I'm still trying to run db migrations. shit keeps hanging.
Slack eventually comes back, and ... Mr. Product is long gone. fine, it's late, and I can't blame him for leaving for the night. I'll just do it tomorrow.
I make a drink. and another.
hard horchata is amazing. Sheelin white chocolate is amazing. Rum and Kahlua and milk is kind of amazing too. I'm on an alcoholic milk kick; sue me.
I randomly decide to switch branches and start the migration script again, because why not? I'm not doing anything else anyway. and while I'm at it, I randomly Slack again.
Hey, Product dude messaged me. He's totally confused as to what i want, and says "All I created was {exact thing i fucking asked for}". sfjaskfj. He asks for the current images so he can "noodle" on it and ofc realize that they're the same fucking things, and that all he needs to provide is the new "hero" banner. Just like I asked him for. whatever. I comply and send him the archive. he's offline for the night, and won't have the images "compiled" until tomorrow anyway. Back to drinking.
But before then, what about that migration I started? I check on it. it's fucking frozen. Because of course it fucking is.
I HAD FIFTEEN MINUTES OF FUCKING WORK TODAY, AND I WOULD BE DONE FOR NEARLY THREE FUCKING WEEKS.
UGH!6 -
There was a sales manager who was raked with overseeing me and another dev finish a last minute request project. He said at one point to the other dev that he was mad at developers because we understood something that he would never understand.
This same manager would often sit in on estimation meetings and constantly say that we were estimating too high and needed to come up with faster solutions. When we would offer him with caveats of possible technical debt or unintended side-effects/performance issues, he'd want us to go with that solution. He would then complain that we were always wanting to work on technical debt and that our application was slow. He would also ask for very high level estimates for large, unscoped features/apps without any meaningful level of detail, then hold us to the high-level estimated date even after revealing additional features previously unmentioned.
We learned to never compromise on the right solution and to push back hard on dates without proper scoping. They didn't learn, so I and most of the good devs left. -
So ok here it is, as asked in the comments.
Setting: customer (huge electronics chain) wants a huge migration from custom software to SAP erp, hybris commere for b2b and ... azure cloud
Timeframe: ~10 months….
My colleague and me had the glorious task to make the evaluation result of the B2B approval process (like you can only buy up till € 1000, then someone has to approve) available in the cart view, not just the end of the checkout. Well I though, easy, we have the results, just put them in the cart … hmm :-\
The whole thing is that the the storefront - called accelerator (although it should rather be called decelerator) is a 10-year old (looking) buggy interface, that promises to the customers, that it solves all their problems and just needs some minor customization. Fact is, it’s an abomination, which makes us spend 2 months in every project to „ripp it apart“ and fix/repair/rebuild major functionality (which changes every 6 months because of „updates“.
After a week of reading the scarce (aka non-existing) docs and decompiling and debugging hybris code, we found out (besides dozends of bugs) that this is not going to be easy. The domain model is fucked up - both CartModel and OrderModel extend AbstractOrderModel. Though we only need functionality that is in the AbstractOrderModel, the hybris guys decided (for an unknown reason) to use OrderModel in every single fucking method (about 30 nested calls ….). So what shall we do, we don’t have an order yet, only a cart. Fuck lets fake an order, push it through use the results and dismiss the order … good idea!? BAD IDEA (don’t ask …). So after a week or two we changed our strategy: create duplicate interface for nearly all (spring) services with changed method signatures that override the hybris beans and allow to use CartModels (which is possible, because within the super methods, they actually „cast" it to AbstractOrderModel *facepalm*).
After about 2 months (2 people full time) we have a working „prototype“. It works with the default-sample-accelerator data. Unfortunately the customer wanted to have it’s own dateset in the system (what a shock). Well you guess it … everything collapsed. The way the customer wanted to "have it working“ was just incompatible with the way hybris wants it (yeah yeah SAP, hybris is sooo customizable …). Well we basically had to rewrite everything again.
Just in case your wondering … the requirements were clear in the beginning (stick to the standard! [configuration/functinonality]). Well, then the customer found out that this is shit … and well …
So some months later, next big thing. I was appointed technical sublead (is that a word)/sub pm for the topics‚delivery service‘ (cart, delivery time calculation, u name it) and customerregistration - a reward for my great work with the b2b approval process???
Customer's office: 20+ people, mostly SAP related, a few c# guys, and drumrole .... the main (external) overall superhero ‚im the greates and ur shit‘ architect.
Aberage age 45+, me - the ‚hybris guy’ (he really just called me that all the time), age 32.
He powerpoints his „ tables" and other weird out of this world stuff on the wall, talks and talks. Everyone is in awe (or fear?). Everything he says is just bullshit and I see it in the eyes of the others. Finally the hybris guy interrups him, as he explains the overall architecture (which is just wrong) and points out how it should be (according to my docs which very more up to date. From now on he didn't just "not like" me anymore. (good first day)
I remember the looks of the other guys - they were releaved that someone pointed that out - saved the weeks of useless work ...
Instead of talking the customer's tongue he just spoke gibberish SAP … arg (common in SAP land as I had to learn the hard way).
Outcome of about (useless) 5 meetings later: we are going to blow out data from informatica to sap to azure to datahub to hybris ... hmpf needless to say its fucking super slow.
But who cares, I‘ll get my own rest endpoint that‘ll do all I need.
First try: error 500, 2. try: 20 seconds later, error message in html, content type json, a few days later the c# guy manages to deliver a kinda working still slow service, only the results are wrong, customer blames the hybris team, hmm we r just using their fucking results ...
The sap guys (customer service) just don't seem to be able to activate/configure the OOTB odata service, so I was told)
Several email rounds, meetings later, about 2 months, still no working hybris integration (all my emails with detailed checklists for every participent and deadlines were unanswered/ignored or answered with unrelated stuff). Customer pissed at us (god knows why, I tried, I really did!). So I decide to fly up there to handle it all by myself16 -
This is the last part of the series
(3 of 3) Credentials everywhere; like literally.
I worked for a company that made an authentication system. In a way it was ahead of it's time as it was an attempt at single sign on before we had industry standards but it was not something that had not been done before.
This security system targeted 3rd party websites. Here is where it went wrong. There was a "save" implementation where users where redirected to the authentication system and back.
However for fear of being to hard to implement they made a second method that simply required the third party site to put up a login form on their site and push the input on to the endpoint of the authentication system. This method was provided with sample code and the only solution that was ever pushed.
So users where trained to leave their credentials wherever they saw the products logo; awesome candidates for phishing. Most of the sites didn't have TLS/SSL. And the system stored the password as pain text right next to the email and birth date making the incompetence complete.
The reason for plain text password was so people could recover there password. Like just call the company convincingly frustrated and you can get them to send you the password.1 -
Boss(In company chat): Guys we only need 100 votes to win this award.Do vote and also push your friends and family to vote.
Me: git push -f origin master
Boss: I'll see you tomorrow.
Me: git reset HEAD --hard.
(I think I am gonna get fired)1 -
Okay, I'm interning at a government institution & boy let me just tell you... mmmh... A FUCKING MESS!
So I'm tasked with developing a HR system that the whole company should eventually use. I tell them I'm not familiar with the open source technologies they'd like me to use, they tell me no worries, you can develop a prototype with a tech stack that you're familiar with. Also, they tell me that they don't quite have the requirements from HR so what I can do for my prototype is just develop something "general" that works according to their "idea".
Being the good intern I am, I develop quite a good functioning prototype & present it to the team who then present it to the managers.
Finally we're all called in for a final meeting with the managers & HR, and guess what? The requirements for the system are different. Almost 90% of the features we built into the prototype need to change. Also, the system must use open source technologies. The managers promise to send a detailed requirements specification document, with sample data. I think this is a great idea as there's still a lot I don't understand. I expected this to happen, so I soon start to redesign afresh, this time trying as hard as possible to consider open source technologies within my plans.
But noooo... My team wants me to "finish" the system!
"Finish" what system, I ask? That was a prototype!
"Just tweak the functionality you built to meet the new requirements".
WTF!
We don't even have the actual requirements specification document, so I'll still be coding blindly. Also, the whole system needs to be re-built using open source technology!
Instead of pushing me to develop a system blindly, with no requirements, how about you push HR to tell you exactly what they need and how it should work first!?
I'm honestly exhausted with the false sense of urgency from my team!!8 -
Made an Android app a while ago. I needed some pet project so I decided to go with Java for Android. First time, no experience at all.
So everything went ok, I had a little help from a colleague, structuring code, and pushing to the store. Work done app was doing ok.
A year later I came back to this project. I needed to fix a bug - date time and daylight savings crap. 😥
Spent a week on it. Ready to push a new version to the store, with some extra features! Build apk. All good.
Wait. I need to sign the APK? Wtf. I had to format my hard drive. How do I recover my fucking certificate?
*Google's for a while*
No fucking way. I can't restore the certificate. Or get the keystore back. The solution is to create a new app with a brand new package name?
Thanks for nothing, I'm done with Android development.9 -
It is said that the number of programmers doubles every five years with fresh CS, CE, and EE grads. Assuming that's true, then at any one time over half the developer community are novices in the early stages of their career.
My entire life's been spent in software and I've been in it now for about 15 years and I've seen a lot of people make alot of things and I've seen a lot of people fail at alot of things. My observation is that the doers are the major thinkers, the people that really create the things that change this industry are both the thinker doer in one person. It's very easy to take credit for the thinking the doing is more concrete. It's very easy for somebody say "oh, I thought of this three years ago" but usually when you dig a little deeper you find that the people that really did it. Were also the people that really worked through the hard intellectual problems.
Many people falsely believe that a great idea constitutes 90% of the work. However, there is a significant amount of craftsmanship required to bridge the gap between a great idea and a great product. As you evolve that great idea it changes and grows it never comes out like it starts because you learn a lot more as you get into the subtleties of it and you also find there's tremendous amount of trade-offs that you have to make.
There are certain things you can't make electrons do, certain things you can't make plastic or glass, certain things you can't make factories or robots do. and as you get into all these things, Designing a product involves juggling 5,000 different concepts, fitting them together like puzzle pieces, and exploring new ways to combine them. Every day brings new challenges and opportunities to push the boundaries of what's possible, and it's this ongoing process that is the key to successful product development. That process is the "magic"4 -
Took up computer course, never used nor seen a computer in my life. Was good at written tests, now first time to use the lab and first time seeing a PC
Prof: Today you're going to create your own bootable micro floppy disk. Afterwards you're going to load it with SideKick and PC Tools. Turn on the PC in front of you and insert your double density disks as soon as you see the C: prompt
Me: my disk won't go all the way in
Classmate: just push it in until you hear a click then it will lock
Me: still won't *pushes really hard until I heard a crack... my disk was inserted the wrong way... it did lock though*
Everyone in class looks at me and I start questioning my life choices. I could've sworn our Prof's face turned white -
git push --force
Because I always push after every commit, when the slightest fuckup happens I just hard reset, commit again, and force push...
