Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "#im back"
-
First off I dont mind what OS you are using. This rant isnt about the OS but about hypocrisy for some of the users. Secondly Im sorry for typos, I typed it on my phone while waking up.
People are calling Windows spyware, so they are using Linux or MacOS. Even though I disagree with the term spyware I would be fine with that if you weren't a hypocrite.
How many of the people who use Linux and call windows spyware uses Google, Apple, Facebook or Twitter once in a while? I highly doubt you if you say you don't.
A few years back Ive tried to live without anything of google, this also meant blocking YouTube, their trackers an javascript libraries.
Not much of the internet still works if you block google servers.
Google is everywhere and always collects data.
Facebook and twitter also collects data about you. Everyone who has your number in their phone will share it with Whatsapp and google so they can build up a profile. Even if you dont block it.
What I am telling you is that its impossible to avoid being tracked by these companies (including MS).
Every company I mentioned here has a profile on you, if you want it or not.
So let's check which of these companies tries to follow European laws.
Google gets fine after fine but doesnt really try to avoid it.
It looks like Apple, MS, Facebook and Twitter are doing it better on this.
But if you check the European law every European citizen is allowed to request their complete profile collected by a company. And that means complete and not the public part you volunteered to give away.
So I tried it out.
Google didnt want to give it, apple didnt want to give it, Facebook didnt want to give it and Twitter doesnt want to give it.
The hypocrisy is becoming clesr with the following. I did get my complete profile from MS. It was a messy PDF file which crashed most PDF readers.
It contained a list of people I know and how I know them. It contained MS accounts I had in the past and my hobbies. (and quite a lot more)
So from these big companies MS is the only one following the European Law.
So yes they do collect data, but they are open in what they collect.
And Im not saying here that Microsoft is great just because they follow the law.
You can have your own opinion about this and do with it what you want. I just wanted to share some, maybe alternative, facts.
And again this isn't an OS rant or whatever. I dont mind what you do, but I do mind hypocrisy.18 -
Back in the days...
Parents: get off that computer it will get you nowhere in life!
Me:But im programming not playing games..I want to become a programmer...
Parents:programming or games it's all the same! Take an example of your sister who actually achieved something with her studies (she's a doctor)
Me today asa computer engineer...receiving paycheck higher than my sister who is a doctor and not to mention I got a car of the company and living very comfortably.
Parents can't believe it.
#rekt
Moral of the story: never let anyone tell you what to do. Keep doing what you truly love and get real good at it!😉13 -
So my Girlfriend bought a new iPhone at Verizon today. Cool story, I know, but here's where it's gone from there.
Firstly her debit wouldn't run as credit, so we used mine but that's the least of it (but began it).
So she has 16,000 photos... Alot, sure, but not the issue. Obviously with that amount of data she wasn't about to reasonably use iCloud to back it up (understandable only by me) so she was confronted both by me and the Verizon employee about this issue to where we both (the Verizon employee and I) agreed that an iTunes backup/restore was the only way to preserve her data. She was confused. No worry, told her I had it handled and the Verizon employee agreed. Great. Yet we get home and begin the process. My girlfriend was not on the latest iOS (understandable given the battery scenario and she was on an iPhone 6) and this was ridiculous to her because she had to update in order to do the iTunes back up. Whatever, I brushed it off. Her phone was updated, and backed up... Which took a while but we are talking 30gb (of which she had no understanding of how much that was). After the back up we discovered her new phone wasn't working due to a bad sim, great, no problem we have the old one... But oh no. "I don't want that shitty old sim" she said. Uhmm what... I say, and say let me get an earring (to switch the Sims) and she gave one to me and as soon as I went to pop the tray, she had a fucking heart attack as if I was demolishing her phone. I talk her down, get it switched, get the phone to restore (slow process as she's complaining... 30gb mind you) and it works. She goes to bed. Comes back, texts aren't working. I say imessages or texts (now she has no idea) I troubleshoot, seems nothing's working, and that's okay Verizon must of reinstated the new sim and deactivated the old (fine). I switch them and it works. She proceeds to berate me about the SIM cards because she didn't want the 'old shitty one' (the one that got us to the place of a functioning phone).
Now everything works and she claims a Genius bar employee would of done this in minutes.
I (obviously) lose my shit, now I'm sleeping on the couch.
Im an IT professional / programmer..... this shit really ticked me off.38 -
Do not continue reading if you value your life.
Visual fucking studio 2015 installation. MOTHERFUCKER !!!
OK new project will only work on VS2015. Need to download it. OK, go to MS website. Project works with community edition. Fucking great. Download the installer. Run the installer. MOTHERFUCKER DON'T OPEN THE FUCKING BROWSER TO THANK ME, YOU FUCKING FUCK. Ok...Wait to download the packages. One fucking eternity later download completes. FUCKING GREAT. Proceed to package installation. After two fucking hours installation progress bar stays the same. Google "vs 2015 installation stuck windows 7". MOTHERFUCKING BACKGROUND PROCESS IS FUCKING STUCK AND INSTALLATION DOES NOT CONTINUE. FUCK YOU. I'VE LOST TWO HOURS. OK, stop the process. Installation gets cancelled. Run the installer again. STOP THANKING ME YOU PIECE OF SHIT :@ OK, check again all downloaded packages. All good. Continue with installation. Installation completes. MOTHERFUCKER WHY YOU WANT TO RESTART THE WHOLE SYSTEM ? FUCK YOUR WINDOWS UPDATES. Ok, restart and be done with it. SSD to the rescue. Try to set up the project.
MOTHERFUCKER I DIDN'T INSTALL THE C++ PACKAGES. WTF WERE YOU DOING ALL THAT TIME? OK, run installer again and install C++ packages. I SWEAR TO GOD MICROSOFT, IF YOU THANK ME ONE MORE GODDAMN TIME, YOU'RE GETTING HATE MAIL.
Ok, installation completes. It's coding time. NO BITCH. VS2015 silently crashes after splash screen. :@@@ Google wtf is wrong again, turns out the C++ packages fuck shit up. Ok, pass some arguments to devenv.exe to reset. Restart VS. Ok, seems to be working now. Make a test project. Fucking awesome. Close VS and get the project files from perforce.
OK, files downloaded. Open VS again....
VS: "You're my bitch, you won't code today. Run from console and pass some shitty reset parameters"
YOU FUCKING FUCK. GO FUCK YOURSELF UP YOUR FUCKING ARSE. Ok, pass the parameters from console. Run again. Same "you're my bitch message" :@ OK, run with administrator rights, opens like charm. Run without admin rights again, "you're my bitch message". :@@@@@
Restart system, VS2015 finally opens project normally. Build project, 6934 errors.... :@ I'M DONE ! IM GOING BACK TO LINUX PROJECT. FUCK YOU ALL.18 -
Back in 2011 when I was 14, I created a cmd shortcut on all pc in my school's computer lab. Replaced the icon and renamed it to Internet Explorer. Deleted the original IE shortcut and a week later the lab got closed because they all the computers got infected with a "virus"
i know im lame kill me7 -
I came from a village, we have animals (like a farm), pigs, chicken, sometimes duck and goose. One day I had to work from home, bc had to come back to parents house. Our daily skype meeting was like this:
* discussing very important IT stuff *
* grandma rushes into my room *
me: sorry, but i have a meeting
grandma: i just wan...
me: but i cannot right no...
grandma: just wanted to know if...
me: grandma, I cannot right now, we have a skyp... im talking with colleagues, on the computer
grandma: * quiet voice * okay, i dont want to interrupt, I just want to know - Did you ordered the ducks?
* what I hear in headphones: collegues and boss LOLd sooo hard *
me: ffs, what ducks?
grandma: did your father not give you the guys number?
me: * starting to sweat * what guy? no he didnt, i have no idea what youre talking about
grandma: * disappointed * then who gonna order them...?
me: ...
grandma: * standing next to me, she hears the laughter * whats that?
since then, if im working from home every skype meeting starts with "Tommy, is your grandma there? HAHA!"7 -
How I went from loving my job to wishing i dont wake up tomorrow just to avoid it.
Ive been a backend dev in the company im at for 2 years now.
First year was a blast, i loved my work so much, I used to get so many random features to do, bug fixes, campaigns, analytics, etc..
Second year i started getting familiar with the part of the code that has to do with Search in our music streaming app. Nobody wanted to work on it, so i wanted to take initiative and start doing a few tasks.
A few tasks turned into sprints, and sprints turned into months worth of sprints. And because the code was the definition of tech debt, and because it was so messed up that changing one thing can blow up everything else, working on Search was not too fun.
However, people seemed to be happy search tasks are no longer piling up and someone is handling them so that used to make me feel good about it. They also gave me so much freedom and i felt like my own manager because no one told me what to do (not even my actual manager) they just let me be and were happy i was handling the part they want nothing to do with. I was also given an intern to mentor and have her work on Search tasks with me which turned out amazing.
During the last few months, I completely rewrote search, made it 10 times more performant in such a neat way, made an inhouse dashboard to automate certain tasks so we wont need to waste developers on them (all of which were extra effort on my own time without being asked), all meanwhile still tending to the fixes of the old implementation.
I felt so accomplished, and in a way, i felt like a lead (even tho im not managing any employees, i had so much freedom and I was literally responsible for everything about Search and if i decide to play with the sprint task order i can even do that).
Then 6 or so weeks ago my manager left the company, and while i thought id be a standalone team / person (single person teams are not uncommon in the company) i was instead put under someone else. Someone who likes to micro manage the fuck out of me. I have been happy working on shit code because it was my baby, my project, no one interferes and no one tells me what to do and everyone would call me the search lead (unofficially). now if i dont report to that guy every two hours he calls to see if im working. preplans sprints i no longer have a say in, and im the only dev who knows the code so all tasks go to me. I feel i got demoted so fucking much. I felt like a lead on a project and now im back to being a normal code minion. From deciding everything about a project to blindly following a some irrelevant manager's opinion. (who btw is making Search worse) And after all the extra effort i put in, after actually caring, after actually embracing Search as my responsibility i get rewarded with losing everything i liked about my job...My Independence. From feeling like a lead to feeling demoted. I am so demotivated.
I love the company, but this is hell for me and this made me hate a job i always loved. I am thinking of talking to the CTO asking to work on other stuff because i no longer want this. If i am to be a code minion at least let it be on code i like, let me go back to dealing with PMs, fuck my new manager I dont wanna work with that guy he can take the project along with all its poopoo.16 -
TLDR; funny revenge prank from my manager
So yesterday (April 2) I decided to prank my manager about me resigning (I've been working with them for 4 years) I wrote a legit looking resignation letter. (No signature) and at the back page it has a small font "April fools".
I asked my junior to help putting it on my managers desk since I was working from home. When my manager saw it he immediately had a meeting with my technical lead. he didnt notice the april fools at the back so I sent him a short email to look at the back and he laughed.
Come today, I recieved an email from our it team with the subject "POST RESIGNATION PROCEDURES FOR JUNNERS". It has some legit looking contents as well as a hyperlInk for a resignation checklist.
It felt like im having a mini heart attack since I thought it was legit. When I opened the hyperlink I was shocked.
I love my job 😂6 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Continued…
The company that I’m working for has done lots of subtle racist things surrounding diversity policy. There was a major blowout between execs and suddenly all went quiet. The guy that was hired against my recommendation was gone. Until early January when he showed up at our building to raid our kitchen. WTF. It turns out HR decided to move him to the other office and out of sight so my team wouldn’t see him. He isn’t working on a project and is getting paid on the bench for more than the 100% billable devs.
After I saw him bumming around, I replied to a recruiter that has been trying to recruit me to their company.
The position pays 25% more 😲 and comes with a an amazingly relaxed development environment. Developer time is managed and allocated by someone in a dedicated role. 80% of the time is sprint work and the rest is self-driven projects or learning. Teams are stable, mostly local, and there is very low turnover. Developers get Mac or Linux computers.
I’m doing an executive meet and greet at the other company tomorrow. They will be the ones that will make me the final offer. I feel pretty good about it too because they will let me sign up to start in a month and a half so I can give a long notice, work until the end, and my current company can hire me back as a consultant in a pinch. It softens the blow for my current company and it makes it easy for me.
Worst case scenario I don’t take the position but use it for leverage. Who am I kidding? I’ll definitely jump ship when negotiation is done tomorrow.
https://devrant.com/rants/2338969/...7 -
Man, we have a snake in our company.
This snake is responsible for terrible code. They oversee a offshore team, but hold them to no coding practices. They don't do code reviews or checks. They let them be lazy and get away with sloppy work every time.
And if you critize their team - they will defend them and get angry at you. You can't adress the problem because said snake is always around. He's in a senior position for giving our company cheap workers, doing years of damage to our product while the non-code savvy managers remain blissfully unaware of their product being ruined in the background.
This snake is the senior product office. He has a share in the company now. He is from the overshore team's country. That team now has their claws so dug into our companies roots and are just pumping lsd's into it constantly. Feels good untill you die from an overdose.
Here I am, the new junior software developer, trying to tear out the claws that have sunk into these roots. Im up against the snake. The snake hates me. I hate the snake. I am trying to open the eyes of the managers. They hate that. They want to silence me so I don't expose the awful, unprofessional level of work they do.
Well, that's too bad. I won't back down from this, snake.14 -
As a full time remote employee it gets lonely. Im getting ready to turn my home into a co-working space :
* Plenty of space with tables and couches
* Gigabit Internet backed by enterprise networking gear
* Lots of fresh ground coffee
* Local Kubernetes server !
* dog friendly chill space
* kid friendly play areas during the summer
* Mountain home with backyard hiking trails , wildlife lookout (wild deer live in my back yard), and fireplaces
What else would you want in your co-work space-at-my-place (TM)?12 -
Fuck YOU Xcode!
20 crashes since I started working this morning.
Restarted the iMac, same shit.
Cleared NVRAM/PRAM whatever its called, same shit.
Closed EVERYTHING, restarted iMac again, unplugged from the wall, left it few mins, replugged back, turned it on, continued working, AND IT STILL KEEPS FUCKING ME OUT OF NOWHERE.
FUCK THIS, FUCK XCODE, FUCK APPLE, AND FUCK WHOEVER DARES TO THINK THAT ITS A GREAT PIECE OF SOFTWARE, im done.
P.S. this rage got me to a point where i had to make this paper13 -
We recently got a new trainee (Not sure if its correct germans correct me i mean "Praktikant"). This guy studied computer Engineering and canceld his studies to work as a developer. So this guy is working on a typo 3 Page for a Client and asks me for help because He got a follding error. Im in the last year of My studies btw. He sends me very Bad formatted HTML template file. I quickly correct the formatting and fix the 3 open Tags That He forogt to Close. send it back to him and walk to his workplace to See him integrate it to his own code again. He Double clicks the HTML file an Google Chrome opens. He then looks at me and says and Where is the code. I say to him That he just opened the HTML file with his Browser. And He responds with yes but i wanted to See the code Not this.
Im done for today 😑😑11 -
When pandemic hit in 2020 I found myself out of work. Until then I used to have a java based pirate gameserver of a MMORPG as a hobby.
When pandemic hit I noticed that online players count increased from like 70 to 200 without much advertising because purely of people being stuck in home. So i decided to scale and spent 2 years with that. What a wild ride it was.
So i invested a bit in ads, managed to reach around 500 online players, opened my own company and launched a couple other successful spinoffs of that gameserver.
First year it was a goldmine but I was doing 10-14 hour days because I had to take care of everything (web, advertising, payment integrations, player support and also developing the server itself, ddos protections and etc.). I made quite a bit of money, saved for a downpayment for mortgage and got an apartment.
Second year I noticed that there was a lot of competition and online players count dropped, but I double downed on this and invested a lot into the product itself and spent most of the time developing a perfect gameserver that would be the big bang while also maintaining existing ones. Clasic overengineering mistake. As you can guess, I crashed and burned on all levels, never even managed to launch my final project because simply the scope was too big and I had trouble finding decent devs to outsource it to, since it was a very niche gameserver.
In the end I learned a lot especially about my own limits and ownership, now Im back to being a dev but working as a contractor.
I believe having actual business owner experience allows me to have different perspective and I can bring more to the table rather than focusing on crunching tasks.6 -
This is my most ridiculous meeting in my long career. The crazy thing is I have witnessed this scenario play out many times during my career. Sometimes it sits in waiting for a few years but then BOOM there it is again and again. In each case the person that fell into the insidious trap was smart and savvy but somehow it just happened. The outcomes were really embarrassing and in some cases career damaging. Other times, it was sort of humorous. I could see this happening to me and I never want it to happen to you.
Once upon a time in a land not so far away there was a Kickoff Meeting for an offsite work area recovery exercise being planned for our Oklahoma locations. Eleven Oklahoma high ranking senior executives were on this webinar plus three Enterprise IT Directors (Ellen, Jim and Bob) who would support the business from the systems side throughout the exercise.
The plan was for Sam Otto, our Midwest Director of Business Continuity to host this webinar. Sam had hands-on experience recovering to our third party recovery site vendor and he always did a great job. He motivated people to attend the exercise with the coolest breakfasts and lunches you could imagine. Donuts, bagels, pizza, wings, scrumptious salads, sandwiches, beverages and desserts. He was great with people and made it a lot of fun.
At the last minute Charles 'Don't Call Me Charlie' Ego-Smith, the Global Business Continuity Senior Vice President, decided to grand-stand Sam. He demanded the reins to the webinar. Pulled a last-minute power-play and made himself the host and presenter. You have probably seen the move at some point in your career. I guess the old saying, 'be careful what you wish for' has some truth to it - read on and let me know if you devRanters agree...
So, Charlie, I mean Charles, begins hosting the session and greets all of the attendees. Hey, good so far! He starts showing some slides in the PowerPoint presentation and he fields a few questions, comments and requests from the Oklahoma executives. The usual easy to handle requests such as, 'what if we are too busy to do recover all systems', 'what if we recover all of our processes from home', 'what if we have high profile visitors that month?' Hey you can't blame them for trying. You are probably thinking to yourself, 'been there - heard that!' But luckily our experienced team had anticipated the push-back. Fortunately, Senior Management 'had our backs' and committed that all processes and systems must participate and test - so these were just softball requests, 'easy-peasy' to handle. But wait, we are just getting started!
Now the fireworks begin. Bob, one if the Enterprise IT directors started asking a bunch of questions. Well, Charles had somewhat of a history with Bob from previous exercises and did not take kindly to Bob's string of questions. Charles started getting defensive and while Bob was speaking Charles started IM'ing. He's firing off one filthy message after another to me and our teammate Sam.
'This idiot Bob is the biggest pain in the ass that I ever worked with'; 'he doesn't know shit', 'he never shuts the f up', 'I wanna go over to his office and kick his f'in ass...!'
Unfortunately...the idiot Charles had control of the webinar and was sharing his screen so every message he sent was seen by all of the attendees! Yeah, everyone including Bob and the Senior Oklahoma executives! We could not instant message him to stop as everyone would have seen our warnings, so we tried to call Charles' cell phone and text him but he did not pick up. He just kept firing ridiculously embarrassing dirty IM messages and I guess we were all so stunned we just sat there bewildered. We finally bit the bullet and IM'ed him to STOP ALREADY!!! Whoa, talk about an embarrassing silence!
I really felt sorry for Bob. He is a good guy. Deservedly, Charlie 'Yes I am going to call you CHARLIE' got in big time hot water after the webinar with upper management. For one reason or another he only lasted another year or so at our company. Maybe this event played a part in his demise.
So, the morale is, if you use IM - turn it off during a webinar if you are the host. If you must use it, be really careful what you say, who you say it to and pray nothing embarrassing or personal is sent to you for everyone to see.
Quick Update - During the past couple of months I participated on many webinars with enterprise software vendors trying to sell me expensive solutions. Most of the vendors had their IM going while doing webinars and training. Some very embarrassing things came flying across our screens. You learn a lot reading those messages when they pop-up on the presenters' screen, both personal and business related. Some even complaints from customers!
My advice to employees and vendors is to sign-out of IM before hosting a webinar. Otherwise, it just might destroy your credibility and possibly your career.5 -
Girl: hello this is amazon support center, hope you're feeling great today, how are you?
Me: im good...
Girl: glad to hear that, how may i help you?
Me: a few moments ago i was on... sigh, actually im not good im extremely sad right now because i was scammed on my amazon account for $250, im calling to ask if that product can be charged back.
*literally 30-60 seconds of silence*
Me: .....hello??
Girl: ok sir ill give u another line to call please dont hang up ok? stay with me
Me: maam im not doing suici
Girl: +1-532...
Me: ...2 -
FKING. LANDLORD. FKING LANDLORD THINKS MY LAN CABLE SLOWS THE FKING INTERNET BACK TO THE 1990s.
- Prologue
I'm renting at a place that looks good af. But the fking wifi is so slow, 80% of the time you can't even send an empty http request.
- Chapter 1
Okay, maybe it's my laptop. *plugs in cable*. Now the requests fail 10% of the time. Better than nothing. 2 hours later, gets a text saying other housemates are having slow internet because of me. FUCK. Unplugs, LAN cable, uses mobile data and cries to sleep.
- Chapter 2
Tries again after a few days. Barely uses the internet (I'm only using it to play games, not even download it and I used more than this with a 2mbps internet). No videos, no music, just small data exchange with a low ping. GETS A FKING TEXT AGAIN
- CHAPTER 3
My sis comes over and complains that the net is slow af. Plugs in LAN cable while no one is around, everything is fine. Sis leaves, I roll up my end of the LAN cable in my room but leave the cable plugged in on the outside of the room. Next morning, it's unplugged. Plugged it back in before I go to work and when I come back, guess what? ITS FKING UNPLUGGED. AGAIN. AND IM NOT EVEN USING IT.
SOMEONE PLEASE STOP ME FROM GOING ON A RAMPAGE SHOVING THE FKING CABLE AND THE ROUTER UP PEOPLE'S ASSES. LAN FUCKING CABLES DONT SLOW THE INTERNET BACK TO THE PREVIOUS CENTURY. ESPECIALLY WHEN THEY'RE NOT EVEN PLUGGED IN ON THE OTHER SIDE. FUCK.23 -
if you are tired, so fucking tired you are not fast enough to double tap a rant.
tap.... *rant opens* fuck! back..
tap... tap *rant opens* *rant opens* what the... back back
tap..tap oh cmon! Not again! back back
tap..tap *++ turns red*
Whohooo im a fucking genius!1 -
Once it really hit me hard. The father of my brothers wife once told me that I'm not fit for IT in general. He thinks that I have pseudo knowledge of IT and Programming.
He just works parttime at home as "computer scientist" and sells routers, pc and such stuff to some private customers. Before he used Filemaker and sayd that he already coded his own CRM with it.
When he said that it really made me sad. But after we talked I looked back what I already achieved:
1. I build for me and friends custom PC's with Case mods and Hard Tube watercooling
2. I can programm in HTML5, CSS3 and PHP
3. I raised a Community with over 60 people in it. We got 2 dedicated Linux Roots (I7-6700K, 64GB RAM, SSD)
4. I manage the Linux Servers on my own with VoIP, Mail-, Web-, MySQL- and Gameservers
5. I built up a complete Community Solution with Game Groups, Forum, Tournament System and a lot of custom scripts.
6. Now Im almost finished learning the C++ Basics to code and manage to learn the beginning of GUI/UX programming.
7. Next thing Im gonna learn is Javascript (Browser) and Java, so I can complete my Web Skills and also can code Java Desktop Apps and Java game plugins (don't rant, Javascript is not the same as Java, I know 😉)
So I thought to myself "maybe in the eyes of others Im not a computer scientist, but then Im on the way to be one at least"
But please dont be a douche (the father) and prejudice me, before you don't know what I already can and achieved.
Just because you're are selling computer parts and installing them doesn't mean, that you are a computer scientist and telling me that I'm not 😉
In IT you're the smith of your own merit!7 -
Coming back to the office after being down with sickness for 3 days. Apparently the two other People on the project doesn't talk together, only when im the middle man making sure they talk, and we got a big test on Monday.....2
-
A few months ago I was working on a (totally underpaid project) where my friend and I had to basically rewrite the entire program our client was using.
So we started planning and wrote all sorts of documentation to show the client our ideas for the new flow of the program, the new structure of the GUI and a few more details of what would the inner workings of the new app. He seemed to like all those ideas and gave us the green light to go through with the project and start coding.
We spent a couple of months coding, redoing the front end from scratch (with a different framework even, so I couldn't reuse any code from the old version) and completely redesigning the back end so it would be better, faster, more scalable etc etc etc. During this process, we obviously showed the progress of the app to our client, explaining everything we had been doing, and he seemed to like every new version we showed him.
When we were in one of the last stages in development (basically sending versions of the app to the client for evaluation), the guy suddenly changed his mind. After agreeing on everything we had been showing him over the last months, he sent an email saying:
"...the new system makes the app too complicated. I want this program to be as simple to use as possible; so we should revert the "Policy" system to essentially what it was in the last major version. The only change I want to make is [...] and everything else is essentially the same as the last Policy system."
So basically he wanted us to FUCKING UNDO EVERYTHING WE HAD DONE AND REVERT THE FUCKING PROGRAM TO THE FUCKING VERSION HE HAD BEFORE HIRING US!!!! WHAT THE FUCK????
YOU WANTED US TO CHANGE YOUR APP AND THEN YOU SUDDENLY CHANGE YOUR MIND AFTER 3 FUCKING MONTHS WHEN THE PROCESS IS DONE???
GO FIND A SWORDFISH TO FUCK YOU IN THE ASS, IM NOT WORKING FOR YOU ANYMORE
God, it feels good to let that out.4 -
Could you put a backdoor on the software so i can see what my employees are doing ? Don't worry I'll pay you more.
Yeahhhh buddy I'm out, give me my card back.