...even if it's just a typo in the commit message6 -
My social life consists of spending much of my free time with my girlfriend, seeing my close family on weekends and meeting with a few friends from time to time.
It's enough for me and since there's not much of it, it isn't hard to "balance". Whatever that means.
Seriously tho, "social/work life balance" is subjective. It depends on what you need to feel good and happy. What works for some will not work for others. Don't try to push others into being social when they don't want to. Don't give me that "you need to go out more" crap. I don't. I'm fine just like this. I prefer to stay home and see a movie with my girlfriend.
That "people need to be social" mindset made me feel bad about myself for too long because I'm just not like that and people keep pushing that idea into my head. I'll go out with you when I feel like it, don't push it. Stop asking me every fucking weekend ffs.2 -
I don't know if this is a problem only in Belgium or also in other countries but while I love Bluetooth for audio playback (headsets, speakers and everything) despite being extremely convoluted as a protocol.. FUCK Bluetooth keyboards.
Several of them I've tried. Several of them, from various brands. Pairing, setting the Belgian keyboard layout (which on that shitty Android 7.0 tablet that I want to use the fucking things with apparently has to be done *every fucking time you connect*, because reasons) all well. Except half the keys don't fucking map properly. A keymap, it doesn't get easier than that! How hard is it to make buttons map to the right keys!? They're literally fucking push buttons on a matrix! Seeing which points in the circuit make contact and sending that off to wherever it needs to go!
And to put the icing on the cake? USB keyboards with the same fucking layout settings work without any problems. So it's extremely likely that it's something in those shitty keyboards' controllers or Bluetooth going full rart on all of them.
Of course, Bluetooth being as convoluted as it is, manufacturers just copy each others' implementations of it if they can.. so there's that.
Can really nobody make a product halfway decent anymore before putting it on the market!?
Another one bites the dust.. JUNK!!! Every single goddamn one of them!1 -
Rant time of 'Derp & Co.'
Today I decided that I am going to find another job, I just can't keep with this shit.
They said that use Agile: FALSE.
• Daily (best scenario) take like 1 hour and a half.
• New task enter the sprint and "Fuck you, more task in the same time". This is something regular done.
• "Oh, dev, we need you to check this other project" I am in the middle of my sprint on this project. "But you have to fix this bug here". (3 fucking days the bloody bug) "You are late again with tasks".
• Meeting for fresh sprint: 6 BLOODY hours... nonstop
The workflow is garbage:
• SOMEONE should did all the devops shit on the first sprint, guess what? They did nothing!, guess now who is being blamed for it (not only me, but a few coworkers).
• Nothing is well designed/defined:
~ task are explained like shit
~ times measured wrongly
~ We are in the last fucking SPRINT and still doing de ER of the DataBase cause Oh, apparently no one has work before with SQL (damn you MongoDB! (Not really)) so I am doing my best, but "jezz dev, this is so hard... maybe we can do it WRONG and easy".
~ No one is capable of take responsability of their mess, they just try to push down the problems. (Remember the devops situatuion? Why is.my fault? I came at the 3 or 4 sprint and I am doing backend tasks, I know nothing about devops).
But the big prize, the last one:
• Apparently you can't send whatever you want to the boss, it has to pass a filter previously of coordinators and managers, hell yeah!
And I am an idiot too!
because I see that we can't reach our schedule and do hours on my spare time!
This is because there are a few good coworkers who probably ended with my unfinished tasks... and they are equaly fucked as me...
This is just the tip of the iceberg. I am not a pro, I am not a full stack developer and still need to learn a lot, but this is just not normal, eight months like this...3 -
I need some advice here... This will be a long one, please bear with me.
First, some background:
I'm a senior level developer working in a company that primarily doesn't produce software like most fast paced companies. Lots of legacy code, old processes, etc. It's very slow and bureaucratic to say the least, and much of the management and lead engineering talent subscribes to the very old school way of managing projects (commit up front, fixed budget, deliver or else...), but they let us use agile to run our team, so long as we meet our commitments (!!). We are also largely populated by people who aren't really software engineers but who do software work, so being one myself I'm actually a fish out of water... Our lead engineer is one of these people who doesn't understand software engineering and is very types when it comes to managing a project.
That being said, we have this project we've been working for a while and we've been churning on it for the better part of two years - with multiple changes in mediocre contribution to development along the way (mainly due to development talent being hard to secure from other projects). The application hasn't really been given the chance to have its core architecture developed to be really robust and elegant, in favor of "just making things work" in order to satisfy fake deliverables to give the customer.
This has led us to have to settle for a rickety architecture and sloppy technical debt that we can't take the time to properly fix because it doesn't (in the mind of the lead engineer - who isn't a software engineer mind you) deliver visible value. He's constantly changing his mind on what he wants to see working and functional, he zones out during sprint planning, tries to work stories not on the sprint backlog on the side, and doesn't let our product owner do her job. He's holding us to commitments we made in January and he's not listening when the team says we don't think we can deliver on what's left by the end of the year. He thinks it's reasonable to expect us to deliver and he's brushing us off.
We have a functional product now, but it's not very useful yet and still has some usability issues. It's still missing features, which we're being put under pressure to get implemented (even half-assed) by the end of the year.
TL;DR
Should I stand up for what I know is the right way to write software and push for something more stable sometime next year or settle for a "patch job" that we *might* deliver that will most definitely be buggy and be harder to maintain going forward? I feel like I'm fighting an uphill battle in trying to write good quality code in lieu of faster results and I just can't get behind settling for crap just because.9 -
Saturdays I like to code and have some beers.
Learned the hard way to wait until the next day to push my changes... 😂 -
How do you judge the ability of the candidates during the interview?
Sometimes I find it hard to score their ability. I have seen some candidates with x years on paper yet does not know git more than push and pull.
Also there are few who didnt do very well at the interview, however we hired and doing quite well at work.
(As I also had a hard time getting a job before, I sometimes feel bad to reject some who seems to have good personality but didnt do well at work)5 -
4 months into the journey at an ambitious streaming startup we, a team of 10 engineers (primarily full stack), sets up a tiny and performant express.js api setup.
We document plans for improving the maintainability, including outlining specific practices (not very different from general node best practices) that need to be followed for all new development.
Enter a new engineering manager (dedicated backend manager), henceforth referred to as S, with a rat face and brain that belongs in a rat hole.
Week 1:
S: let's push this new feature out asap
Dev: it'll need a couple of weeks to get done right
S: let's push out a functional version tomorrow, and revamp in the next iteration
Dev: ... (long pause) there's documented practices specifically directing against this
S: can you not do it by tomorrow
Dev: not if it needs to be done right
S: all you need to do is.. (simplifies changes spanning 5 modules into a 3 line summary)
Dev: yes, (outlines how each changes chains into the others, and how to keep the development maintainable for atleast a few months)
S: (interrupts every sentence saying "yes dev, I understand, yes yes")
Dev: could you please tell me how you expect me to connect (outlines two modules that would fail unless developed as standalone services)
S: Yes dev, I understand, yes yes. I don't have much experience with Node.js, so I can't tell you that.
Dev:
<_<
>_>
O_<
Our.. entire.. backend.. stack.. is.. Node. (Months of motivation, cultivated through hard work over late nights, dies inside)
I need a J and some sleep.6 -
A rant from git,
Why do developers always PUSH and PULL me around. I mean they don't just do it once or twice. No they COMMIT to doing it over and over. I try to REBUILD myself, but it is hard getting pushed and pulled constantly. I don't know the ORIGIN of where it started, but gosh I wish the bullying never started! -
Tldr: fucked up windows boot sector somehow, saved 4 months worth of bachelor thesis code, never hold back git push for so long!
Holy jesus, I just saved my ass and 4 months of hard work...
I recently cloned one of my SSDs to a bigger one and formatted the smaller one, once I saw it went fine. I then (maybe?) sinned by attaching an internal hdd to the system while powered on and detached, thinking "oh well, I might have just done smth stupid". Restart the system: Windows boot error. FUCK! Only option was to start a recovery usb. Some googling and I figured I had to repair the boot section. Try the boot repair in the provided cmd. Access denied! Shit! Why? Google again and find a fix. Some weird volume renaming and other weird commands. Commands don't work. What is it now? Boot files are not found. What do I do now? At this point I thought about a clean install of Windows. Then I remembered that I hadn't pushed my code changes to GitHub for roughly 4 months. My bachelor thesis code. I started panicking. I couldn't even find the files with the cmd. I panicked even more. I looked again at the tutorials, carefully. Tried out some commands and variations for the partition volumes, since there wasn't much I could do wrong. Suddenly the commands succeeded, but not all of them? I almost lost hope as I seemed to progress not as much as I hoped for. I thought, what the hell, let's restart and see anyway. Worst case I'll have to remember all my code😅🤦.
Who would have thought that exactly this time it would boot up normally?
First thing I immediately did: GIT PUSH --ALL ! Never ever hold back code for so long!
Thanks for reading till the end! 👌😅8 -
WHY IS IT SO FUCKIN ABSURDLY HARD TO PUSH BITS/BYTES/ASM ONTO PROCESSOR?
I have bytes that I want ran on the processor. I should:
1. write the bytes to a file
2a. run a single command (starting virtual machine (that installed with no problems (and is somewhat usable out-of-the-box))) that would execute them, OR
2b. run a command that would image those bytes onto (bootable) persistent storage
3b. restart and boot from that storage
But nooo, that's too sensible, too straightforward. Instead I need to write those bytes as a parameter into a c function of "writebytes" or whatever, wrap that function into an actual program, compile the program with gcc, link the program with whatever, whatever the program, build the program, somehow it goes through some NASM/MASM "utilities" too, image the built files into one image, re-image them into hdd image, and WHO THE FUCK KNOWS WHAT ELSE.
I just want... an emulator? probably. something. something which out of the box works in a way that I provide file with bytes, and it just starts executing them in the same way as an empty processor starts executing stuff.
What's so fuckin hard about it? I want the iron here, and I want a byte funnel into that iron, and I want that iron to run the bytes i put into the fuckin funnel.