What the fuck im going back to my open source safespace.3 -
You know what i hate? Applying to jobs and never getting feedback--if a polite "we didn't hire you because x and y" is too damn hard, i would still rather a royal refusal over not hearing anything back at all. It's happened to me 3-4 times in a row now, probably going to be 5 - 6 soon enough. Seriously though, what is this shortage of devs everyone talks about? Because here i am with both hands and a leg in the air high as i could manage and you're not even acknowledging me? I even made a small React SPA once to satisfy a company's questions and show a bit of my competence--you think i ever got a reply from them? Shit, i didnt even get an auto reply. And from what ive read here on others' rants, im far from being alone. At least i could understand why they dont look at me (Bahamian, no degree, never had a dev job, etc.), but for proven programmers to go unnoticed the way they do is ridiculous.7
-
Me trying to use Linux for first time:
Sudo node index.js
access denied
Sudo shutdown
access denied (noob)
Me: im going back to Windows now....23 -
My friend who is new to Android App Dev was trying to make a simple app that programmatically takes a pic then sends it as an MMS. He opened Stack Overflow, copied code and i heard him murmur "hmm this is simple". Knowing the future, and the wrath of Android Studio, i leaned into my seat and waited. 2 hours later i knew Andy Studio had pissed all over him and it was written all over his face. I walked past him as if to go to the toilet then back again, his screen was blood red with errors and my heart danced and sang.
3 hours later i was out of the room and he sent me a text saying "I give up". I replied, "well tbh, im suprised it took you that long"
Thank you Android Studio for showing all those who think all we do is copy and paste code that they are freakin retards.4 -
After completing my sprint and some lingering stuff in the backlog
Me: Hey, there's this tiny feature people have really requested, I'll go build it since I got nothing else to do at the moment. It'll only take like 1h
PO: Hmm ok. Don't work on that yet, we need to check with business people and agree on the user stories and bla bla bla
Me: Ok, well there's these bugs I can take care of then, I'll get them fixed, won't be long.
PO: Hmmm, we need to measure the impact first. Let me get back to you on that a bit later
Me: Meh, oh. I'll refactor this bad component meanwhile then.
PO: Have you created a story for that in JIRA? Create the story first and then we'll groom it and take it in when we've time
Me in my head: Dafuq! Im trying to work on your fucking project but you keep throwing all that business bueraucracy shit at me. What am I supposed to do then? Sip coffee in the kitchen and talk about the other fucking billion failed "new business opportunities" with my peers? Fuck this circle jerk of a billion management people all trying to make themselves important. Nothing. Ever. Gets. Fucking. Done!!!
Me: Ah right, I'll do that *proceeds to the water cooler*5 -
Okay so this is just a rant about my personal life because if I post it any where else no one will really care.
So I graduated from a vocational high school where I learned about basic IT and networking skills but I mostly focused on my programming. and I LOVED that school honestly the environment was so amazing and everyone and everything about it was amazing. then I started college recently hoping for the same thing and its just depressing me, and my depression is coming back and I cant stop it because I cant distract myself from it. My friends are always off playing Monster Hunter Ultimate and Im just wishing theyd hop back on Warframe so we can play again.. They say they will but they really wont so im usually just playing alone or going online which is sometimes fun if you have people that talk back.
so i took myself to the official warframe discord to find people that would help but everytime I ask I just get ignored. So Im stuck playing alone.
while thats happening Im not really getting any messages from anyone besides my girlfriend which is nice but she isnt able to really keep up a conversation and shes often busy with school as well. when I try to talk to any of my friends they arent really interested to talk or just send short replies that obviously tell me to go away. one friend in particular she and I used to talk everyday not even in a romantic way just straight up besties for life, but after one of my relationships ended she basically took her side and never talks to me now. Ive just been really lonely and wanting to just have my friends talk to me again or just have some programming friends I can chill in a discord server while we code but I cant bring myself to ask anyone on the specific server im in for programming..
Honestly idk if anyone on devrant really looks at my posts and thinks "oh look Bubbles posted again". I feel like im not good enough to be here because Im not nearly as good as all of you, Im mostly just here asking questions or posting extremely fucking long posts no one wants to read. and yet this is still where most of my interactions are and I love that this devRant community makes me laugh or feel better about myself sometimes. and I thank all of you for that and I remember your @ 's all the time.
honestly the only real highlight of my week was when my teacher of my vocational class asked me to come back as an unpaid intern to help teach his new programming class and It made me happy but other than that I havent been too happy.
if anyone actually got through this holy shit youre awesome and thank you a lot its appreciated.21 -
We have 2 layers of testing environments and production.
I tested the changes on the 1st layer, bud since it was 5min to lunch i did not test on 2nd layer which is connected to the production DB. I pushed to production and caused 5+ websites to go full retard and went to lunch.
Came back to 19emails and 3+ skype msgs about "why the fck would you do that..."
Estimated damages nearly 20k EUR and i lost some permissions for two weeks, but my great boss helped me out and cheered me up by telling stories how he took down multiple servers too
plot twist: im the team leader of our office now :)5 -
I was given a 1700 nzd budget to make my own computer.
The mouse i threw in with my own money. I went 150nzd above budget and the rest is coming during the week.
Its going to be my first custom computer. And im fucking excited like its christmas back when i was 7 years old!!!9 -
Its been a few hours, and i was busy with meetings but
THANK Y'ALL FOR 10K ++
I remember wk20something, when i joined devrant. I was just starting a job as a data analyst, and the wk at that time spoke to me on a personal level, so i wrote a quick rant and didnt give it much thought. The next day i opened devrant and had like 100++s and a bunch of comments. Since then ive met a lot of awesome people here and im happy i clicked the install button back then. Thanks cfox and brogus for the opportunity, love ya.
Already got a longboard as a 10k-day gift :^)2 -
This rant is inspired by another rant about automated HR emails like "we appreciate your interest [bla bla] you got rejected [bla bla]". (Please bare with me).
I live in an underdeveloped country, I graduated in September, did Machine Learning for my thesis and I will soon publish a paper about it, loved it wanted to work as ML/data science engineer. On all the job postings I found there was only one job related, I sent resume, they didn't answer, couple months later that company posted that they want a full stack web dev with knowledge of mobile dev and ML, basically an all in one person, for the salary of a junior dev.
- another company posted about python/web scraping developer, I had the experience and I got in touch, they sent me a test, took me 3 days, one of the questions took me 2 days, I found an unanswered SO question with the exact wording dating to 6 months ago, I solved it, sent answers, never heard back from them again.
- one company weren't really hiring, I got in touch asking if the have a position, they sent a test, I did it, they liked it, scheduled an interview, the interviewer was arrogant, not giving any attention to what I am saying, kept asking in depth questions that even an expert might struggle answering. In the end they said they're not really hiring but they interview and see what they can find. Basically looking for experts, I mentioned that im freshly graduated from the very beginning.
- over 1000 applications on different positions on LinkedIn across the whole world, same automated rejection email, but at least they didn't keep me waiting.
- I lost hope. Found a job posting near me, python/django dev, in the interview they asked about frontend (react/vueJS) and Flutter, said I don't have experience and not interested in that, they asked about databases, C and java and other stuff that I have experience in, they hired me with an insulting salary (really insulting) cuz they knew im hopeless, filling 2 positions, python dev and tech support for an app built in the 90s with C/java and sorcery... A week into the job while I'm still learning about the app I'm supposed to support, the guy called me into the office: "here's the thing" he said, "someone else is already working on python, i want you to learn either react or vueJS or flutter" I was in shock, I didn't know what to say, I said I'll think about it, next week I said I'll learn react, so I spent the week acting like im learning react while I scroll on FB and LinkedIn (I'm bad, I know).
- in the weekend a foreign company that I applied to few weeks ago got in touch, we had some interviews and I got hired as DevOps/MLOps. It's been a month and I'm loving it, the salary is decent and I love what I do.
Conclusion: don't lose hope.8 -
> starts coding at a young age
> makes it my whole personality
> goes through a rough year of quarantine, graduates high school, changes changes changes
* no. coding for a super extended period of time*
now I'm slowly trying to get back into it consistently. miss you besties lol hope yall are doing ok I'm back and I'm better and also older. I think the last time I was consistently on here I was 17 lmao
I work at another bank now. I finished my first year of engineering at my uni. Ontario is slowly opening up. I'm doing better :)3 -
So today I realized that Im not happy.
When I was a kid I wanted to do many things because I had time and energy but I had no money. Now that Im an adult and I have the money, I have no energy and no will power to try and have personal life in these few hours left of my day. I spend 9 hours at work everyday and totally 1hr 30min is wasted on commuting.
I spent 4 years in uni between lectures and working on my side projects, and I really believed that after uni I will get a job and my life work balance will improve.
After uni I spent 2 years working abroad in 3 jobs at 3 countries. I work as android dev and now Im making a really decent salary.
However Im not happy at all. I realized that life is not about the money. Im changing countries like socks and dont even feel the need to socialize or enjoy my life anymore. Im european and these other eu countries are not that different at all. It came to a point where relationships are meaningless to me. I became an office drone who cares only about work and outside of work I care only about my projects and more work.
At this point im only 25 years old with around 2 years of experience and money is really good, but fuck it Im so tired of being an emigrant and having no stability in life. Im so drained. I spent past 6 years (4 in uni combined with side projects and 2 years working in 3 jobs in different countriee) working my ass off and lying to myself that after the next big thing Im gonna take a break and enjoy life. But its never enough. I dont want to hit 30s or 40s and realize that I wasted my life on pursuing money and didnt get to enjoy life..
Im really considering taking a 6-12 months vacation. I need to find myself. Probably going back to my own country. Just learn how to enjoy life, attend workshops, get to know new city area, meet new people, do some interesting hobbies. Maybe do a little freelance (max 10hrs a week).
Im tired of feeling like I need to make as much money as I can and learn as much about my work as I can. Its not rewarding because its never enough.
Whats the point in that money if I cant enjoy it?4 -
Best girl i've met.
I attended a CMS Conference last month(I don't use a CMS, i'm just interested with the topics about DevOps and UI/UX). I met this pretty lady ( I find her cute and awesome.) who's one of the speaker, she talked about design principles and applying it to BEM with SASS. After the talk, i asked her some questions about her dev't workflow like what tools she used and some best practices. Our conversation went well and exchange some of our knowledge and ideas also i introduced her to devrant (She's a wordpress user, i showed to her how the community hates WP, idk if she registered). After her talked we separated ways and ended seeing again after the conference as she's looking for a cab going to a mall (Same directions where i'm heading to), We talked again and decided to have dinner together. I felt like she's the best girl i met as she's into TV shows i like (Silicon Valley and Mr Robot). We added ourselves in FB and saying goodbye to each other. After a week or two, i just found out that she already into a relationship and it broke my heart.
I guess im back to the start, but i'm happy that i made a new friend.13 -
Me doing front-end work and get a stupid feature request from a customer...."I'll have to talk to our back-end developer and DBA to see if those changes are possible".
Guess what...Im the back-end developer and DBA and the answer is "hell no".2 -
Sometimes I wished there was no internet, computers etcetera and that the world would go back to the basics. When people from a village knew each other and married a girl from your village and lived in a wooden hut in the mud.
This all can be so much better than how life is at the moment. People ignoring eachother, fighting wars by killing thousands without actually fighting.
And yes I know some of us wouldnt survive it, Im not sure I would with my chronic kneepain. I cannot hunt because of it. I could be a builder or farmer maybe?24 -
I'm thirteen, and we have an excel unit in our computer class. When she's want to teach us something, she'd deploy her screen on ours and we couldn't do anything. It took me until the third time (yes, that long) to remember the connection was wired via Ethernet. I took the cord out and my computer was free! During the boring "lesson," I opened Code::Blocks to work on a fun side project. When she notice she wasn't connecting to my computer, she walked over to my chair and saw Code::Blocks on my screen. Then, I noticed her behind me. I quickly pressed ALT+TAB. She walked back to her chair. To this day I swear she thinks Im a hacker.11
-
Context: been coding for a year and been on react for 6months.
So im excited to talk about my achievements. Of which making buttons and menus which i share with my beloved partner.
Few months later I'm confident about my skills (that is not being a simple mortal anymore),so i come back home and my wife kindly asks me:
“how are you today darling? Have you been succesful with your buttons today?”
.... I had to say yes.... -
Im back to anyone that may cared a little, so I was offline for 6 days since my ISP Ultra Hilarious to crash my state records of their paying customers and some other stuff that It took 5ever to get back, anything you guys want to share with me that may happen lately here on DevRant? I personally my classic Amazon bashing news and Perhaps giving away some Steam Keys that one Reviewer user of my site give us out to promote the site along side the devs.
For the Amazon News there is:
Amazon in talks to buy cybersecurity startup Sqrrl and also group of New Jersey Amazon Warehouse workers stood in the cold outside an Amazon Books store in Manhattan on Wednesday to remind shoppers that their online purchases are made possible by warehouse employees who often are underpaid and denied normal workplace benefits. More info at: https://legionfront.me/pages/news
No about Free Steam gamuz:
Gravity Island Key: AACA7-CYFVW-N775L
For more free keys drop by:
https://legionfront.me/pages/gaming
https://legionfront.me/ccgr6 -
so I had a very important video conference for some rather large cloud infrastructure that Im engineering. I decide to look "smart" so i decided to wear a jersey during the video call. I aced the meeting, happy people all round. I walk to my room and my wife says "you do know your jersey is inside out...and back to front..and the label is sticking out from under your chin....How did the meeting go?" me:"..fine until you pointed out a look like a 2 year old dressed me !" ... well thats one way to kill the happy feels!3
-
Decided to delete devRant and reddit for a few months. Now I'm back, and the first thing that greets me on both is Light Mode 🤢
Thank God that I haven't cancelled my devRant subscription. Once you go black you never go back! 😏3 -
Due to working from home I decided a few months back to invest the money I save instead of keeping it all in my bank account.
About 10-20% of it goes to a long term investing account and the rest into the one I manage actively.
The nice thing about homeoffice is that I can have a lunch break an hour later when the market opens and review my shit, then again checking up on it in the late evening before the market closed here.
Have been playing around with trading for years but never did it with patience and discipline.
After 3 months I managed to reach over 16% profit.
My account is small so it’s not a lot of money but I’m focusing on the % rather than the $ at the moment. It’s a start..
Anyway, thought I’ll share my progress with you guys as some of you probably invest as well..
Im exclusively swing trading, so holding my positions between 1-14 days with no leverage.
😬17 -
And I thought dealing with recruiters couldn't get worse..
Applied for a job, get a call back a short while later. Recruiter guy has zero details about the job, but needs some background info. Then says he needs a few more things, it'll come in an email. Calls me 5 minutes later asking why I haven't replied yet, told him im not home.
Get home, check my mail.. please send full address, social security number and a copy of both sides of my photo ID.
Nooooooooooooope. Email back, say no can do.. no replies, job listing deleted a few hours later.2 -
Was cleaning up some of the old files on my system and found the first ever raycast program I had written.. in c++
This was during a time im pretty sure all of you guys just like me learnt the things that you could possibly do using code.
The experience of the first time I ran this and saw the sprites appear was the awe all of us have experienced in our own ways.
The reason I found this picture interesting is many of us end up losing the wonder and sense of excitement that got us into development in first place.
Go back , clean up your drives .. find your old code. I'm sure there is no better feeling than looking at the past you , writing bad code , with a probably bad language on a bad editor with sleepless nights to get nothing more than the output we wanted.
It's amazing when you realise everything is better when it's simple. -
I think there is such a thing as "getting too comfortable with the people you work with".
My boss came over and wanted to show me how to do a new process. We start going through the steps and a question arises. I then IM my team lead, because he's the one who would know the answer, and all I get back from him is sarcastic comments and profanity (he doesn't know my boss is sitting at my comp with me). So I keep trying to get him to be serious, and he just keeps his mouth (well, fingers) going. (He is remote - not in our bldg). I want so badly to shut him up because what if he says something about my boss while she is sitting there? Not that he does that, but at the pace he's going, it no longer would surprise me.
There should be some sort of code to hint to your team to STFU and give a fucking answer when one is needed. Sort of like what kids do to hint that a parent is in the room, but for work?3 -
After 6 months of work in this startup I gave in my notice yesterday.
- Me: I decided to leave this position as well as this country because: 1. My side business is expanding and Im making the same salary like here, 2. My army drafting got postponed for this year and next year they cannot draft me anymore(because of the age gap), so basically I'm a free man and can go back to my own country, 3. I have some freelance gigs on the side as well, so having them plus fulltime job plus my own side businesses it's not sustainable.
- My project lead: What if we would increase your salary ?
-Me : No, as I said this is purely due to personal reasons
My project lead: What If we would hire another dev so that you wouldn't have to work alone on frontend?
-Me: ......
Seriously do they ever listen??? I'm telling you that I'm making nearly twice the salary that you are paying me, do you really think an extra couple hundred of EUR a month will make a difference?5 -
Sooooooo since a few days im feeling more and more depressed.
There are some things that might cause it :
- school
-My last frienhship broke (not like i care about sociality. lol)
-my parents being so strict.
What can i do except for going through this, eyes shut?
I alceady had a depression i dont wanna get back there :/51 -
My boss and one of my coworkers “touch me”...
I’m usually one of the first ones in the office. When my coworker comes in and walks by, he touches my shoulder from the back in a “hello friend” kinda way.
Especially when I’m trying to ignore him he pokes my shoulder. He could you’d waved his hand in front of my head.
My boss is trying to be the “buddy” I guess. When having lunch and someone says something funny, he literally rests his hand on my shoulder or kinda rams my shoulder with his shoulder..
They think that’s nice and “bonding” but I hate it and it makes me very very uncomfortable. The ONLY ones who are allowed to touch me are my GF (I don’t have one) and other girls i know in a night out after a few drinks.
Not even my best friends touch me cause they know I don’t like that.
Im giving obvious signs that they should stop but they don’t get it..
On the other hand I probably have some serious problems that It makes me that uncomfortable in the first place, but not sure how to fix that.. i don’t even go to the barber shop because they have to touch me to cut my hair. So I cut them myself or my dad does it once in a year.17 -
I joined (still under probation period) in a startup founded by an 18 year old.
I work after my full time job for them and thought itd be fun but the kid made a slack channel and asks for progress updates everyday and feels a bit in a haste to get the product up and running. He seems to think I will be working every weekday from the second i come back home till i sleep. I have a party today that im going to and im sure he will ask for progress updates and when I tell him im out and wont work today he’ll probably say something like “the faster we do the project the better”.
Im not sure if i should leave now while its easy or i should stay for the money ($900 a month). Like i really dont feel like tolerating a demanding kid who cant wait for his app plus id much rather be working on other things just for fun like making rust crates. but at the same time the extra money is nice.
Thoughts?15 -
I have a new Job as a full stack developer, so Im here to tell my story, you see,I told my boss today that im quitting,
Which he replies by telling me to wait, to see if he can get the CTO to pay me more,
now the CTO sais, "HE IS ONLY A BACK END DEVELOPER, HE'S NOT THAT IMPORTANT, I THING WE ARE PAYING HIM MORE THAN ENOUGH" So I said fuck him and left :D4 -
Inspiration to code kicks in!
Kids asleep, everybody’s asleep, house is quiet. The kind of peace ive always wanted and wished! (Parents here will understand.)
Get to my laptop, opened up code editor, start fresh and clean! Created new file, about to type my first code and.........blood dripping from my nose. It doesn’t stop there, its like flowing for a while!
I noticed it keeps flowing while im projecting the inner excitement to code. When my mind drifted a bit, the nose bleeding stops. Wth? Its like my body is ejaculating when im excited to code, yeah.. it ls blood shot out of my nose, wtf!
...and i have to stop what im doing. Then the ideas just spoofly gone. Suddenly i dont know why im staring at an empty code editor.. (what was im about to code again?) i totally cant recall, it simply gone. Damn it. That could be a million dollar apps! Wish i can go back to an hour ago and record myself when i received that historic inspirational moment. 😔9 -
Teammember left. I did his three tickets yesterday. Before that I created and applied new rescue procedure for broken deploys on production and deployed the app manually. Took me about 6 hours to do this right, find the cause, and solve it, and document what I did. After that my teamleader bought me a launch :)
It wasn't his, my former teammate responsibility to bring back prd to life, it was me being good and engaged employee. His tickets, on the other hand, were his duties. Took me one hour to code them. He was working on them for two weeks. I can't wait for the performance review, im definitely going to ask for a nice rise :)1 -
Senior management just had a covid opening up party, streamed it on YouTube in the middle of the office with not a single person wearing a mask or social distancing. Encouraging employees to come back to working in the offices.
I AM FUCKING DONE. IM DONE.
It hasn't been a week since one of our employees died and these were the same people who emailed the team asking to donate towards the bereaved family.
This isn't even a rant. It baffles me that narcissistic bullshit like this is legal. How can anyone be that fucking stupid? Just how. Explain this shit to me. Because these aren't total assholes. They're generally nice people outside of work. Why is it that anything touched by corporate greed gets corrupted to the point of inhumanity.
Nope.6 -
My life is basically a loop of:
1) “I’m in a slump and terribly depressed because of my lack of productivity.”
2) “I know! I’ll try using the strategies that proved to make me very productive”.
3) “I’m very productive right now, that’s because I’m so smart and talented, it’s just part of me”
4) Back to step 1
Im an unaccomplished idiot with a big ego. Why do I have an ego if I don’t have any real accomplishments????
Dear god, I will become a fucking egotistical moron the day I actually do something worthwhile.
I’m a goddamn fucking piece of shit.5 -
So I had this internship in highschool for some marketing company creating simple databases for them to help out with their business.
When I came back from college for I think winter break they had asked if I would come in to help with a task that was going to take all day so they wanted me to come early. I agree and show up the next morning.
They had an Excel spreadsheet with about 5000 records in it and one of the fields was the name of the customer. They told me that the records came in as lastName, firstName or as lastName,firstName.
They wanted the field to look like firstName lastName. For a minute or two they had someone show me how they have been doing this which was just by hand. I don't really work with Excel so im not too keen with the macros. But it took me about 1 Google and 30 seconds to find someone with a similar macro to achieve this, I altered it a bit and let it go through all the records.
It was an awesome feeling when I went to the boss to let them know I was done (it had only been 10 mins), they almost didnt believe me.
Funny how one line of code can turn a day's work into a matter of minutes.2 -
*flashback to days of windows xp*
Just finished formatting and installing xp on friend's trash pc cuz the os was compromised due to a shitload of viruses. Notice that other partitions might still be infected and i don't have an antivirus on me.
"Big boi Ill be back in an hour, just whatever you do, don't open ANY drives no matter how urgent it is. Just Don't do it or i won't be able to help you"
Come back and VIOLA this worthless trash avocado opened a drive to play a game and d pc was infected. Again. Back to square one. It almost broke my heart. Almost.
I remember that day well. I was 15yo and hopeful. That day marks d start of my hatred toward tech incompetent people.
SO FKIN
A N G E R Y
So today
College
My classmates stink of incompetence. I'm not that smart in fact i consider myself to be a noob among devs but seeing ppl that are several order of magnitudes trashier than me breaks my heart and makes me soo Fkin
A N G E R Y
Hey you cunt of a skunk, WHY can't you even compile a fkin cpp file without an IDE what the fuck is wrong with you? What do u mean ur program isn't compiling? Well it literally says there syntax error on line 15 congrats u moron u fkin spelled else as esle. Why shud I waste my time on stupid Shitty ppl like u huh?
And waddup mr shithead.No. Not gonna help you partition ur drives and install a fkin linux just cuz ur too lazy to google it urself.
And if i refuse to help cuz im working on my shit then I AM D BAD GUY? Stop bitching about me u lazy bastards get ur lazy arse off and read the fkin book. Watch a tutorial or sm shit why the fuck can't u understand YOU LITERALLY PAY TO COME HERE AND YOU AREN'T EVEN TRYING TO LEARN THE BASICS GOOD LUCK GETTING A JOB YOU WORTHLESS CUNTS.
Now now all the poison is out i can finally focus on improving myself and stop giving a fuck about them. Its hard to be calm and cool when ur surrounded by ppl like this all day. Even harder when there is almost noone that you can look upto. All this time, there's only one thing I've learnt- in a place like dis, being an asshole is better dan being polite.3 -
After an hour long discussion via call with someone and after over a year of working in web3. I can safely say the entire web3 is actually a sham. Im too tired and exhausted from scams and frauds to explain why. It is just a bunch of overhyped artificially inflated bullshit to lure you into the ponzi scheme. I am almost 100% sure with proof how this is all a lie. Web3 is equivalent to government and political corruption - just a bunch of EXTREMELY WEALTHY people ripping poor and middle class off by defrauding them through crypto and nfts to make the rich richer. Its truly disgusting. There is no way in HELL that you can work in this space and expect to succeed if you are not already wealthy. People apparently spend between $10,000 up to $500,000 on a single project for marketing. They spend it so easily as if they earn that sum of money back by tomorrow. This is truly sickening. The reason why marketing costs so much is because it manipulates naive and newbies, lures them into the web3 world by creating an illusion of get rich quick schemes "hey buy this jpg for $2000 and you'll be able to sell it for $20,000 in a week!" Truly truly sickening. Web3 isnt even a wild west. Web3 is a fucking dystopian void where these fucktards are like animals fighting each other who's gonna defraud a bigger chunk of thousands and millions of dollars from each other. Literal fucking shithole. I am so disappointed. I thought web3 technology was useful. Perhaps it is but people's greed has molded this technology into crime and frauds. Which is what it has become9
-
almost a year ago, i have no idea of what i was doing at work cause everything was new: coding languages, databases, clients, co-workers, etc. i had 0 experience and i am back here again on devRant after 3836382 years and i am proud to say i've learnt so much and have been promoted to Project Manager. im happy asf and i am now ready for another round of dev rants!14
-
Im getting tired of this fucking scrum team.
First of all let me introduce our backend team which takes 3 weeks to add one fucking column to database and in the end turns out they fucked up RabbitMQ RPC implementation so the column is not syncing with our app at all so now we have to wait 2 extra weeks until that will be working. Best part is that backend fucker who fucked up doesnt even feel like hes blocking a feature and would rather sit for extra few days and do nothing until he gets reassigned his pile of shit back to him than clean up his own shit.
Then we have business analytic who doesnt know how to define tasks properly so I have to record each grooming meeting so I would know what to fucking implement because he doesnt even bother to take proper notes. Which results in not fully defined tasks, which results in unexpected behaviours and MR's stuck in limbo for weeks.