Fuckin millions of indirection layers. Fuck off. Give me an iron, or a sensible emulation of that iron, and give me the byte funnel, and FUCK THE FUCK AWAY AND LET ME PLAY AROUND.8 -
I started off in a MNC company as a junior developer. I entered with candy glasses.
I didn't expect to win the lottery. Of getting abuse by superior.
I stayed for a year, at the project. Constantly being belittled by this team lead. It was awful i enter as a fresh grad. All the new tech were so new and scary at that point.
During my time there, i constantly think that developer is not my stuff.
Ultimately i reach the state of burnout. I reached out to the manager and broke down in his office.
I actually told the manager. "I hate coding"
I remember staying up to 4am just complete a piece of program. To be ready to be push to production the next day. My team lead just come screaming at me saying there is bug.
Upon receiving that message via skype. I broke, tears flow down my eyes.
After which i reach a state of burn out. I start to reach out to external parties for help to get me out of there.
Now i am recovered from the burn out. I am curious of the technology that were utilized in that project. I literally face palm. After understanding the technology it isn't so hard after all. I just didn't gear myself up with the tech.
I still do enjoy working on code.3 -
I used to be a sysadmin and to some extent I still am. But I absolutely fucking hated the software I had to work with, despite server software having a focus on stability and rigid testing instead of new features *cough* bugs.
After ranting about the "do I really have to do everything myself?!" for long enough, I went ahead and did it. Problem is, the list of stuff to do is years upon years long. Off the top of my head, there's this Android application called DAVx5. It's a CalDAV / CardDAV client. Both of those are extensions to WebDAV which in turn is an extension of HTTP. Should be simple enough. Should be! I paid for that godforsaken piece of software, but don't you dare to delete a calendar entry. Don't you dare to update it in one place and expect it to push that change to another device. And despite "server errors" (the client is fucked, face it you piece of trash app!), just keep on trying, trying and trying some more. Error handling be damned! Notifications be damned! One week that piece of shit lasted for, on 2 Android phones. The Radicale server, that's still running. Both phones however are now out of sync and both of them are complaining about "400 I fucked up my request".
Now that is just a simple example. CalDAV and CardDAV are not complicated protocols. In fact you'd be surprised how easy most protocols are. SMTP email? That's 4 commands and spammers still fuck it up. HTTP GET? That's just 1 command. You may have to do it a few times over to request all the JavaScript shit, but still. None of this is hard. Why do people still keep fucking it up? Is reading a fucking RFC when you're implementing a goddamn protocol so damn hard? Correctness be damned, just like the memory? If you're one of those people, kill yourself.
So yeah. I started writing my own implementations out of pure spite. Because I hated the industry so fucking much. And surprisingly, my software does tend to be lightweight and usually reasonably stable. I wonder why! Maybe it's because I care. Maybe people should care more often about their trade, rather than those filthy 6 figures. There's a reason why you're being paid that much. Writing a steaming pile of dogshit shouldn't be one of them.6 -
So... My boss is "hard working", meaning that she'd rather edit and upload a html file every morning at 5am for the last 5 years and manually send a push notification notifying the user that the new file is up than learning a little bit about automation (cron? IFTTT?) and even after letting her know about those options she has "no time"
She'd rather keep source code (pug, sass), manually build on local computer and upload to live servers instead of learning git and letting me setup once and for all CI/CD
SERIOUSLY!?!? NO TIME!?!? But there's time to do things at a turtle pace like in the 90s... 🤦♂️5 -
Rant
Frustrated...
How single tiny mistakes can ruin your day...
For those who don't know me (and I've been absent from social media, even DevR cause of a burn out) I'm not a developer as most here, my code Is Numeric Code (work with a CNC machine)
Like, I have to do corrections every day to compensate for my programmer mistakes...
-Today broke two tools because I'm so tired I forgot to make such corrections...
-Got fucked up by my boss cause of It
- worked to hard all week to push the work forward (everyone else is dependent on me, because I start most of the pieces from a block of metal), now I can't think straight... and get fucked because of some simple mistakes...
Colleges trow away pieces worth from 5000 euros to 50000 euros (and more) cause of distraction and he always picks on me, even for stuff that isn't my fault or my responsibility...
I love my job, my company, but sometimes...
BTW, if anyone is curious what a CNC machine does, check this out: https://youtube.com/watch/...
Its so awesome to work with such a machine... Mine has a 2,5m x 1,3m table and 5 tons maximum weight4 -
So I work in a web development company in my town and have been doing a while or heap of parallax sites for our clients. Now obviously when we do the designs we get them in and get them to play around with the site before we go ahead and push their new site out and make it live right.
Wellll who would of thought that a simple parallax site would be so hard to use for the general user??? Recently we have been getting the occasional call where the client is getting complaints about the site only being a big ole image or just one block of text. After investigating why their site was broken or why the users weren't able to see the whole site I came across no problems at all.
Today I got a call from the client who instructed me that after explaining to one of his own clients that he had to scroll down the page that everything was just fine!
I mean, what? How do you miss the big ole scroll bar on ya screen or even think to even attempt to scroll? Some people aye lmao2 -
Stupid pipeline bullshit.
Yeah i get it, it speeds up development/deployment time, but debugging this shit with secret variables/generated config and only viewable inside kubernetes after everything has been entered into the helm charts through Key Vaults in the pipeline just to see the docker image fail with "no such file found" or similar errors...
This means, a new commit, a new commit message, waiting for the docker build and push to finish, waiting for the release pipeline to trigger, a new helm chart release, waiting for kubernetes deployment and taking a look at the logs...
And another error which shouldn't happen.
Docker, fixes "it runs on my machine"
Kubernetes, fixes "it runs on my docker image"
Helm, fixes "it runs in my kubernetes cluster"
Why is this stuff always so unnecessarily hard to debug?!
I sure hope the devs appreciate my struggle with this... well guess what, they won't.
Anyways, weekend is near and my last day in this company is only four months away.2 -
Short angry rant
What the fuck is wrong with the SalesForce Authenticator logic?! How in the hell do you fuck up a simple 2FA system this hard?!!
Login -> Waiting for Notification... nothing... -> Reload Page -> Login -> Waiting for Notification... nothing -> Click "Use Code instead"... nothing happens... -> Reload Page -> "Login -> don't even wait for notification and just pres "Use Code instead"... nothing -> Reload Page -> Notice there's a "Use Code" button on this page as well -> Finally be able to log into the fucking Aloha piece of shit...
How TF is it, that Duo is able to send me a push notification within 1 second and it ALWAYS works... and THIS FUCKING SHIT NEVER FUCKING WORKS THE FIRST TIME AND AT WORST JUST DOESN'T WORK AT ALL!!!!!
Fucking hell.... Don't offer me a push notification service if you don't know how to make one... jesus fucking christ... All of Salesforce security is fucking stupid, but at least the others mostly work, but this retarded piece of crap is making me actively surprised when it works on first try... Maybe it's because I'm on a slow connection, but again Duo Mobile doesn't have this problem and works *instantly*... so what sort of retarded monkey coded the SF one I don't know, but I hope they are making better products now, because this is a disgrace to programming and security6 -
So today a drawer above my desk fell, but sadly my MacBook Air was under it, now I had a cushion based cover and a hard shell case for my Mac. However the edges of drawer penetrated the cover and case leaving a dent on the back. Which somehow means I don’t get the display but everything else is working (ie keys and sound).
Now I have to push an important bug fix and screen replacement will take at least 10-12 days.8 -
Our company recently moved to git and the number of people who do not understand basic git concepts like commit and push are too damn high! I don' get it, its a completely logical model, what is so hard to understand.4
-
What a satisfying and yet freaking scary thing when you run
# git checkout -b feature/lostHoursWorkingOnThis
# git reset -- hard <commit from 3 months ago>
# git push upstream master --force
Just when you're at the final sign off of a major change and the business goes "nope, we want to make even more changes before we sign off ok this"
🤷♂️out of scope gone wrong!!
Well fuck you, I got shit to deploy, all this work can get out of my way! -
I turned down another women who was absolutely, 100% flirting with me, because, from what I can gather, she was trying to get out of a relationship with her current boyfriend, a military veteran.
I outright ignored her and then when that failed, I made our work relationship 100% about that, work.
Even though I'm friendly with everyone else.
I'm an absolute shit, aren't I? I feel genuinely bad.
I'm not sure if I did it out of a misplaced sense of honor for a dude who obviously has some ptsd, or because I don't feel like I'm able to connect with anyone anymore.
I feel like I'm alone in this world. Not, like, sexually or anything, but more like I don't want to burden anyone with the shit I'm going through. Like a man on a mission on a sinking ship, and it would be wrong to let anyone else on board.
Like a one-man shit-show, all singing, all dancing, driven to one end, with one purpose. And it'd be wrong to let anyone get attached, or invite anyone else in.
Fuck I got so many irons in the fire. I have an ARG in the works, a full game, a social platform that the code and marketing plan is laid out and I'm saving money for, two more games already planned, plus spending an in-ordinate amount of time with my father and sister and mother as they deal with the loss of my sister, plus volunteering to help the homeless, plus working, plus studying.
I barely sleep.
It's just me. I'm like a cruise missile heading to one destination, to some final destination, I just don't know what. And I don't let anyone in, because then they might see how fucking crazy I am, and how crazy my life is, and how crazy my goals are. Thats not a humblebrag. Thats more of a "wholly shit, I'm so in over my head, I'm fucking drowning" type thing. But I'm not giving up, I'm just going deeper.
And it feels like drowning but somehow I'm okay with it. Like I've passed the crux of loneliness, and settled for going for it all, alone, shooting out of orbit, and saying "fuck it all' to everything and everyone. They say "if you got everything you wanted, everything you wished for, you'd wish you hadn't, which is why god isn't a genie". And lately I've been thinking god doesn't exist, or doesn't care, because he's left it all up to me, and I've fucked it up good and proper, and am on my way to either nothing, or everything I've ever wanted.
Is this what happiness feels like? Or suicide?
I don't know. I mean I really don't. I don't want to die. I think I could stop existing and be okay with it. Having achieved at least a modicum of understanding the universe, at least accomplished something small but meaningful.
Or maybe I'm delusional, driven mad with the full comprehension of human floundering against a meandering existence.
I don't fucking know.
I feel like I'm spinning my wheels, so much, that even two weeks feels like a fucking eternity. I don't sleep anymore. When I do, I escape into my dreams, where I can fly, or float, and the people in my dreams tell me I'm living in the matrix and I believe them..in my dreams. Feel it even.
And when I wake up, the feeling persists. Leaves me in wonderland, for hours after waking.
And I have visions, of going homeless, like some buddha, all the time, and then I say "wake up J, you're fucking crazy! You want to go be some couch surfing homeless bum living off other's good graces? get the fuck outa here! While others suffer, schlep it at whatever job they work, day in day out, toil. In this economy? In this inflation? What a dishonest way of thinking. What a dishonest way of dreaming."
And yet I daydream. Because its the only escape there is from all the world has become.
And I bring joy to others, earnestly, vicariously, because its the closest joy I can feel, when I've become numb.
It is this quasi-permanent sense of alienation that permeates my whole world, a sort of invisible force field that separates me from others, even as I reach out to understand them, to comfort them, to smooth the corners off their world, so that they don't become like I have, something not entirely human, but...other.
Often when we meditate, long and hard enough,
at the center that emerges, at the center of ourselves, we find an abyss, a whole universe, devoid of anything, a perfect silence, mirroring back the cosmos, and other people. Observing, silent, irreducible, implacable.
Sometimes I feel like I don't exist. Sometimes I think others don't exist.
Very often I feel like nothing is real. And that I am playing some sort of game. Not like a video game per se, but that there is a bigger pattern, a hidden pattern to it all, just out of reach, and I'm reaching for it but understanding eludes me.
Not that the universe has made me for some special purpose, but merely that the universe observes me specifically, for no special purpose, other than that it can, whatever trivialities may impede or push forward my life.
As if the universe were bored.24 -
TeamWork 1 week before release de projet
Guys i dont know why but all the projet is fuckup in Git ...
Me: where is your firts commit of all these shit ?
He: just there
Me : git reset eb23ae --hard && git push origin HEAD --force
Me: now you sit there and you play with your pencil ! 😡😠
Thx2 -
I am a manager of an entry-level employee who share with another manager. Our shared employee, let’s call her “Jane,” is terrific — a hard worker, very smart, quick, and organized. Jane has been with us over two years and we would like to promote her, something she’s clearly earned, but our progress has been stalled by the pandemic. And though we’re working to push the promotion forward as quickly as possible, with budget cuts to contend with, this has been slower and more difficult than expected.
Meanwhile, Jane has shared with our team (including my boss, her grandboss) that she’s interested in returning to school for graduate study but was not sure when she’d want to attend. However, later Jane confidentially asked me to write her a recommendation letter to include in an application for study beginning this fall. I happily agreed and we discussed that she didn’t want this shared more widely, so I wrote the letter and kept it to myself. A few weeks ago, Jane texted me that she’d been accepted to grad school. I was thrilled for her but concerned about her departure. She stated that it was her intention to defer until 2021 due to the pandemic. We love Jane and I’m happy to have her as long as she’d like to stay, and again kept it to myself per her wishes.
Today, to my surprise, my boss called my attention to a tweet that Jane had shared, publicly on her personal account, announcing that she’d been accepted to grad school. My boss was blindsided since she didn’t think of this as an immediate plan and was particularly upset because HER boss (my grandboss and Jane’s great-grandboss, our president) was the one who saw it and alerted her of it. What’s worse is that my boss’s boss has been the one doing the hard work in negotiating Jane’s promotion with HR. Worse worse, after sharing this development, my co-manager (who shares management of Jane with me) revealed that she too had learned of Jane’s acceptance on Twitter. For the record, this tweet is about 10 days old at this point — time for Jane to have made a plan to speak directly and openly about it at work if she chose to.
I’m all for private use of social media and the right to have an online presence that is separate from your work. However, this puts me in an embarrassing position. I was honest with my boss when confronted, confessing that I did know about her acceptance and had provided a reference, but I can’t help but feel a little taken advantage of after Jane had asked me to keep it confidential. Additionally, her other boss heard of this news on social media and so did people above her who are gunning for her promotion — valued coworkers of mine and superiors of Jane who now feel disrespected for being out of the loop. I do not believe that Jane’s attendance at or deferment from grad school should affect her eligibility for a promotion, but it will surely be another hurdle to overcome among many other pandemic-related ones now that the news is out in this manner.
Extra notes: 1) Jane has previously announced 10-day vacations on Instagram (plane tickets booked) before asking for the time off. 2) Jane runs our company social media channels, so people look at her personal ones with scrutiny.
I feel compelled to speak with Jane in a friendly but direct way to explain that it’s her choice how or with whom she’d like to share her news, but that social media is not the place for bosses, grandbosses, or great-grandbosses should discover employment-altering news. Ever, really, but particularly when we’re working hard for her promotion. How can I do this without overstepping? Am I overstepping?8 -
A dev life in Queen songs:
„A Kind of Magic“ - Build successful
„A Winter’s Tale“ - Key Account Manager visits customer
„Action This Day“ - Release day
„All Dead, All Dead“ - System down
„Another One Bites the Dust“ - kill -9 4711
„Breakthru“ - 10 hour debuging session
„Chinese Torture“ - Microsft Office
„Coming Soon“ - Client asks for delivery date
„Dead on Time“ - shutdown -t 10
„Doing All Right“ - How's the progress on the new feature?
„Don’t Lose Your Head“ - git push -f
„Don’t Stop Me Now“ - In the zone
„Escape from the Swamp“ - Hand in resignation letter
„Forever“ - while(1)
„Friends Will Be Friends“ - friend class Vector;
„Get Down, Make Love“ - No rule to make target "Love"
„Hammer to Fall“ - Release day
„Hang on in There“ - 2 weeks until release
„I Can’t Live With You“- Microsoft
„I Go Crazy“ - Microsoft
„I Want It All“ - Google
„I Want to Break Free“ - free( (void*) 0xDEADBEEF );
„I’m Going Slightly Mad“ - Impossible feature requested
„If You Can’t Beat Them“ - Impossible feature promised by sales
„In Only Seven Days“ - Impossible feature ordered
„Is This the World We Created...?“ - Philosphic moments
„It’s a Beautiful Day“ - Weekend
„It’s a Hard Life“ - Weekday
„It’s Late“ - Deadline was last week
„Jesus“ - WTF?
„Keep Passing the Open Windows“ - Interprocess communication
„Keep Yourself Alive“ - Daily struggle
„Leaving Home Ain’t Easy“ - Time to get up and go to work
„Let Me Entertain You“ - Sales meets customer
„Liar“ - Sales
„Long Away“ - Project start
„Loser in the End“ - Dev
„Lost Opportunity“ - Job ad
„Love of My Life“ - emacs/vim
„Machines“ - Computer
„Made in Heaven“ - git
„Misfire“ - Unhandled exception at Memory location 0xDEADBEEF
„My Life Has Been Saved“ - Google drive/Facebook
„New York, New York“ - Meeting at customer
„No-One But You“ - Bus factor = 1
„Now I’m Here“ - Morning rush hour
„One Vision“ - Management goals
„Pain Is So Close to Pleasure“ - NullPointerExcption
„Party“ - Delivery completed
„Play the Game“ - Customer meeting inhous -
„Put Out the Fire“ - Support hotline
„Radio Ga Ga“ - GSM/GPRS/UMTS/LTE/5G
„Ride the Wild Wind“ - Arch Linux
„Rock It“ - Linux
„Save Me“ - CTRL-S/CTRL-Z
„See What a Fool I’ve Been“ - git blame
„Sheer Heart Attack“ - rm -rf /
„Staying Power“- UPS
„Stealin’“ - Stack Overflow
„The Miracle“ - It works
„The Night Comes Down“ - It doesn't work
„The Show Must Go On“ - Project cancelled
„There Must Be More to Life Than This“ - Philosophic moments
„These Are the Days of Our Lives“ - Daily routine
„Under Pressure“ - 1 day until release
„Was It All Worth It“ - Controlling
„We Are the Champions“ - Release finished
„We Will Rock You“ - Sales at customer
„Who Needs You“ - HR
„You Don’t Fool Me“ - Debugging session
„You Take My Breath Away“ - rm -rf /
„You’re My Best Friend“ - emacs/vim4 -
I don't know if this is exactly a rant. But - I am sure somewhere out there has run into this situation before.
I've been a developer (professionally) for a 3 years. And in that time I've stayed with that same company.
Over that time its become incredibly apparent that my boss (senior developer) isn't exactly keen on new technologies, source control (I had to push hard for this. And even then he doesn't use it properly), or any kind of project management. It's only he and I.
I've started interviewing other places and while I have no problems answering their technical questions. I'm worried my lack of experience in a team is becoming a problem.
We don't work on projects together. We don't do code reviews. He does not ask my opinion on anything. We are basically two separate teams. I want to improve as a developer. I love the rest of the company and I enjoy what I'm working on. I just feel I'm hindering my growth as a developer.
Anyone have any advice? I know I can find a project to contribute to on github or something. But honestly that's intimidating to me for some reason. I am self taught. And don't have any experience in working with teams.4 -
TL;DR; do your best all you like, strive to be the #1 if you want to, but do not expect to be appreciated for walking an extra mile of excellence. You can get burned for that.
They say verbalising it makes it less painful. So I guess I'll try to do just that. Because it still hurts, even though it happened many years ago.
I was about to finish college. As usual, the last year we have to prepare a project and demonstrate it at the end of the year. I worked. I worked hard. Many sleepless nights, many nerves burned. I was making an android app - StudentBuddy. It was supposed to alleviate students' organizational problems: finding the right building (city plans, maps, bus schedules and options/suggestions), the right auditorium (I used pictures of building evac plans with classes indexed on them; drawing the red line as the path to go to find the right room), having the schedule in-app, notifications, push-notifications (e.g. teacher posts "will be 15 minutes late" or "15:30 moved to aud. 326"), homework, etc. Looots of info, loooots of features. Definitely lots of time spent and heaps of new info learned along the way.
The architecture was simple. It was a server-side REST webapp and an Android app as a client. Plenty of entities, as the system had to cover a broad spectrum of features. Consequently, I had to spin up a large number of webmethods, implement them, write clients for them and keep them in-sync. Eventually, I decided to build an annotation processor that generates webmethods and clients automatically - I just had to write a template and define what I want generated. That worked PERFECTLY.
In the end, I spun up and implemented hundreds of webmethods. Most of them were used in the Android app (client) - to access and upsert entities, transition states, etc. Some of them I left as TBD for the future - for when the app gets the ADMIN module created. I still used those webmethods to populate the DB.
The day came when I had to demonstrate my creation. As always, there was a commission: some high-level folks from the college, some guests from businesses.
My turn to speak. Everything went great, as reversed. I present the problem, demonstrate the app, demonstrate the notifications, plans, etc. Then I describe at high level what the implementation is like and future development plans. They ask me questions - I answer them all.