Also lets not forget QA guy who doesnt even bother writing scenarios, I as an app dev have to write them myself just to be sure that fucker will test everything thoroughly.
Then we have fucking devs from consultancy agency who apparently have 6 years of experience (I have barely 2) and these fuckers are spamming me daily with the most basic questions. After each grooming they rush to assign themselves tasks which are not even defined properly yet and not even in this sprint, but fuckers are lazy so thy want to reserve easier tasks for themselves. Pathetic.
At least I have a decent senior on my team, but sometimes he patronizes me so much that I start asking me what I am doing in this team.
Fuck this shit, I asked for a 43% raise and if Im not getting it in 2-3 weeks im outta here. Fuckers.5 -
Shit, again a long rant...
It all started 9 months ago.
We had a meeting with our group staff (5 people). Back the we discussed, if we should only work online or still send files around with mail.
Sure I suggested to run everything on a root server, would be the best performance/cost choice.
The president and the accounted refused, they said it's still working, why change. Payment will only be trough banktransfer and everybody keeps files local.
Back then I told them, that they will have sooner or later a problem. Files will be missing and bills not payd.
Last week we had a new meeting:
- Some of the group missed files.
- Some bills were unpaid
So now I have time until march to find and finish a groupware/collaboration tool.
I need to run member administration and payment online, this should be finished in October 2018. It should also do accounting.
Im really planing to use WooCommerce for this, I'm really crazy, I know! But I dont have time for that shit!
I work fulltime beside this and almost have no time to code something like that.
Well this week I demanded a memberlist, so I can plan a CRM database.
I received a word file as memberlist.
I asked them if this is a joke, right?!
They said no, thats the list. All the Data was mixed and some user details missing.
I HAD 3 HOURS TO GET IT DOWN IN EXCEL. WHY ARE YOU DOING THIS??? I REALLY WANNA PUNCH YOU ALL IN YOUR FACE!
When I sended it, I didn't receive a response or thanks.
The joke, I'm doing this stuff for free. I volontered, to make something big...
Im really going to shit Lego Bricks next... -
I get so fucking awkward and autistic when i sit at work 8h a day and just work... I cant fucking communicate with people. I behave like the most extreme "nice guy" beta shithead and its hard to fight it.
Went to put coffee in the sink now and a girl was washing the dishes. In the same time another girl was coming into the kitchen. I stopped and wanted to wait for her to wash them. The girl walking in looked at me weird. I was turning around pretening like im searching something. She asked hey do u need something. I then turned a 360 in place (oh my fucking God) walked towards the sink 1 step and then 1 step back as if i forgot to walk. Then i replied i just wanted to wash the coffee. And then i awkwardly put the coffee in sink for the girl to clean my coffee too
So fucking embarrassing!
Only when i work from home at my pace within my environment ALONE (im the biggest introvert) is when i dont become autistic. I can communicate. Im an alpha chad11 -
>Sitting at desk pondering over what is wrong with code.
:Top
BRAIN : "maybe we will think better with /another/ cup of cofee?"
Repeat until
BRAIN : "damn now im too jittery to think about code. Maybe if I relax woth some music/meme hunting ill be able to focus"
Repeat until
BRAIN : "Damnit i spent 2 hours on 9gag and not coding. Gotta get back to this bug squashing but im now so tired. Maybe some cofee will help me think"
Goto Top3 -
Attention: incomming resentful boiled up for months rant.
Hands down G2APAY is the worst because:
Merchant account aproval takes fcking months. It starts with unreasonable delays in documents approval. I mean insane nitpicking. They want to see merchants name surname and address on every god damn document that you submit even if for example bank statement doesnt include these details. I had to manually edit pdf’s just so that they would fck off and approve the merchant application. Insane requirements for document check also combined with their email only support answering only once a week you will have to wait one month just to get your account approved.
Then you get to the fun part, approval proccess for vendor gateway and webhook integration. They are nitpicking everything you can imagine: about website not having https, website forum missing some icons, merchants phone number being from another country then he is, and bunch of other hundreds of problems imagined only by them. Again combined with their one email reply per week policy you will waste atleast one month to finish up your integration.
Now finally you are their client and you think you can chill and go back to focusing on your business? Nope bro. Prepare for threatening emails. Last time I got a request to install https or my merchant application will be shut down. I was given 3 days notice on a fcking friday and had to do it.
Then g2a backend is crashing quite often. Combined with their one email per week policy you are fcked in the ass if your users were not able to pay through g2a and you will get no compensation.
Their backend documentation is shiet. Not clear how to integrate everything and after you integrate they make changes without publishing any changesets. Your integration is working? Good luck if it will still be working tomorrow.
And the very worst part is that they stopped proccessing credit cards like month ago with zero notice. Its been weeks and still zero news about bringing card proccessing back. They sad that they were acquired by some other company so shitty support got even shittier now while they are in a proccess of handover.
So yeah thats the worst vendor I have ever seen in my life. For example integrating paypal took me 30 minutes. Integrating stripe and getting all documents reviewed took me one business day. Same with paymentwall integration and document approval took 1 business day. Support is amazing and even have a phone number that I can reach if urgent problems arise. Thats how it should be. Thats why I can pay percentage of my transactions with a smile for them.
Sorry for the typos since im typing on my shiet phone while driving.
Eat a bag of dicks g2apay. I hope you go bankrupt and shutdown.21 -
FUCK SPOTIFY
This bloated buggy piece of shit
This fucking piece of bull dick that runs efficiently as much as a legless cockroach this motherfucker thinks its offline even though its in the motherfucking browse screen and I have a 4.5g connection (this retarded cunt) fills space faster than a hot gas released in a vacuum chamber just to fix its goddamn internet bug I have to reboot my damn phone. I see so many damn bugs in this shitty app that I think they rolled back to the alpha versions sometimes if I had any other god damn alternatives (google music is not available where Im from fuck you too google) the only thing I would give them would be my middle fingers. It just fucking froze on me while I'm just trying to listen to my Retrowave playlist while I fucking get ready for bed FUCK YOU FUCK YOU FUCK YOU YOU RETARDED INFECTION FILLED CUNT I WOULD PUT A BIKE CHAIN ON MY DICK AND RAM YOU WHILE WE ARE TIED TO A CAR THAT DRIVES OFF OF A CLIFF IF YOU WEREN'T AN INCOMPETENTLY PUT TOGETHER 1S AND 0S7 -
Hey, been gone a hot minute from devrant, so I thought I'd say hi to Demolishun, atheist, Lensflare, Root, kobenz, score, jestdotty, figoore, cafecortado, typosaurus, and the raft of other people I've met along the way and got to know somewhat.
All of you have been really good.
And while I'm here its time for maaaaaaaaath.
So I decided to horribly mutilate the concept of bloom filters.
If you don't know what that is, you take two random numbers, m, and p, both prime, where m < p, and it generate two numbers a and b, that output a function. That function is a hash.
Normally you'd have say five to ten different hashes.
A bloom filter lets you probabilistic-ally say whether you've seen something before, with no false negatives.
It lets you do this very space efficiently, with some caveats.
Each hash function should be uniformly distributed (any value input to it is likely to be mapped to any other value).
Then you interpret these output values as bit indexes.
So Hi might output [0, 1, 0, 0, 0]
while Hj outputs [0, 0, 0, 1, 0]
and Hk outputs [1, 0, 0, 0, 0]
producing [1, 1, 0, 1, 0]
And if your bloom filter has bits set in all those places, congratulations, you've seen that number before.
It's used by big companies like google to prevent re-indexing pages they've already seen, among other things.
Well I thought, what if instead of using it as a has-been-seen-before filter, we mangled its purpose until a square peg fit in a round hole?
Not long after I went and wrote a script that 1. generates data, 2. generates a hash function to encode it. 3. finds a hash function that reverses the encoding.
And it just works. Reversible hashes.
Of course you can't use it for compression strictly, not under normal circumstances, but these aren't normal circumstances.
The first thing I tried was finding a hash function h0, that predicts each subsequent value in a list given the previous value. This doesn't work because of hash collisions by default. A value like 731 might map to 64 in one place, and a later value might map to 453, so trying to invert the output to get the original sequence out would lead to branching. It occurs to me just now we might use a checkpointing system, with lookahead to see if a branch is the correct one, but I digress, I tried some other things first.
The next problem was 1. long sequences are slow to generate. I solved this by tuning the amount of iterations of the outer and inner loop. We find h0 first, and then h1 and put all the inputs through h0 to generate an intermediate list, and then put them through h1, and see if the output of h1 matches the original input. If it does, we return h0, and h1. It turns out it can take inordinate amounts of time if h0 lands on a hash function that doesn't play well with h1, so the next step was 2. adding an error margin. It turns out something fun happens, where if you allow a sequence generated by h1 (the decoder) to match *within* an error margin, under a certain error value, it'll find potential hash functions hn such that the outputs of h1 are *always* the same distance from their parent values in the original input to h0. This becomes our salt value k.
So our hash-function generate called encoder_decoder() or 'ed' (lol two letter functions), also calculates the k value and outputs that along with the hash functions for our data.
This is all well and good but what if we want to go further? With a few tweaks, along with taking output values, converting to binary, and left-padding each value with 0s, we can then calculate shannon entropy in its most essential form.
Turns out with tens of thousands of values (and tens of thousands of bits), the output of h1 with the salt, has a higher entropy than the original input. Meaning finding an h1 and h0 hash function for your data is equivalent to compression below the known shannon limit.
By how much?
Approximately 0.15%
Of course this doesn't factor in the five numbers you need, a0, and b0 to define h0, a1, and b1 to define h1, and the salt value, so it probably works out to the same. I'd like to see what the savings are with even larger sets though.
Next I said, well what if we COULD compress our data further?
What if all we needed were the numbers to define our hash functions, a starting value, a salt, and a number to represent 'depth'?
What if we could rearrange this system so we *could* use the starting value to represent n subsequent elements of our input x?
And thats what I did.
We break the input into blocks of 15-25 items, b/c thats the fastest to work with and find hashes for.
We then follow the math, to get a block which is
H0, H1, H2, H3, depth (how many items our 1st item will reproduce), & a starting value or 1stitem in this slice of our input.
x goes into h0, giving us y. y goes into h1 -> z, z into h2 -> y, y into h3, giving us back x.
The rest is in the image.
Anyway good to see you all again.27 -
-Im a frontend
-We don't have any back-end in our team
-Im now a front-end & backend
We need to migrate our server to AWS but we have nobody
-im now a front-end & back-end & DevOps
During de migration we need to use AWS database and create new view and manage access
-im now a front-end & back-end & DevOps & DB engineer
-We have new employee (Yess)
-im now a front-end & back-end & DevOps & DB engineer & Trainer and repository manager (PR, Manager)
Public institution... No salairy growing... Fluck this shit4 -
The company who said i passed the interview and got the job is not sending me email from hiring department to schedule interview. They said they gonna do it. But the recruiter told me they have a high demand of interviews so i guess they dont have time to reply to me back and hire me officially? Im still waiting its been a few days.
Or is this a slow sign of these shitfucks pulling back and will ghost me or reject me for no fucking reason even after telling me i passed and got the job but now they changed their minds for no reason?8 -
Skype??? For main communication in soon 2024 in an IT company???? Get the fuck out are you fucking kidding me??? Starting a 9-5 job after so many years of being jobless feels like im degrading myself back to caveman primal age. What who the FUCK uses skype ????? Please22
-
Im seriously thinking about Watercooling my Raspberry Pi 3...
Why?
BRCAUSE THIS LIL SHIT RUNS SO FUCKING HOT THAT I CAN MAKE AN EGG ON IT! THATS WHY!
Its 80°C when under little load BUT GOES OVER FUCKING 90°C ON LOAD! AND THIS IS FUCKING DANGEROUS! FUCK!
so back to watercooling...
Its a Stupid idea, I know, but its literally THE ONLY FUCKING WAY TO COOL THIS BASTARD! And trust me I tried Novec (Yes the liquid that evaporates at 60°C...) and SHITS EXPENSIVE!12 -
!dev
Im working with morrons...
So someone had bright idea of having clone setup of our servers in other hosting company (in previous company we have rendundant setup). Whatever, maybe they want to be resistant to thermonuclear war or whatever, like the project wasn't underfunded already... Whatever, fuq it.
And with that, I have like really, really really fucking ABSOLUTELY BULLSHIT STUPID questions thrown at me.
So, this particular instance of bullshit started with trivial, literally "how much storage capacity we will need" I anwsered at least 4TB, preferably on redundant disk array, I've added small table what uses what and how much etc.
Than I got mail back...
"Thats not enough information:
1. What we need to say to company ABC
2. What we need to say to company XYZ
3. (this one actually had sense) Backups conception
4. **WILL WE PAY FOR SERVERS**
5. other important things (literally)"
So let's break it down.
Im backend guy. What the fuck do I know what you gonna say to XYZ or ABC. I dont give a shit, for me it's clicking setup new server and Im done for, you are overcomplicating as shit and require special care from hosting company that you will pay extra.
Next one, the killer one. What the fucking fuck. my anwser was literally "yes, we need to pay for servers, servers arent free."