I was sure I was going to get a 10 - the highest score. This was by far the most advanced project of all presented that day!
Other people do their demos. I wait to the end patiently to hear the results. Commission leaves the room. 10 minutes later someone comes in and calls my name. She walks me to the room where the judgement is made. Uh-oh, what could've possibly gone wrong...?
The leader is reading through my project's docs and I don't like the look on his face. He opens the last 7 pages where all the webmethods are listed, points them to me and asks:
LEAD: What is this??? Are all of these implemented? Are they all being used in the app?
ME: Yes, I have implemented all of them. Most of them are used in the app, others are there for future development - for when the ADMIN module is created
LEAD: But why are there so many of them? You can't possibly need them all!
ME: The scope of the application is huge. There are lots of entities, and more than half of the methods are but extended CRUD calls
LEAD: But there are so many of them! And you say you are not using them in your app
ME: Yes, I was using them manually to perform admin tasks, like creating all the entities with all the relations in order to populate the DB (FTR: it was perfectly OK to not have the app completed 100%. We were encouraged to build an MVP and have plans for future development)
LEAD: <shakes his head in disapproval>
LEAD: Okay, That will be all. you can return to the auditorium
In the end, I was not given the highest score, while some other, less advanced projects, were. I was so upset and confused I could not force myself to ask WHY.
I still carry this sore with me and it still hurts to remember. Also, I have learned a painful life lesson: do your best all you like, strive to be the #1 if you want to, but do not expect to be appreciated for walking an extra mile of excellence. You can get burned for that. -
I still don’t understand git completely ,sometimes the error messages are so hard to understand I just make a new repository and push all my new updates there using GitHub desktop.7
-
Right now business is kind of slow for my company, so I've been working on Documentation. It's been kind of cool to make the gitlab repo, write the Markdown documents, and then push them to the repo when finished, but it's also hard because it's only me really doing anything...rant git in general is pretty awesome coworker needs to pull his weight! gitlab is cool markdown is cool documenttion
-
Why is so hard to find engineers that actually care? It feels like the majority of people always want to do the bear minimum, no one wants to fix their shitty code even when it clearly violates the project or company standards. Everyone constantly comes up with shit about why they can't do things properly or how they'll fix it later and then get their mates to push their shit through review. The majority of lower management usually care equally as little so there's no point explaining the situation to them and the lack of care probably goes much higher. It seems like so many people go from job to job getting bump after bump in salary, which granted is absolutely fine and probably advised, but have nothing to show for it. Usually very little skills but alleged mountains of experience and a lazy piece of shit attitude. I hear all the time people saying you'll never change anything so why try and it feels like that most of the time but more because everyone keeps saying it. If everyone pulled their fingers out their arse, maybe we would stand a chance. I'm sure a lot of people on here have a real passion for computer science, whichever division you're in and love to learn and improve and reflect. What I really want to know is how you deal with people who are just taking their paycheck and enjoying the ride but don't actually care and how you discover these people as early on as possible to get shot of them.14
-
After playing et and wow a few year it all started when I hosted my own ts2 server with npo license. Rented a server for 90 bucks as a highschool student (13) with no job. (Who the fuck rented to me? I had my own bank account and lied about my age. Had a credit card at 14 but that's another story)
*Shit is expensive*
How does one get some value out of a server? Oh right, let's host Webspace and ftp accounts.
That got me into server administration and bash.
After dropping wow in bc i started playing on private servers.
*Shit is buggy*
How do you fix wow server? Let's learn c++ and push patches to arcemu. Why is this part crashing on this one server? Let's look at the binary. Wtf is this? Oh assembler?!? Ok let's try to read this. Ok I get it now. Let's fix the code.
Ok let's host my own wow private server. We need a website for account creation.
Let's learn php. Wait php is easy compared to mastering c++? I need an app for my first smartphone (iPhone 3g) to manage the server on the go. Let's learn how to do that. Why is this so easy? Switching to Android: wait java is even easier?
And that's how I learned that if you start with the hard part and grasp the concept, everything more abstract is significantly easier. If you start to read code to learn any language it's easier then following books (for me at least). If you get an error, track it down, you might learn amazing things in the way.
And if you want to get into reverse engineering, start by being passionate for the thing you want the reverse. It will be hard before it gets easier and you will need all the willpower you can muster not the just stop.
Programming for me is not a job but my passion. It's like I'm on vacation every day of the year (expect meetings, fuck meetings)2 -
I have a lot of fun during crunch time.
It's like running a marathon. It is both physically and mentally taxing, and I get a rush out of seeing how hard I can push myself.
But like a marathon, it suuuuucks if you are not prepared, or you otherwise didn't want to do that.
You hear that bosses?
Crunch is like running a marathon. That thing that people, who prepare for years to do, still causes them to piss and shit themselves while their nipples bleed. And that's when they are fully prepared. That is what you are asking your team to do without any notice ahead of time.
"Ok Derrick, I know you wanted to visit your family in the country this weekend. But we need you to run uphill, fuled only by diet dr pepper and fear of loosing your job, untill you pass out and need an I.V. to keep you from stroking out. '
Otherwise a lot of fun. -
Here some more information to despise Apple.
In the past few weeks I keep having a problem making the iMac connect to whatever website/host, so I had to rerun whatever I had to do: fetching from github, push to github, connecting to a LAN server, pinging to know to IP, accessing a webpage and so on.
Luckily enough, browsers tend to request again if an error occurs.
At my job, I upload app files to servers, like GooglePlay and AppStoreConnect.
For those who don't know, Google makes you upload the app through the browser (among other ways) while Apple requires you to upload your app either through XCode. No other possible ways.
Whenever XCode requires an update, the authentication is required, but the authentication server cannot be reached for at least 5-6 tries.
Then I have to upload the app and just to be ready to hit the "upload button" it takes like 3-4 minutes, which might be completely useless if a network error occurs.
How hard is it to make your fucking app-loader to try again at least a few times?6 -
Can't git push
because of an "access denied" error message
because I didn't set up my key file properly (with right paths, right format and so on)
because I'm working from my home laptop device
because I'm in home office
because Corona
..but..
I can connect to my work computer where git is set up properly but also I
can't git push
because I can't "cd" into the project path
because the samba mount point is messed up
because I don't reboot my machine to fix it
because I can't enter my password
because it does have a full hard drive encryption and the password screen shows up before the network services are started.2 -
Me: [jira comment] We have similar text for the mobile version of the site already. [includes screenshot of what site looks like now] Are you sure about this?
[radio silence for a few hours]
Me: [slack] I want to follow up.
Web Operations: What’s the issue?
Ooh k. Slack messages can have a tone.
Me: I just want to confirm we’re not repeating copy.
Web Ops: We’re not.
I complete the ticket and submit for review. The C-suite for my department reviews.
C-suite: [to web ops in JIRA comment] This looks weird. Is this right? [sends screenshot of my work because there is repeated copy, like I said there’d be]
Web Ops: [in JIRA comment] Oh, I thought X was questioning the request. X changed the wrong text.
C-suite: The website has always looked like that. You’re looking at X’s screenshot for the current website. Look at the screenshot I sent over.
Later, I complain because web ops was completely unprofessional with the comment about “questioning the request.”
C-suite: Web Ops is working hard. It’s our busy season and it’s their first time dealing with it. You know, I’m going to teach them some css and html so they can make content changes in the CMS and they’re not sending over changes so often and bothering you.
Me: [to myself] 🤨 wtf so it’s ok for web ops to treat me like dirt. And in writing. And with service that’s version controlled—JIRA emailed web ops comment to me. And lol no 😂 on teaching them how to code. That’s such bullshit. We all know you’d never allow them to edit the CMS because they’d fuck up the site. And they wouldn’t do edits anyway because it’s beneath them. And idk how this relates to web ops gross behavior.
A few days later.
Me: I was offered a job elsewhere. Here’s my two weeks notice.
C-suite: Can you push back your last day? It’s our busy season.
Me: Nope. Bye Felicia.1 -
I'm burned out and yet I'm trying hard to do anything useful that I push uncompleted code in different new projects without a README file or description of any kind.6
-
Serverless and death of Programming?!
_TL;DR_
I hate serverless at work, love it at home, what's your advice?
- Is this the way things be from now on, suck it up.
- This will mature soon and Code will be king again.
- Look for legacy code work on big Java monolith or something.
- Do front-end which is not yet ruined.
- Start my own stuff.
_Long Rant_
Once one mechanic told me "I become mechanic to escape electrical engineering, but with modern cars...". I'm having similar feelings about programming now.
_Serverless Won_
All of the sudden everyone is doing Serverless, so I looked into it too, accidentally joined the company that does enterprise scale Serverless mostly.
First of all, I like serverless (AWS Lambda in specific) and what it enables - it makes 100% sense and 100% business sense for 80% of time.
So all is great? Not so much... I love it as independent developer, as it enables me to quickly launch products I would have been hesitant due to effort required before. However I hate it in my work - to be continued bellow...
_I'm fake engineer_
I love programming! I love writing code. I'm not really an engineer in the sense that I don't like hustle with tools and spending days fixing obscure environment issues, I rather strive for clean environment where there's nothing between me and code. Of course world is not perfect and I had to tolerate some amounts of hustle like Java and it's application servers, JVM issues, tools, environments... JS tools (although pain is not even close to Java), then it was Docker-ization abuse everywhere, but along the way it was more or less programming at the center. Code was the king, devOps and business skills become very important to developers but still second to code. Distinction here is not that I can't or don't do engineering, its that it requires effort, while coding is just natural thing that I can do with zero motivation.
_Programming is Dead?!_
Why I hate Serverless at work? Because it's a mess - I had a glimpse of this mess with microservices, but this is way worse...
On business/social level:
- First of all developers will be operations now and it's uphill battle to push for separation on business level and also infrastructure specifics are harder to isolate. I liked previous dev-devops collaboration before - everyone doing the thing that are better at.
- Devs now have to be good at code, devOps and business in many organisations.
- Shift of power balance - Code is no longer the king among developers and I'm seeing it now. Code quality drops, junior devs have too hard of the time to learn proper coding practices while AWS/Terraform/... is the main productivity factors. E.g. same code guru on code reviews in old days - respectable performer and source of Truth, now - rambling looser who couldn't get his lambda configured properly.
On not enjoying work:
- Lets start with fact - Code, Terraform, AWS, Business mess - you have to deal with all of it and with close to equal % amount of time now, I want to code mostly, at least 50% of time.