Now tell me. How the fuck it is possible that someone can be such an idiot to ask questions like that. and I dont mean #3. maybe even #1 and 2 is like looking someone to throw responsibility on. But why the fuck I have to anwser mail that literally asked me if servers are free.
No, fuck off idiot, I have actual work. Take your bullshit and spread it somewhere else.
E:
and before anyone asks. No, Im not working in kindergarden but I often feel like I am indeed working within kindergarden full of 30+ mentally handicapped toddlers.8 -
Quick rant, I dont have time.
I have no idea how the fuck but I managed my IDE to show me that it's confused if my class "PackModel" is "PackModel" or "PackModel" (I have only one definition if you are hands first to ask).
its few years and first time when I see shit like that.
Fun fact, it was working OK until I used getter that was returning another object and than IDE got absolutely lost.
I had to use workaround in middle of nowhere as shown on image and suddenly its back fine with it. Not like it's returned by function hard typed and PHPDoc typed to return instance of this very object and in other scopes it just works...
It's Jetbrains so Im confused, it's robust IDE ;-;...8 -
In context to my previous rant(s)*
As much as fixing up the pyload youtubecom plugin and giving back to the project sounds great, I'd be just shooting myself in the knee, because youtube-dl has active support that fixes things whenever they break, where as with the plugin I would have to constantly fix it based on what the youtube-dl project does.
So I might just write my own wrapper around youtube-dl since it apparently has progress_hooks that return all I'll need, might even get into python again, have been quite rusty on that.
* https://devrant.com/rants/1802202/...
* https://devrant.com/rants/1753119/...1 -
1. When i was 11 years old i came across a trojan horse program and i sent it to all my school friends to get their messenger password.
(I had a list of passwords of all the people in my class... dont worry, i didnt even used the passwords, i just stored them in my list lol)
2. Took data structures 10 years later, hated it and switched to electrical eng
3. I was working on a manufacturing plant as the lead engineer and one of my prototypes was misbehaving and i was blaming software and software was blaming me...typical stuff... So i said "im going to get a masters is software so i can know wtf you are talking about, and tell you that you are wrong😠!!"
Got in school, started in the masters and quit that place i was working for 🤣.. (they were shitty people and unethical business... fyi)
Now im back to where i was was when i was 11... (minus the hacking email accounts of my classmates)4 -
ah this fucking sucks my boss, who is also the guy developing back end for our mobile app which im developing, isnt working on the back end makes me guess the fucking json strings that hes going to send and buils the front end, then later changes the fucking json structure completely and expects my app to work without any problems, how do you teach these fucking php developers the importance and significance of data types and data structures4
-
I am building a website inspired by devrant but have never built a server network before, and as im still a student I have no industry experience to base a design on, so was hoping for any advice on what is important/ what I have fucked up in my plan.
The attached image is my currently planned design. Blue is for the main site, and is a cluster of app servers to handle any incoming requests.
Green is a subdomain to handle images, as I figured it would help with performance to have image uploads/downloads separated from the main webpage content. It also means I can keep cache servers and app servers separated.
Pink is internal stuff for logging and backups and probably some monitoring stuff too.
Purple is databases. One is dedicated for images, that way I can easily back them up or load them to a cache server, and the other is for normal user data and posts etc.
The brown proxy in the middle is sorta an internal proxy which the servers need to authenticate with to connect to, that way I can just open the database to the internal proxy, and deny all other requests, and then I can have as many app servers as I want and as long as they authenticate with the proxy, they can access the database without me changing any firewall rules. The other 2 proxies just distribute requests between the available servers in the pool.
Any advice would be greatly appreciated! Thanks in advanced :D13 -
Some years ago but it's funny.
The company give to me a new laptop with windows Home Edition,
After few months I have installed Pro Version.
1 month later the laptop didn't work anymore, nothing on display, no beeps, zero.
Tried to replace ram and check but nothing works.
The CTO asked the supplier and they asked about SO, and they said it's not turning ON because i have installed Windows Pro.
Than the CTO had a brilliant idea: try put the hard disk in another laptop and install Windows Home, and put back in the defective one. I refused to to that, it's stupid and he insisted, then I put the laptop in his desk and I said: if you want do this you can do, im not stupid enough to do this.
He got really mad, 1 week later i got a brand new one 😅5 -
At the turn of September, my mental health went really down hill.
I have always had problems getting to sleep and feeling that I don’t get enough sleep. So having a day without sleep didn’t feel so strange to me. Usually after that I have had great sleep, the next night not so much, and so. It is often a cycle of good and bad days / nights that gets triggered by too much stress probably.
This time I didn’t get to sleep the next night neither and I started getting really stressed about everything. I had psychosis-like symptoms. I super duper over-reacted to every stimuli and my head wasn’t in a good place.
I posted here about watching news and trying not to overreact and stress too much.
https://devrant.com/rants/2243611/...
Then I posted almost a cry for help where explained the situation with politics and world news. I don’t get it either.
https://devrant.com/rants/2245488/...
So I freaked out for no reason, and I just stressed more about the attention I got from devRant. Then I had a feeling that I’m being followed and thought that someone broke to my apartment. I was paranoid.
I left my home to calm down elsewhere. My dad’s and mom’s house. Didn’t help, and I ended up in hospital. Not too dramatic though. Just resting and trying out new medication.
Now it's better. I have the new medication and I'm having some health studies done on me so it won't happen again.2 -
It's almost midnight here and I just realized something. I just realized that none of my college friends have contacted me in almost a year now... Like none of them. They hang out every weekend near the college I cannot coz im working and it has never occurred to them that "hey there's this guy that we we were together for four years with , I wonder what he's doing how's he holding up" and I wasn't even an asshole or a douchebag or something I guess I just vaporizer from their memories like a volatile liquid.
I also feel like my boss gives me nearly impossible tasks so that I fail like "design these two complete web applications in three months while you do your actual job of teaching people java for 8 hrs a day"
And now here I am at midnight sitting curled up in the corner of my bed like a paranoid chipmunk that drank a pot full of dark coffee, trying to talk to this random bunch of people from random places in the world who are doing random shit right now. And the worst part is I chose this ... I wanted this I wanted to make a difference. I didn't want to be just a cog in a machine.
If I die right now how many people would cry? I ask myself that a lot it's never more than ten. This is probably creeping u out right now so I'll probably end this.
Rest assured six hrs from now I will put my mask back on. a mask of a happy, mildly funny, averagely successfully geek, until my next date with sadness3 -
So my brother went back to school today. Now, during the 5 years I was there they had the most shit security on their IT systems, but aparently now they have fucked up their ssl. If you try to load the https page it comes up with the warning saying its an invalid certificate, but once you click it, it doesn't even load the school website, it loads this random page. Clicking on the buttons then take you to a page under their domain provided by another school. Going to this schools website, the https seems to be broken in the exact same way. It wouldnt be so bad, but it can confuse the hell out of people who type https before a url, and thos who dont realise and end up on the insecure site will need to provide passwords over an insecure connection. I am so glad im out of that place, they had such crap IT and everything was so easy to break.1
-
Do you find it difficult to make new friends in your late 20s? Im talking about situation when you left your hometown, left your university city and started living in a fresh new city while working as a remote dev? Only way to make some would be to get into some hobbies, but for now I just try to kick my anxiety causing addictions (nicotine in particular). Once Im back to my calm state I will get out there, but for now Im just an anxious uninteresting wreck haha. At least Im living with my sister and managed to find a great girlfriend, but in terms of social life I dont have it as much as I wanted. Im in a strange situation where I hate people but at the same time want to connect more with them.11
-
I’m so fucking pissed off right now ... what the actual fuck!!! I worked so damn hard during this semester i got 70% for a presentation whilst some jack off who gets 100 fucking hundred percent doing it last minute by MY FUCKING HELP and also has the nerve to tell me to stay silent while he enjoys his Fucking undeserved HD (high distinction)
Well guess fucking what???? I’m not staying damn silent !!!! I’ll definitely be watching out for who I help in the near future, 😡 1AM i should be sound asleep but im legit so bloody pissed right now...I put my heart into my project stayed up late nights till 2 bloody fooking AM many times in a row, put my heart into my FREAKING presentation and i get stabbed in the back?!? Well thats how i feel right now.. i dont know how i will sleep tonight.. what PISSES ME OFF THE MOST IS HOW SOMEONE HAS THE NERVE TO TELL ME TO BE QUITE SO THEY ENJOY THEIR UNDERSERVED MARKS!!!
anyways guys and gals.. i had to get that off my chest. Thank you for taking the time to read my rant.. as always wishing you all the best.
Milo12 -
I didn't posted something in a long time so...
TL;DR: FUCK YOU ANDROID STUDIO YOU FUCKING SHIT PIECE OF SOFTWARE
Thank you for your time.
I am running my own meme social network. For quite some time I wished I knew a Android developer, which could help me.
Because I know java I tried it myself, and Android studio is one of the worst programms I've ever seen.
My app crashed the whole time, just because my studio version was 1 behind. Updated studio, everything worked.
My layout wasn't showing correctly, reopened Studio, all layouts deleted.
For no good reason video views aren't resizing, so I need to use exoplayer.
One video on my platform nearly crashes the app when creating a thumbnail.
And so one....
I fucking hate Android studio...
(PS: if your a German, Swiss, Austrian you could check out my network and may become a beta tester of the app)15 -
When thinking back to my first pc im like how da fuck did i survive using dat crap I must've been a very patient guy 10gb hdd, 64mb ram, 700mhz cpu (if dats da correct way to write megahertz) and to top it off 56kb/s dialup internet4
-
balancing school work between life and sport and programming is so hard. i mean, school is complete bs. what’s the point?
ffs it’s not *just* that im never gonna use the shit im taught, but that if it dont learn it, im punished. even in some classes (code.org), information that we’re taught is blatantly incorrect. either way, being able to find the foci or an ellipse and the latus rectum (hehe) of a hyperbola isnt going to make it easier when i get my job and just adjust css to my bosses’s specifications. i maintain a 4.0, and i fucking hate it. my friends are working hard, and getting into mit for racial diversity, while im doing just as much work, for what?
i want out. i really do. but this redundant thing called a degree is holding me back. i really want to have some way of proving my skills without a degree. i’m currently building a social media application i believe will take off, but frankly, i dont care.
take off or not, hopefully it will be enough to prove my skills. i’ve been working on this for two weeks now, and, well, that’s my story.7 -
Yay, Dubba didnt die.
Okay, hello'ed back, lets fucking rant.
Im fucking SICK and TIRED and ANNOYED by all freaking cloud fanboys. Yeah, sure. You get scalability. You waste less resources. Sure. But it depends on use case. There is suprising ammount of services that can be run on VPS or dedicated servers that will be a lot cheaper if you just DONT run it on cloud. And dont you dare to missinterpret me. I fully recognize that there are valid uses for cloud services. But for fuck sakes, its not anwser for ALL of your needs, and it costs insane ammount of money if you use it where you should use dedicated.
WHY we, as humanity came to this place where self-claimed "proffesionals" will anwser you "cloud" before you even ask your question.
No, fuck off, take calculator and think for around 60 seconds. And than decide if you need cloud or not.
And no, this mail server will be fucking few times more expensive on cloud, and I know it becouse I have fucking calculator and I was running it past 1.5 year and actually run sometimes htop, so stop bullshitting me.
Sorry if some cloud die-hard felt offended but it is exacly how I see and feel it.
Peace.1 -
I am now sitting in my apartment lobby after rushing home this morning because of a FedEx Delivery.
They said they can't get access to the building then how the fuck did this FedEx package get in between when I got back and when I came down?
Now they said there are different trucks... And my service could come later today.
It wasn't even supposed to come today but I guess maybe that's good since I took today off anyway...
Now I'm just stake out here all day and if it's not here..... Im going to aim to make FedEx the next Facebook or Panama Paper PR crisis -
Writing my code, go to run it and boom its not working. I pull up stack over flow to get some insight. At this point i was working on my code for countless hours and became a bit annoyed so i decided to copy what someone wrote on stack over flow delete my code where i thought it was flawed. I run it and Blam bugged the hell outa my code. So i undo go back to my original. Turn to a friend and ask what do you thinks going wrong. He resets my browser and there it goes it works. I just kind of gave him a blank stare and thought to myself Im a dumbass!1
-
I'm the lead dev on this team. The project is split into multiple separate modules to comply with separation of concerns, and so new devs don't need the whole fucking codebase (risking them running away with everything) to contribute to the project as a whole.
So we don't need a fucking config file to enable and disable features.
So we don't need to upload a 500mb monolith every time we want to test a change.
So we can test old fucking versions of modules without merging it back into the entire codebase.
What did this fucking dev do? He was having one small issue with Maven. One. It wasn't updating his local snapshots to the correct Artifactory version.
He decided, instead of trying to fucking fix it: HEY, LETS IGNORE THE LEAD DEV'S DEMAND TO KEEP THEM SEPARATE. IM GOING TO MERGE THEM INTO ONE MODULE FOR SOME FUCKING REASON.
I refuse to continue working with this dev if he's going to sidestep my demands and undermine my authority. He wants to go it alone? Be my fucking guest. I'm not touching his shitty single-codebase monolithic monstrosity.