- Everything is in the air ("cloud computing" after all) - gone are the days of starting application and seeing results. Everything holds on assumptions that will only be tested in actual environment. Zero feedback loop - I assume I get this request/SQS message/..., I assume I have configured all the things correctly in sea of Terraform configs and modules from other repos - SQS queues, environment variables... I assume I taken in consideration tens of different terraform configurations of other lambdas/things that might be affected...
It's a such a pleasure now, after the work to open my code editor and work on my personal React.js app...2 -
Because of the amount of complaining I do at work concerning legacy php applications the HOD is trying to push for different technologies to use for backend services. We have met multiple times to discuss the proper way of handling the situation since there are a lot of very obvious things to consider regarding the push for a new tech stack. The typical names have come about, but my biggest issue will be training people for these stacks.
Testing environments with docker and so forth, push for CERTAIN applications to be more API centric and the use of better frontend frameworks that will remain standard for years to come(hard to bet on this one but I tend to orefer React) among other things are the topics of conversation.
Personally I would love to move the shop to something geared towards Golang, thing is, the lead dev is complaining about it saying that the training for a new language would just take time. After a couple of examples he is still not convinced.
I think its wrong of him to center himself on just PHP and JQUERY as the main development stack he uses and learning new things should be part of the job, I also have a case against the spaghetti code that results from just using vanilla php with no proper development practices(composer based systems, oop etc etc you get the gist)
In the end I am starting to think that it will become one of those "fuck off I am the boss" type of deal since I am going to be here after a long time and he has about 2 years before he medically retire.1 -
So today my colleague is installing new dependency to our react native project and do something cool with it.
Him: I already push it in new branch and make a pr, would you review and merge it to master.
Me: ok let me try first.
.
.
Me: it is not working, i get this error.
Him: try change these xxx in xcode.
Me: ok, wait.
.
.
Me: now I get this error
Him: hmm... Try 'react-native link xxxx'
Me: ok
.
.
Me: I get same error like first error.
Him: now try 'react-native unlink xxxx'
Me: hmm... Wait.
.
.
Me: I still get same error, what's wrong?
Him: I don't know, it's working in my mechine .
*Me 'git reset - - hard' and try to build again.
**After building
Me: hey it's working after I git reset lol.
Him: nice
Me: let me clone it and try 1 more time.
*after cloning and building
.
.
Me: I still get same error like 1st error hahaha.
Him: so try to 'react-native link xxx' again.
Me: OKkK
.
.
Me: still get same error
Him: try git reset and build again
Me: hmm
.
.
*after git reset and build again
Me: I still get same error. I think the correct steps is :
1. Clone
2. Do something in xcode
3. React native link
4. React native unlink
5. Git reset - - hard
6. Build
I can't stop laughing 😂🤣😂🤣🤣😂🤣😂 -
I built a view engine that relied on V8 for expression evaluation and flow. Not very stable of course, since it used RegEx, but it worked fine for what it was designed for.
The crown feature was the ability to pass in lazy-evaluated huge objects to that view model, so that the view model decided what was going to be used in order to display the view. Made it really flexible, while not sacrificing speed.
I was brainstorming for 2 days about the lazy loading part, and the gymnastics that had to be implemented for this to work.
After I wrote my final line of code and thought that this is it, I launched it, and it FUCKING WORKED! First try!
I was hyperventilating, walking around the apartment like crazy, doing random push-ups just to try to utilize some energy that I felt was fighting to burst out like a xenomorph out of the chest.
... 2 weeks later I found bugs. Had to re-learn how I did it. It's true what they say: if it was hard to write, it's even harder to debug. Fixed it eventually, but that part's not that exciting. -
Ok finally, I can tell now.
There's a college project I'm in with 2 more people that uses Python and AnyLogic (separately).
We also need to write some LaTeX, so as I was already using PyCharm for the Pyshit, I used it for the LaTeX and for Git.
I used it for Git too because I didn't know how it used Git and was worried that if I used the console it didn't recognize something or glitched out or something. And what the hell, it's a mature IDE, what could be so hard or possibly go wrong?
I had to re download the repo a couple of times because between pushes, pulls, merges and commits something happened and the repo ended in a weird state.
These are all the things I do:
Add, commit, create branches, merge, push, pull and delete branches.
So, I hadn't opened in some time. The last time I tried to bring something from another branch, and stayed up late to finish something. I was waiting for my classmates to join the call when I thought something like "Hey, I should commit what I did until now, it worked great.". When I examined the IDE I found out I was in the middle of a rebase or something. I start clicking buttons to at least try to commit. I press "Skip Commit". I lose everything.
What the fuck‽ As you can see in the comprehensive list above, I never do something similar to a rebase. Apparently when I tried to merge a couple of branches, the stupid IDE thought I tried to do a rebase and never asked me to finish it. Why do something I have never asked? Plus, why haven't you prompted me to finish the operation? That's so stupid. I'm never trusting IDEs again.
I was so lit for losing so many hours of work I did a couple of weeks before, I would have to think it and do it all over again because of something I never asked.
We spent an hour looking for a way to recover the lost code.
Why an hour, you ask, if you can use the Local History for that in PyCharm?
Because none of us had used it before and the articles we found said that you had to open it from the toolbar. From the toolbar it was greyed out.
Then I found the option in the contextual menu of the files. Recovered the LaTeX files but on the AnyLogic files, it was greyed out.
I had to open the Local History of the folder containing the AnyLogic file.
And that was that.
I almost faint.
Fuck Python, fuck PyCharm.8 -
My team was asked to point to a mock service in our QA env. Standard procedure is to copy the line in our QA property file that has the service URL, comment one out, and change the other to the mock service. Then, push the code and deploy to QA.
What did someone do? He didn't touch the property file. He found where we were defining the configuration for our http requester, removed the property reference, and HARD CODED the mock URL.
Wait, it gets better. The mock service does not function the same way the real service does. We need to send an additional query param to the mock service (that has a value already being sent in a header) so they modified ANOTHER file where the actual request is being made.
He made the changes, deployed to QA, and didn't check in any code.
What is going to happen next time when we deploy to QA with the latest code? Oh look, we'll be pointing to the real service again.
I explained this to my architect, and included that this messed up mock service they were calling is our 2nd mock service (no idea why they made a new one) and he simply deleted the stupid 2nd mock service. Screw that!
And...now requests to QA don't work 😂 -
git suicide:
git() { if [[ $@ == 'suicide' ]]; then git reset --hard origin/master; git push origin master --force; fi }2 -
"Hi X, I'm getting some push back on a bigger hard drive seeing as you'll be on the only person in the company who has something bigger than 250GB. Are you able to give me the headline values of how you've used up 249GB so far please?"7
-
HR declared day as holiday.
You Resume work next day and Git commits channel had 400 unread messages,
Silently telling at you like - hmm lazy lots get back to work!
To the hard workers You could’ve waited to push your commits the next day brother, we know you don’t like holidays like we do. -
I'm currently having a problems sleeping my inner philosopher just keeps thinking about various things. I wanna try to write some of them down as an simply to see what will happen.
I'll write my opinion down as honest as possible so feel free to disagree, but point out what I should rethink, if you want me to consider it.
To me respect has to be earned. I think especially on the internet many people try to skip this crucial step when they try to get respect. Most often when they want an opinion or their ideals to be respected. Most of the time it doesn't even feel like they want to be respected, but rather accepted.
There's nothing wrong with accepted in my opinion, but there are several approaches to get to this point and I despise some of them.
Earning acceptance by earning respect is one of the right ways to do it. Working hard towards your goals, showing your individual strength, standing behind your ideals. These are things I can respect.
I should also mention that these Ideals should be concrete, based on rational thought and a general good will or you will just twist my words to say that I support e.g. IS, Stalin's politics ect.
On a side node, I think it'd be wrong to disrespect everything Stalin did, since, from an economical point of view, he pushed Russia forward by quite a bit.
Then on the other side I see crybabies. People who want to be accepted, without putting effort in their ideals. Most of the time not even aiming for acceptance through respect, but through pity. Honestly, that's all they're going to get from me.
Pity, for their petty ideals.
Basically all I ever see these people doing is attention whoring and practicing multiple deadly sins at once.
Wrath, jealousy, sloth, pride, greed and optionally also gluttony.
Lust is rather a separate package. When I think about it, I link it mostly to horny teens and "send bob and vegane" type of stuff.
Gluttony being powered by sloth or vice versa, enhancing it.
The clear image I have in mind, while I write about this packages of deadly sins however, is that of a jealous person, complaining / getting angry about something they could change change themselves, but want them to be changed for them. Mostly through social networks such as Facebook, Twitter and whatever the fuck Tumblr is supposed to be.
"I wanna be rich, why is <person> richt but I'm not? This world is so unfair 😡". Have you tried working towards becoming rich?
"I don't don't feel pretty. Accept me". Accept yourself. Done.
"I don't like <person or organization>'s doing". If that's the whole message, all you probably did so far is complaining or crying. Sweet tears.
Stuff like that can happen to any person, just like any person makes mistakes.
Mistakes are made to learn from them. If you realize realize and accept your mistakes others may do so as well and forgive you.
But we are he towards this idiotic trend where people just can swallow their pride even for microscopic things. They instead push their pride to higher levels of ignorance, blaming other people, l(ying)mfao, creating black holes of density in the process. Makes me wonder whether their real motive is an inside bet on who can get the most people to kill them selves by face palming.
Most of my life I have been fairly protected against these people, besides some spikes of incompetence, but recently the have invaded 2 areas in my world that make the world somewhat less of a pain. Programming and the internet culture.
Yes, I'm talking about that master / slave BS renaming and article 11 and 13.
The remaking itself isn't really the problem, but rather the context. This was basically a show of power for the self proclaimed "social justice warriors" or SJW for short.
The fact that this madness has spread. That's what worries me. To me it feels like the first zombie has spawned.
Then we have this corrupted piece of incompetent shit, called Axel Voss, and other old farts.
They live in a galaxy far away from reality, somewhere in the European Parlament, making laws they don't know shit about, regulating things they know shit about.
All in the name of the people of the EU of course. And by people we obviously talk about the money.
I can honestly not think of another reason, after reading the replies Voss and his party gave on Twitter regarding the shit they pulled off.
Well, at least none that doesn't involve some firm of brain death.
For now I'll show them as much as possible how much I despise / reject them. Currently playing with the thought of some kind (social media?) website were posts from other sites or actions in general can be rated only with "Fuck you"s.
Given these articles, I should not have them hosted in an European country though 😅.
Almost hitting that 5k character limit 😰1 -
Has anyone else found that not all USB C inputs are the same? You can't just buy an cable and expect it to plug into any socket.