If this is going to be a regular fucking occurrence, he can eat a dick and choke on it.2 -
Im petting my cat with my left hand and browsing Devrant with my right. Its super hard to get back from a rant. Pretty please devs of rant make swipe right and left on rants leave/enter?6
-
So I am only 15 and I am trying to find local businesses that will allow me to either build them a website or let me redo their current website.
Doesnt sound thay complicated right? I have gotten to do it once, for a laid back coffee shop owner whos business went out of business a day after i emailed him about it being done. I mean how the hell does that even happen!
I have tried different types of emails and shown all of my work, which it is all good sites that look professional. Issue is alot of people dont trust email offers or dont trust me cause im 15. I am not much of a person who can walk into a store and talk to the owner about it, i am not social in that aspect.
So anyone have any ideas?5 -
I know its been quite a while since ive posted last but it is safe to say that i am back! And boy do i have some stuff to bitch about.
This semester, Im taking mobile app development as a class. I chose to take this class over the introductory c# class, so that i wouldn't need to work with Windows or really do anything else to touch Windows. Well the joke is on me. Here i was thinking that we would be using a bit of Java from time to time while only really learning best practices and concepts.
Never did i think that this class's curriculum would be entirely based off of Xamarin.
Seeing as I need either this class or the two c# classes to graduate, I had to bite the bullet and just accept that my semester would be full of irritation during this class.
Its been about seven weeks in, and i have turned in 8 assignments.
All 8 of those assignments have been Windows Form Applications doing simple shit like dividing two numbers.
We have not made anything for multiple devices. We have not made anything for even one mobile device. We have not even discussed how to do this in the class.
This wouldnt bother me so much since these are typically easy programs that take about 30 minutes to make and test and submit for grading. It does insanely bother me, however, that it takes Windows so FUCKING LONG to boot, or when it freezes every 2 minutes because i clicked into another program, or it just HANGS ON THE UPDATING SCREEN AT 36% FOR THREE DAYS, or when it took 4 different reinstallations of Visual Studio 2017 before i could actually open without an error code.
College, Ive learned, tests my patience way more than it has ever tested my knowledge.2 -
Do not trust Unity Collab.
Been using unity collab as a VCS for months on a project, regularly saving the files, working well.
Today i decided to refactor some code but lost track of some things, so i reverted to a version i checked in 2h before.
Unity replaced my files with the stable build back then, except... half of the files were missing. of course no undo functionality.
months of work were simply not saved in collab. no version had these files, i did modify them regularly and they never caused collab issues.
how can a company not make the vcs they add for their main product work to its minimal requirements?!
Im not sure how i could motivate myself to fix this mess. fuck this trash company, cant have a single project without major issues.2 -
Backups is the most important thing, but there is something more important then that. Making sure your actually backing up the files your paying to back up. Now im stuck waiting on 4 2tb drives in raid 6 connected over sata 2 to be recovered because a raid card failed but the drives are still good. Estimated time over 3 days.15
-
Can anyone tell me how to become less resentful and less bitter? I am becoming a miserable fuck. Its true that I burned out in this job after doing 100hrs overtime during previous month, its also true that I am pissed off about having to wait 8-9 weeks for my raise to happen. I cared so much that I burned out and now Im trying to set some boundaries but damage was done and Im struggling dealing with it.
I took 6 days off to disconnect from work (still was responding to some major blockers and monitoring stuff). Today I got back at work and interacting with two incompetent devs immediately sets me off. Imagine taking 2-3 days and extra meetings to do a simple fix which shouldnt take longer than 30min. My mind was blown and still gets constantly blown about how ineffective some members of team are.
I am becaming a ranting fuck. I even noticed one person escaping my rants once he sees that they are taking longer than 5min.
Right now I started setting boundaries - I clock my 8 hours, disable slack/email notifications and get the fuck out from the office. I dont care if I will have to sit in traffic extra 30min during summer heat, Im done with putting in overtime and caring so much about being efficient. I will just start working on my side project and put my love/learnings in that. Hoping that by the end of year I will have couple projects to show in my portfolio so I could find a better paying job...
In the past I was the sole dev responsible for apps and I was communicating with ceos/ctos/product owners/designers directly. This is my first position where I work in a dev team and boy oh boy out of 8 devs barely 3 are competent enough but their output is how to say... Not the biggest. Anyways...
Transition to boundaries and 'normal life' is so hard. Nobody told me that I will have to learn to work with and tolerate such retarded and incompetent people. Im talking about illiterate monkeys who cant even read or write. Im amazed how they manage to code.8 -
Do your companies have dedicated software / web architects / designers, or are most places just a group of developers who are also expected to do design and architecture work?
Do you have dedicated front end teams and back end teams, or are most places just a mix of people who do everything?
I'm asking this because im a junior dev being given a large project, mostly to head up on my own (!), where I have to do design and architecture work which I feel is completely out of my comfort zone, and I want to know if this kind of thing happens often? Are developers supposed to design specs, pick the tech to use.. etc.?6 -
Why can’t IE just die?!
I was sent home for almost 3 months due to the pandemic, when I came back on monday there was a major issue with page load speed on IE and some potential customer, had a test account and told us that the platform is taking forever too load and then came the hunt to fix what is asap, it was a very important customer that still uses IE
This happens last week, the only developer on the job last week, was 3 days trying to figure this out, no dice! then I come back on monday, then Im being reboarded and keep up to date what has been going on while away, then I am given that damn task on Wednesday and I’ve been tearing out my hair trying to fix this all week.
But today!
I fixed it!
The solution: npm update <package-name>
Great way to start up at work again *clap*6 -
This technical interview went horribly awful... I cant believe what they asked me.... And it was all on english. Interviewed by german and indian guy. I got SO stressed the fuck out just from this 35 min technical interview. I drowned in stress. If this is the reality of engineering world im not sure if i can handle all this stress....
If i work a job i would literally just go to office and come back home like a literal zombie. Emotionless soulless purposeless zombie. Emptiness. Void. Numb. As i work in the office i would put a fake smile face as if im so happy working while from inside drowning in stress and decomposing out of depression... The amount of money i earn wouldnt even be spent because id have no energy or will to go out and spend it. It's meaningless....16 -
Dear web devs,
PLEASE learn how to (or teach/inform your clients) correctly target ads.
Thank You
Also, WTF??? and even WZF?!?! Who created this? Furthermore who the hell paid for this to be an ad, what are they trying to achieve and how tf do they think this will achieve that???
PS-
In case you're wondering what i was looking up on thesaurus.com, or would like to assume/blame this ad on my browsing history, cookies and/or something like google listening in the background through my mic... nope. Looked up "adage" and im waaay too adept at cybersecurity and easily annoyed by anything doing something i didnt explicitly tell it to.
if you're ignorant of the google listening thing:
yes this is totally a real thing that the vast majority of Smartphone users have no clue is happening despite it being in t&c. Try a few, somewhat relevant to this topic, google searches and youll find suggested searches like "can my phone read my mind?".
I tend to explicitly ban shit like that on everything (even devices of anyone on my property that never logged into my internet... im not paranoid, just not a fan of tech doing things i didnt tell it to)... but when i needed to enable/allow it on a dev for 30min, the next time i went to look for a book, one of the top suggestions (before typing anything) was "Burmese Pythons"... i looked back at my activity for that 30min days ago... I had been explaining some basic python code to a kid from myanmar... so it was pretty amusing.20 -
I’M COMIC SANS, ASSHOLE
Listen up. I know the shit you’ve been saying behind my back. You think I’m stupid. You think I’m immature. You think I’m a malformed, pathetic excuse for a font. Well think again, nerdhole, because I’m Comic Sans, and I’m the best thing to happen to typography since Johannes fucking Gutenberg.
You don’t like that your coworker used me on that note about stealing her yogurt from the break room fridge? You don’t like that I’m all over your sister-in-law’s blog? You don’t like that I’m on the sign for that new Thai place? You think I’m pedestrian and tacky? Guess the fuck what, Picasso. We don’t all have seventy-three weights of stick-up-my-ass Helvetica sitting on our seventeen-inch MacBook Pros. Sorry the entire world can’t all be done in stark Eurotrash Swiss type. Sorry some people like to have fun. Sorry I’m standing in the way of your minimalist Bauhaus-esque fascist snoozefest. Maybe sometime you should take off your black turtleneck, stop compulsively adjusting your Tumblr theme, and lighten the fuck up for once.
People love me. Why? Because I’m fun. I’m the life of the party. I bring levity to any situation. Need to soften the blow of a harsh message about restroom etiquette? SLAM. There I am. Need to spice up the directions to your graduation party? WHAM. There again. Need to convey your fun-loving, approachable nature on your business’ website? SMACK. Like daffodils in motherfucking spring.
When people need to kick back, have fun, and party, I will be there, unlike your pathetic fonts. While Gotham is at the science fair, I’m banging the prom queen behind the woodshop. While Avenir is practicing the clarinet, I’m shredding “Reign In Blood” on my double-necked Stratocaster. While Univers is refilling his allergy prescriptions, I’m racing my tricked-out, nitrous-laden Honda Civic against Tokyo gangsters who’ll kill me if I don’t cross the finish line first. I am a sans serif Superman and my only kryptonite is pretentious buzzkills like you.
It doesn’t even matter what you think. You know why, jagoff? Cause I’m famous. I am on every major operating system since Microsoft fucking Bob. I’m in your signs. I’m in your browsers. I’m in your instant messengers. I’m not just a font. I am a force of motherfucking nature and I will not rest until every uptight armchair typographer cock-hat like you is surrounded by my lovable, comic-book inspired, sans-serif badassery.
Enough of this bullshit. I’m gonna go get hammered with Papyrus.
by Mike Lacher, https://mcsweeneys.net/articles/...3 -
This is gonna get someone illogically upset, but idc about that.
I know it's ignorance of semantics but I'm tired of propagated ignorance changing the meaning of things.
Non-binary is NOT a legitimate term for whatever 'gender' you are!
I get what *whoever-started-it* was going for, but it's NOT valid. If you want to say that youre not male or female, fine... just don't abuse binary systems to do it. Just say youre non-bool/anti-boolean or identify with one of the, apparently 50, shades of gray.
I keep getting into logical loops to nowhere about this nonsense. No one is even defining what's supposed to be the 1 vs the 0. Which then makes me think '1 must be male... genitalia=1 in many ways...' which then sources back to the historic validity of males vs undervalued/less than human interpretations of females...
Then <brake>.
Ofc these people aren't going into the historical significance... they don't even realise how binary works! Ofc they'd have no clue that all 0s= no data... and 0s only have significance when viewed in placement to the 1s.
Let's all start using proper terminologies, like non-boolean. Maybe i can start a trend by paying people pennies to learn/teach wtf a boolean value is, and that binary can represent anything. With proper encoding the array is limitless... so being binary is actually a giant spectrum... therefore makes no sense to be "non-binary".
Ok... im done. It had to be said.
Who wants to start identifying as non, or educating wtf is, boolean with me???42 -
Right now what i want to do is just quit everything, move somewhere else, get a job and never fucking look back. Im sick of all these projects college dumps on me, the idiots im surronded with, my job, people who think im interested in their fucking research. I just want a 8 to 5 job and after 5 im fucking done and nobody calls me about how long will the next release take for projects i dont give a shit about.
In other news i just started my thesis yay.1 -
Wordpress.....
God, why..
Okay, so my company has deep roots with wordpress websites, which is, well fine, and at some point they needed portal that would do something but I was bussy doing other project for our child company, so our frontend slapped together "portal" in wordpress. So I dont even know if I understand that properly whats going on, but today buddy came with help request to wordpress.
I had to look through wordpress database and was like.... FML hard.
Okay, fuck it, let's try to make it work. So, I needed to get random category (using get_terms), check it's ->count and if its greater than X show it on page. I came to done halfway, the random part wasn't working.
Okay, made it work after initial struggle with "WHAT THE FUCK IS THAT?! AND THAT?? AND THAT?!?!??! ;-;" and now comes the kicker. It has ACF installed and it has additional category in ACF. And it should check count of posts within the category that have certain ACF value.
After awhile I just said "this shouldn't be done on wordpress, no idea how to make it work".
What I seen is like... it hurts me on so many levels... My head wants to explode...