1. I replaced the cable for a power pack, but the new one didn't fit my OP6 socket well, no clicking and have to push it in very hard to get it to charge, and still eat to fall out
2. The pixel 2 cable fits it nicely and all cables are ready to plugin and work
3. I tried charging my new Pixel 4a with ur though but very hard to plug in. Had to install the charger and cable that came with.
4. Amazon Fire takes all of them nicely and send all the others can use the cable that came with it too8 -
Playing ME:A, game froze, alt-tab out to try and close it, can see my mouse moving around but the screen the game is playing on is staying black. Whatever, shit happens, I'll just hard power off and reboot.
Powered down, push the power button, SSD isn't booting, being sent to BIOS. "Oh no."
SSD isn't listed in available boot options. "Shit." Checked the cables and what not, nothing, pretty sure it died on me. Go to Fry's to get a new 960 EVO m.2, sold out, go to the other one 30mins away that says it has one in stock, it doesn't either. 😧
Guess I'm ordering one online, Amazon says 1-3 weeks even with Prime, Samsung website says 1-3 days but no rush delivery.
Guess I'm computer-less for a while. (Unless I find something else before end of day)5 -
(I'm not completely sure of what I'm saying here, so don't take this too seriously)
Settling on a language to write the api for ranterix is hard.
I'm finding a lot of things about elixir to be insanely good for a stable api.
But I'm having a lot of gripes with the most important elixir web framework, phoenix.
Take a look at this piece of code from the phoenix docs:
defmodule Hello.Repo.Migrations.CreateUsers do
use Ecto.Migration
def change do
create table(:users) do
add :name, :string
add :email, :string add :bio, :string
add :number_of_pets, :integer
timestamps()
end
end
end
Jesus christ, I hate this shit.
Wtf are create, add and timestamps. Add is somehow valid inside the create, how the fuck is that considered good code? What happens if you call timestamps twice? It's all obscure "trust me, it works" code.
It appears to be written by a child.
js may have a million problems. But one thing I like about CJS (require) or ESM (import) is that there's nothing unexplained. You know where the fuck most things come from.
You default export an eatShit() function on one file and import it from another, and what do you get?
The goddamn actual eatShit function.
require is a function the same way toString is a function and it returns whatever the fuck you had exported in the target file.
Meanwhile some dynamic langs are like "oh, I'll just export only some lang construct that i expect you to specify and put that shit in fucking global of the importing file".
Js is about the fucking freedom. It won't decide for you what things will files export, you can export whatever the fuck you want, strings, functions, classes, objects or even nothing at all, thanks to module.exports object or export statement.
And in js, you can spy on anything external, for example with (...args) => debugger; fnToSpyOn(...args)
You can spoof console.log this way to see what the fuck is calling it (note: monkey patching for debugging = GOOD, for actual programming = DOGSHIT)
To be fair though, that is possible because of being a dynamic lang and elixir is kind of a hybrid typed lang, fair enough.
But here's where i drop the shit.
Phoenix takes it one step further by following the braindead ruby style of code and pretty DSLs.
I fucking hate DSLs, I fucking hate abstraction addiction.
Get this, we're not writing fucking poetry here. We're writing programs for machines for them to execute.
Machines are not humans with emotions or creativity, nor feel.
We need some level of abstraction to save time understanding source code, sure.
But there has to be a balance. Languages can be ergonomic for humans, but they also need to be ergonomic for algorithms and machines.
Some of the people that write "beautiful" "zen" code are the folks that think that everyone who doesn't push the pretty code agenda is a code elitist that doesn't want "normal" people to get into programming.
Programming is hard, man, there's no fucking way around it.
Sometimes operating system or even hardware details bleed into code.
DSLs are one easy way to make code really really easy to understand, but also make it really fucking hard to debug or to lose "programming meaning".7 -
I used to blast throught everything accademic in a really short time span. I used to push hard on the gas pedal since my college years, up to my bacheler degree. I was always on schedule with every exam, even graduated top of my class and first amongst my colleagues. But then, I felt the urge to change university, I moved out of my parent's home, in a far away city, and everything simply collapsed. All of the sudden, not only was I struggling with my exams, but, most importantly, I started struggling with telling the truth about it. I constantly felt in debt of my parent's efforts to put me through university, to have given me a chance. This caused a strange feeling in me, it was similar to a weird form of depression, I was unable to...act. To do stuff. To even wanting to do it. I started procrastinating everything. I lived at my parent's expenses in this far away town but all I could do was playing videogames. I somehow managed to get to the point that I only had three exams left plus my thesis, but I did this by avoiding all the real hard exams, somehow cheating myself. I was already two years behind schedule at this point, and willing to quit. I was desperate, I cried a lot, thought about running away fron everything as I fear the disappointment I would have caused by simply telling the whole story.
Thankfully I met my girlfriend who helped me realize all I needed to do was move back to my former university and take it step by step from there onwards. I almost didn't make it...again. But I was able to pull throught, I worked during the day, wrote my master thesis early in the morning and late in the evenings. I gave it all. And I made it.
I graduated last year and got a job in the industry. I don't feel as useless anymore. I still fear and dread what the burnout made me feel. How it almost destroyed all confidence I had in myself.
Tldr; I burned out right after getting my bachelor degree. And I stayed like that for years, up to the point that I ended up being years behind schedule. I was able to recover thanks to my gf but still fear and dread those feelings I had when I burned out. -
!dev
Personal rant, but as one shouldn't bottle up emotions, probably not so bad idea....
Started with diet and exercise in the vacation, as finally a certain thing starting with C calmed down...
Its maddening how fucked up the world is. Now as a lil private info (that might not be so unknown, shared multiple times here) - my body is a train wreck.
Lungs are fucked, muscle distrophy, some other things are fucked.
I'm the kind of thing every gym trainer dreads - the client that needs not only a lot of ass whooping, but also has a lot of problems that need to be taken care of.
Which is why I rather do exercise at home, cause... My experiences with humans in gyms are bad. Most trainers behave like fucking chimpanzees screaming commands while not listening what one tells them...
First challenge: Find a low impact cardio training.
What one mostly finds is a female chick (which is sad cause I like men more for obvious reasons), that should gain some weight, screaming at ya how great sport is while jumping around like a bunny on ecstasy.
Low impact isn't really low impact when you jump around, lil bunny... And it isn't low impact when you just let yourself fall to the floor and start doing push ups.
If an obese person like me did that, it would end in pain, frustration and an empty fridge TM.
So one has to painfully look and skip through 20 min vids of "Non low impact low impact YouTube / ... vids" to find one that is doable without wrecking the body even further... Yaaaay. That makes one totally not feel depressed :-)
The other thing that I always hate is dieting. Note that I don't have to change much - I'm basically on a diet since years, holding weight the whole time.
The jolly fun is that I can't take off with just an diet. If you never heard that such thing is possible, a lil advice: It is possible. Nothing hurts more than being told that eating less solves all problems magically - cause it doesn't.
What I usually need is added protein, as I suffer from muscle dystrophy in my left side. (hence the low impact vids).
If you go to a grocery store, you most likely find *tons* of protein stuff.
The fun thing is that roughly 80 % of that are - like all things in a supermarket - completely bullshit.
I know one could avoid using protein powder / ... - but that makes dieting a very very very hard task, as one has to not only do a lot of planning, but cooking and eating becomes a depression palooza... It just doesn't make fun when you have to scale components for every meal or force yourself to eat e.g. 250 g of low fat curd cheese to gain the necessary proteins.
Why is supermarket stuff so shitty....
Added sugar / saccharides . When one has been dieting for long for health reasons, one finds out pretty quick that most products (especially those labeled as healthy / fat reduced / "weight loss") are perfectly made to lead to a sugar crisis and binge eating.
I've found protein drinks containing up to 25 g of sugar per drink (330 ml).
A coke has 27 g of sugar per 250 ml...
:) Now isn't that jolly...
I've found my stuff of joy not so long ago (not advertising here, but depending on flavor it has only up to 3 g (!)) of sugar per drink)...
It just annoys me and pisses me off how much money is made - in my opinion deliberately - on the suffering of other people...
Most laws by the way end up being blocked by lobbyists - most nutrient scores etc are just "wrong" or better to unspecific... Making exploitation pretty easy.
It's funny how everyone has an opinion on obese people, everybody is pointing fingers and explaining how stupidly easy it is to take off... And at the same time no one gives a damn about shit like that.
That's all folks. Feeling better now.
By the way, I'm doing fine. I lost 7 kg already, though the train wreck of body was pretty pissed the last two weeks as everything hurts.
Another reason why motivational speeches are dumb in videos: Pain isn't fun. :)1 -
So this month I had to do two major features which required unexpected refactors and I had to handle unexpected edge cases all over the place. Since I work in another timezone and time was of essence, I was kinda working around the clock to complete refactors as fast as possible because it was "important and critical". I have 7 other devs in my team but only half of the team are actually competent and even less are motivated to push through. Most of the team prefer to sit on low hanging fruit tasks and cant even get that fucking right.
So that resulted in me doing at least 100 hours of overtime this month. Best part all I got for pulling it off was a thank you slack message from teamlead and got assigned even more work: to lead a new initiative which seems to be even bigger clusterfuck...
So today I had a sitdown with my manager and I asked for 3 paid days off and told him that I did 50-60 hours of overtime. He okayed it as long as my teamlead was happy.
So I created a chat, adder manager and teamlead to it and explained my situation. That Im feeling burned out, I need 3 days off and combined with the weekend that should allow me to finally relax.
My fucking teamlead told me that these days are mine and he cant take them away from me. But then he started guilt tripping me that no one else will be working on the new initiative these days so we will have a very tight timeframe to deliver this (only until August).
Instead of having at least a drop of empathy that fucker tried to guilt trip me for taking days off for fucking unpaid overtime. What a motherfucker. Best part is Ive talked with manager and we actually have until end of August to deliver the new initiative, so fucker teamlead is gashlighting me with false sense of urgency.
I guess a hard lesson learnt here. Waiting for my fucking raise to be approved for the past 6 weeks (asked for a 43% bump which is on the way since I got very strong positive feedback).
So Im done. I proved myself, will get the salary of which I only dreamed about few months ago. Not putting any overtime anymore. If something is very urgent, borrow fucking decent devs from another team. Or replace half of our useless team with just one new decent dev. I bet our producticity would increase at least by 50%.
Its not my fuckint fault that 2-3 people are pulling the weight of 8 people team. Its not my responsibility to mentor retards while crunching under immense pressure just because current processes are dysfunctional. Fuck it. Hard lesson learned. If you want overtime, compensate with extra days off or pay. Putting my 7-8 hours in daily and Im not responding to your bullshit slack messages or emails after work. I dont give a fuck that you work in another timezone and my late responses might result in stuff getting done postponed by a few days or a week. Figure it out.2 -
What do you do when you're trying to push yourself further by learning new concepts and techniques but start to feel the burnout closing in?
Usually I'm useless for about week if I push myself too hard. Would love to overcome this.
How do you guys handle this?4 -
I went to an interview a few days ago, just out of curiousity, even though i was sure that i won't be getting any "android developer jobs" there . it was a mega job fair. in one company, me and my friend neil(fake name) went. the interviewer guy was willing to give neil a package upto 10LPA (its a great offer for freshers in my country) based on his current skills of php js, react,angular, ... web stuff .
I had this assumption( and neil did too , we both kind off had the same mindset) that a company teaches us things, we just have to be a little famous/accomplished. So i thought why not? i am accomplished. i got 2 apps on playstore, i am an AAD certified Android dev and know a lot of android stuff, i am quite famous. i am equally as deserving as neil.
But what happenned was something different. When my turn came, the interviewer said " If you have no knowledge of phy/js/node/angular, why are you sitting here?" to which i said " i presumed company would teach me, since i bring some level of expertise from other fields"
so he told me some hard truths **"Companies are fast paced. they don't have time to train you in everything. we seek for candidates having some level of knowledge in the domain, so that we could brush up your skills, increase your knowledge to current requirement and push you to production engineer asap, so that you could be worthy of your salary"**
This is completely correct. i have stuck myself in such a career that its very difficult to sell myself for other job profiles. And from what i have seen, companies seek a very high level of proficiency in this field and rarely recruit freshers( or even if they do, salaries will be aweful)
. Now i am so unsure about what to do next:
A.) keep learning more and more of android and look for job in it. And even if am getting an aweful job offer, just sulk and take it
B.) do open source work/gsoc work?( its a good way to earn more recognition/stipend/knowledge and sometimes even job offers)
C.) learn web dev, data sciences, blockchain, cloud or other stuff that i don't yet know
D.) go back to ds algo / competitive? (because having good competitive knowledge is a safe zone. you are assumed as apure fresher with 0 level of practical knowledge but good level of mathemetics)
I know i am going suck in all of the above except maybe (A) or (B) because (C) is something that am unsure would grab my interest (and even if it did, i am sure i need another 1-2 years to be somewhat good at it) and (D) is something i myself know am uncapable of , i am an average shit in maths(but might mug it all up if i pull all nighters for 1 year)2 -
What's with the updates in our technology ? has it always been this situation that Computer manufacturers stop providing upgrades after a few time?
Like android tries hard, but no device older than 3 years is going to get the latest android . i phone guys say they get the latest ios on iphone 6 plus, but isn't that also like 6 generations later device?what about iphone 4s or iphone 3g or iphone1 ?
So far i guess microsoft and laptop manufacturers are winning at this area... i believe i could find some peeps with their 10 yo fatass pc running win 10 . Or maybe iot, i am not sure but i wonder if those microwaves won't be compatible with the latest version of whatever OS they are using (if there is a mechanism to update one)
I was actually reading about the operating systems. My point regarding this post was that the OS's have been architectured to be modular and h/w independent for years . Nearly every OS has this HAL layer which literally has the function to abstract hardware and give apis to system such that whatever the hardware there is down below, the system would not have to worry.
So why does new updates to the os not pushed to older devices? why do manufacturers give the reasons that we don't push updates because the hardware is incompatible with the os?13 -
if spinlaunch can make spinning machine that is able to push ball hard enough that it would travel to moon we can build another one on the moon and travel trough solar system like pinballs lol2
-
Git is overrated. There's absolutely no good reason that `git add` should be default to call before `git commit`, if people don't want files added that should be the exception not the rule. But where it all really falls apart is mono repos. There's no good way to make a repo inside a repo, which is fucking stupid. There's no good way to clone just a chunk of a repo, which is fucking stupid. And -- just in general -- every aspect of git feels like it wasn't designed to be usable. For instance: there should be a command `git save "message"` which does the default `git add ., git commit -m "message" git push`. Or rebasing, that doesn't need to be so hard at all.
This is just a rant and all, but I'm so tired of git being clunky and poorly designed from a UX perspective. And not supporting mono-repos for shit.13 -
I think I just realized what my biggest gripe about our career paths that I hate the most.
This is something that has worsened over time, especially the last 2 to 3 years.
As developers, we have far too many options. Some of the most powerful apps are written with languages that have hard, and I mean HARD, guardrails in place. If the app is written in a language that does not meet this criteria usually a framework has been used to install those guardrails.
We just get our minds so wrapped around the possibilities and the opportunities in the software, that we just can't focus on the end result. We're like puppies that are excited about something and we just piss all over everything.
In my career I have met far too many developers that don't have the capacity and mental fortitude to take control of their actions. Because of this I think the only way for us to stop this corruption, that I feel we are nurturing, the solutions/services that we use need to push back on us and install those guardrails for us.
All this came from a change that Microsoft put in place that seems well intended, but introduces yet another choice and a multitude of opinions in how you release code.
It used to be a simple check box. If it was checked it was pre-release, if it was unchecked it was a production release. That's it. On or off. The simplest choice you ever needed to make on a release.
Now though, there are two check boxes. One for a pre-release and one for a latest release. You can also not check either for some "ephemeral" release? So now something as easy as on or off has been made into a difficult decision on how this works within my pipeline. Now every time I make a release I have to ask myself, "which one do I check?"
I shouldn't need to spend more than a second to identify a path forward on simple shit like this, but here we are with a third choice.
Can we just stop overcomplicating shit?6 -
Taht moment when you finally have time for that github project, when you done all your changes requested, and you're proud that your local tests are all green... you commit into that project, you push it real hard , long and passionately deep...
and then i apparently hit travis in the nose... Cause he keeps running for -undefined ipunchedtravisonhisnoseapparently build runner forever mypullrequestwillneverseethelightofday continuousidiocy -
God damn...if you want to be a developer learn using git and fucking STOP messing up the repo every time you push something.
Understand the importance of branches and use 'em so the problems you're causing are isolated and stop commiting / pushing on master....ITS NOT THAT HARD TO READ THE FUCKING CONTRIBUTION GUIDELINES!!!3 -
I had mistakenly added a large file to a commit, and I'm now spending 3 hours of my life just to remove it and being able to push.
I've deleted the file from tracking, but it remained in history so when I try to push, github rejects to continue.
And, still worse, trying various solutions on StackOverflow I've done a mess on the history which now looks unrelated to the remote one, and I think it's a never-end catastrophe.
It's absurd how badly designed is git, and how hard it is to use besides the 3 commands that you learnt by heart16 -
floating point numbers are workarounds for infinite problems people didn’t find solution yet
if you eat a cake there is no cake, same if you grab a piece of cake, there is no 3/4 cake left there is something else yet to simplify the meaning of the world so we can communicate cause we’re all dumb fucks who can’t remember more than 20000 words we named different things as same things but in less amount, floating point numbers were a biggest step towards modern world we even don’t remember it
we use infinity everyday yet we don’t know infinite, we only partially know concept of null
you say piece of cake but piece is not measurement - piece is infinite subjective amount of something
everything that is subjective is infinite, like you say a sentence it have infinite number of meanings, you publish a photo or draw a paining there are infinite number of interpretations
you can say there is no cake but isn’t it ? you just said cake so your mind want to materialize something you already know and since you know the cake word there is a cake cause it’s infinite once created
if you think really hard and try to get that feeling, the taste of your last delicious cake you can almost feel it on your tongue cause you’re connected to every cake taste you ate
someone created cake and once people know what cake is it’s infinite in that collection, but what if no one created cake or everyone that remember how cake looks like died, everything what’s cake made of extinct ? does it exist or is it null ? that’s determinism and entropy problem we don’t understand, we don’t understand past and future cause we don’t understand infinity and null, we just replaced it with time
there is no time and you can have a couple of minutes break are best explanations of how null and infinite works in a concept of time
so if you want to change the world, find another thing that explains infinity and null and you will push our civilization forward, you don’t need to know any physics or math, you just need to observe the world and spot patterns10 -
No matter how hard I try within a certain time window only certain options are available and unless I practically kill myself
Its difficult to push hard and far enough to get blessedly out of sync with the slave machine -
"I prayed to God for a bike, but i know God doesn't work that way. So i stole a bike and prayed to God for forgiveness"
- Italian mafia drug boss Al Pacino
This made me think about something. If by my 26 years of existence God has NOT rewarded me just once (by being successful and escaping the matrix) in spite of my hard effort of trying to do that on a legal and fair way... Could that mean that I'd have to switch teams? Join the dark side?
Like how the fuck does satan help you achieve materialistic shit (including success) but God doesn't. Does that mean i should worship evil side so the evil force can push me to escape the matrix in any way possible, and once that's done and i escaped the matrix thanks to the force of evil then i leave this dark team and switch back to the light team, the God team and then pray to God for forgiveness?
Is it possible?
Like temporary worship of evil and then pray to God for forgiveness later cause that's how God works apparently30 -
I am in my final year of CSE degree, and it's that time of the year when I have to prepare for placements. I need motivation. I need to work hard. I need to push hard. I am not sure if I can practice hundreds of coding problem. I do not find every other question interesting. Please motivate me to work hard.1
-
We use Sequelize. This is how we do database structure changes:
- I create/change a model in Sequelize, and let it change my local database, then I do work on that
- I push the new code to a remote branch
- my boss/CTO/lead dev then manually creates/changes the relevant table(s) in our staging database
- I finally merge the branch I originally developed into the remote branch
- boss checks that everything is working
- at last, boss does the same process of modifying/creating tables in production database
- finally, staging code is merged into main
So right now:
- I'm changing a feature, forgot I was editing in the main branch
- go ahead and create a remote branch for it, pull locally, checkout local version of newly created branch
- try to run code
- oops, there's a missing column in one of my local database tables
- ask for boss for SQL script that will create the missing column and potentially add more data or whatever
- waiting for boss to respond
H-how can we improve this process? Boss has talked about us moving to use migrations but we never ended up doing it. I don't know much about migrations either. This is gonna suck so hard.3 -
Sometimes I wonder we make too much or at least the devs at corps.... (Not a bad thing...)
But compared to everyone else like chefs, teachers, builders, scientists, etc that actually need to revert physical labor... We just push buttons all day or half the day...
Just looking over this month's income... Basically only spent 10%...
An I really worth that much... To me the work I do isn't hard... Or don't see how it connected to the bottom line...11