Can I get back to writing normal code now? ;-; Im fed up patching logic in frontend (I dont even know if that's `the wordpress way` but that's what they did) -
iiiii fffffuckingg hate articles that just explain something
put a piece of code
that piece of code uses X amount of classes/models
they never mention what structure are those models/classes made of
what is inside them
i cant continue following the article because i dont know what is inside them
they just put it in ur face and say Fuck you
no
Fuck YOU
<font size="1000000px;">FUCK</font>
<font size="10000000000000000em;">YYYYYYYOOOKUUUUUUUUUUU</font>
U MOTHFFFFFUCKERRRRRRRRRRRRRRRRRRRR
USELESSS ARTICLE
zzzzz
frustratioms
my nerves are torn
broken
disabled
demented
day
in life
obsession
hell
unreal
what is life
q
what are doing
why are doing this
what is the point of living
how long does it take for a man to die
why are some people blessed with luck and some are not
zzzz
u know what is even more frustrating
girls
yes
ohdont get me started on this topic
well i warned u
the path towards abundance lies upon the few; thou who shalt not risk high; shalt always stay thus low
girls also frustrate me bc
i always do every thing nice and im always nice
so i realized
being nice is fake as fuck and doesnt fuckin work
being urself doesn't do a Fckimg tHING
hhh
frustrations
.
breathe
.
in this hardlife
only the strong survive in this world
- tupac shakur
zzzz
so yes bavk where i was saying girls frustrate me because i always do what im supposed to
so
i tried being thou who shalt i am not
guess what mothrfucker
it works when u be a gofdamn fkig low mothfckr a u know a goddmn fkig punk then they respect u and want u
back i fckked up
i turned back to my real me, the nice me
and then they left me
they think being nice = means being weak
FUCCKK YOUU
ssss
zzzf
kindness != weakness
U FCKING WHORES
UNDERSTAND THAT
zzzzz
breathe
i just wanted to have a walk outside and thenit started raining
so i had to stay inside bc of the rain
m
i am very lonely
u know i was very fine when i was lonely at a very young age but now i need a living entity beside me
with me
i fking need
wait i will cuddle my fluffy dog rn maybe i will feel better
br b wait for me ok
i feel better now
fck
i remembered that goddamn girl again
man i feel so heart broken
srsly
i have sunk into the deepest depths of endless depression I think
it doesnt feel nice
it feels very lonely and depressing down here
but i thimk tjat is be because i care too much
some people say i overthink
I dont overthink
i am like the stealth people
the shadow people
i stay quiet and observe
everything
i always know what is happening but i rarely speak about it
and people dont realize
so they think they can fool me
no
everything has its limits
so much lies that im sick of it
i always tell it how it is
i always reward those who help me
i always help those who help me
i never forget those people
zzzZZ
why is it that people who dont give a single fucking Fffffficxkkckck about me
are the ssame people i almost care the MOST?
i cross hundreds and thousands of miles to visit a person, invest hours of my time to do that
i do that....
and they wouldnt even step 1 foot in front to see me....
what kind of life is this
vv
feel like cryin rn
.
zzzzz
.
i dont understand what one must do
what is the point
all i want is to be happy
that is it
but being happy is.... i wanted to say the hardest part of life but now my voice told me being happy is a state of mind
myself answered me that being happy ? is a state of mind?
so that means if i want to be happy even if everything around me is falling apart
in my mind i can create a psychological world that would make me.... happy ....?
or what
i dont understand what did myself tell me
why do i care so much if im lonely
u know my friend from college we go to same computer science college
hes a very smart man but a fake FUCKING friend, plastic as fuck
he reads philosophy booms and told me
"when a man is lonely for long enough, he will slowly start to fall apart"
that is me...... that is ...truth......
he quoted a philosopher from some book
zzzz
he also said a quote he read about the meaning of life
"this life is endless pain and the only purpose of life is to reduce this pain as much as possible so we can be happy"
what the fck that is incredibly depressing
what the fuck im actually crying rn
i feel stabbed in the back and left behind and cheated on, all of those happened and some of them are happening right now
dont know what to think about the reasons
all of this causes me such huge anger and depression and that is whT keeps me going
going by working harder than i am supposed to
without all this hurt there would be no glory
all this effort..... it better pay off at the end...... please God..... i beg you....
i have completed 50% of my life purpose, let me do the rest so i can die in peace...13 -
Not dev related but what is the fucking point of someone saying I'm going there to do that and when i ask them to show me THAT what they did they say "oh it was so bad I'm not gonna show you haha"
Like how do i explain it without being rude.....
........
Here's a savage example scenario
---
Your wife: "i just came back from a mountain in the middle of nowhere filming an ad and in gonna be in that ad"
You: "cool. Id love to see that ad, could you show it to me?"
Your wife: "noo i was so ugly and it was so bad im not gonna show u"
---
What are you gonna think? What was your wife filming secretly behind your back and she doesnt want to show you? Was she even filming in the first place? Or was she fucking a guy? What is one supposed to think of this conversation? Why fucking tell me ur gonna go there and do that and then not talk about it at all after doing it? What the FUCK who DOES THAT ???3 -
First rant here..
So earlier this week, on a php Laravel project, I created a set of nice new features.
The code is tested, locally all fine, I push to Github, circleCi kicks in and double checks myself, still everything green. (Just for a not, its a private project so only I work on it.)
I go ahead and merge, deploy to staging and continue on my next ticket, which is a very small one.
I call it the day, next day I pick back up where I left, test locally, all green, push... then circleCi says no.
I spend 2 days debugging, trying to figure out what is wrong without advance. I just push develop branch again, guess what also failing.
I leave it for the day as I already spend enough time on it.
This morning, I simply do a composer update, push and everything miraculously starts working.. even if there were no changes in the working branches.
Im so mad right now, and this is going in my "try this before you debug a ci" book..2 -
How to deal with situations when in work people are overstepping personal boundaries too much?
My situation is that 2 months ago I started working in a very small startup and it currently consist of 3 ceos(main ceo, marketing ceo, product manager) and 3 employees (backend, android and ios).
What I currently dread is tea breaks. There is one at monday before work which lasts for 1 hour. And there is another one at Friday after lunch which lasts 1 hour again. I hate these Friday talks about "what are your plans for the weekend" which then triggers a circlejerk of ppl trying to impress each other about what they are going to do on their weekends. Same happens on mondays they circlejerk about how their weekend was amazing.
My situation is that I came to this country just to get skills and make shit ton of money when Im at it. Besides my fulltime work, I also am freelancing part time in my previous gig and also Im managing 2 other hobbie projects. I like to keep myself occupied during weekends so they usually consist of shopping/pc repairs/gym/working on my hobbie projects.
So basically when I tell them what I've done over the weekend the ceo's don't seem to be impressed so they start suggesting me to do something else. I completely loose any motivation of sharing my personal life when they start telling me what to do with my life.
I don't feel like exploring the city or meeting new people since maximum Im going to stay in this country is 6-9 more months. Then I'm probably going back to my own country.
Anyways even overall, I started dreading this companies culture. The politeness is so fake. For example there is an employee which has worked 3 years for them and the ceos haven't even increased his salary. I joined 2 months ago and I get paid more than him! They dont value loyalty at all since immigrants can be replaced easily. Another example: 2 weeks ago it was my birthday and no one from ceos even shook my hand, for them it was normal to just say happy bd during a standup.
So fking weird. I feel like I'm seeing redflags every day and not sure how long more I can stay here.5 -
My phone just died. Got a new phone on recommendation of friends and flash Jolla on it. The OS is super nice but the "Android support" doesnt work. No lastpass, no netflix, no prime, signal works half, no banking app.
I really need my windows phone back. It just worked without issues. After two android phones and now a Jolla in about two years im kinda done with all this shit.14 -
I don't really know what I should be feeling right now.
So its been 2 years at my company and im still considered a junior dev. There's a pay freeze, meaning there's no chance for me to move up the ladder.
And yet, as of today, I am being asked to head up both the design AND development of a prototype file cloud sync engine that will replace our current sync application that's been worked on for 4+ years now (yeah, its legacy). And I'm 100% on my own, at least for a while, untill someone else comes around.
I still reside under the title 'junior dev' and am paid as such. I don't mind challenges, but this just feels like a bit much. Heck, I'm sure maybe I could even do it too, but I don't feel like im being compensated or given a higher title to reflect that sort of responsibility. I've tried to tell my manager I don't feel comfortable with this, but they've insisted I head this up.
I feel kind of locked up inside, I don't even really want to start working on it because I feel angry that I would be given such a huge project to do all on my own, while being called a junior, and without anyone to fall back on.
What should I do? Do I refuse the responsibility? Do I see it as a challenge that will help me grow? Or do I see it as an exploitation?12 -
We use at our company one of the largest Python ORM and dont code ourselfs on it, event tough I can code. Its some special contract which our General Manager made, before we as Devs where in the Project and everything is provided from the external Company as Service. The Servers are in our own Datacenter, but we dont have access.
We have our Consultants (Project Manager) as payd hires and they got their own Devs.
Im in lead of Code Reviews and Interfaces. Also Im in the "Run" Team, which observes, debuggs and keeps the System alive as 3rd-Level (Application Managers).
What Im trying to achieve is going away from legacy .csv/sftp connections to RestAPI and on large Datasets GraphQL. Before I was on the Project, they build really crappy Interfaces.
Before I joined the Project in my Company, I was a Dev for a couple of Finance Applications and Webservices, where I also did coding on Business critical Applications with high demand Scaling.
So forth, I was moved by my Boss over to the Project because it wasn't doing so well and they needed our own Devs on it.
Alot of Issues/Mistakes I identified in the Software:
- Lots of Code Bugs
- Missing Process Logic
- No Lifecycle
- Very fast growing Database
- A lot of Bad Practices
Since my switch I fixed alot of bugs, was the man of the hour for fixing major Incidents and so on so forth. A lot of improvements have been made. Also the Team Spirit of 15+ People inside the Project became better, because they could consult me for solutions/problems.
But damn I hate our Consultants. We pay them and I need to sketch the concepts, they are to dumb for it. They dont understand Rest or APIs in general, I need to teach them alot about Best Practices and how to Code an API. Then they question everything and bring out a crooked flawed prototype back to me.
WE F* PAY THEM FOR BULLCRAP! THEY DONT EVEN WRITE DOCUMENTATION, THEY ARE SO LAZY!
I even had a Meeting with the main Consultant about Performance Problems and how we should approach it from a technical side and Process side. The Software is Core Business relevant and its running over 3 Years. He just argumented around the Problem and didnt provide solutions.
I confronted our General Manager a couple of times with this, but since 3 Years its going on and on.
Im happy with my Team and Boss, they have my back and I love my Job, but dealing with these Nutjobs of Consultants is draining my nerves/energy.
Im really am at my wits end how to deal with this anymore? Been pulling trough since 1 year. I wanna stay at my company because everything else besides the Nutjob Consultants is great.
I told my Boss about it a couple of times and she agrees with me, but the General Manager doesnt let go of these Consultants.
Even when they fuck up hard and crash production, they fucking Bill us... It's their fault :(3 -
Ever since i learned terraform i cannot go back. I cant fucking use the ui anymore. This shit is too good. 1 command to create all bullshit and 1 command to destroy all bullshit. Fantastic. Misconfigured shit? Just fix it in a file and 1 command to update it. Perfect. Need to add more shit? Add more lines and 1 command to update. Shitastic. Instead of misconfiguring bullshit or forgetting to delete some shit manually i can simply just do it all 1 command no errors
HOWEVER i noticed sometimes even terraform gets fucked up with bullshit. When im destroying my infra it infinitely says destroying. As if its stuck in that loop. No idea why. So i have to manually destroy the bullshit and then run destroy a fww more times till it works5 -
Im a complete back end guy, decided to learn a js framework......
var whatToLearn = rand("angular", "react", " vue");
Suggestions..... :/24 -
!rant
May I suggest an email service?
I saw this post recommending the Vivaldi browser (https://devrant.com/rants/1544070/...) and there was a discussion a few days ago about how email providers snoop around and sell data. I can't find it anymore, but noone mentioned protonmail.ch there.
I just wanted to share my so far positive experience with protonmail. It's a fully encrypted email service that was first used internally by some Swiss academics. Now they made a product out of it with paid subscriptions and a basic, free account. They already open-sourced the front-end web client and are planning to do the same for the back-end in the future, which is really cool. Oh and they have really nice email clients for iOS and Android, which have higher ratings than gmail itself in the Play Store. But that might also be because only a special audience uses protonmail and not the regular guys.
So, I suggest that you register an account there even if you don't want to use it right now. The free account comes with 1 email address and storage limitations. But it's usable and ad-free. Since it's still quite the new service, many email addresses are available. Just like gmail in the early days. That's why I'm suggesting you go and register even if you don't need it now.
Oh and last but not least: I'm not affiliated in any way with protonmail, except for having a paid subscription. But I believe things making the internet a better place should be promoted and devrant is definitely the community with people thinking the same way I do. Have a nice day.7 -
My last post was a year ago. What brought me back here is the ability of AI to agree and apologize to anything and everything, while producing the worst hopeful code.
4 days I wasted, trying to make an android audio visualizer, but AI... sigh.
It gave me the wrong structure of FFT bytes emitted. I corrected it
It gave me the wrong logarithm calc, I corrected it
It gave me the wrong sampling rate, I corrected it.
It gave me the wrong texture order, I corrected it.
It gave me the wrong glsl sample2d, I corrected it.
It gave me the wrong textureID generation, I corrected it.
It gave me a render which was about 10 fps, I found out that instead of using native onDraw, I had a fcking delta time in my shader. I almost corrected it, I gave up
Lets go to code generators with Annotations.
Like always, starts very positive, until I start to correct it.
It gave me the wrong file locations, I corrected it.
It gave me the wrong order of find copy modify and write to .build, I didnt correct it.
It gave me regexes to find annotations. Im like So whats the use of an "ANNOTATION PROCESSOR"
It apologizes and used a fucking regex in the processor,..... I didnt correct it, in the end, I was left with a separate module, targetting iOS Android and JVM, with an annotation processor implemented in jvmMain, which tries to modify commonMain src by finding annotations with regexes, which wont run on app build or app sync project, but only on java -jre command pointing to that fucking .java class in that module, which takes at least 2 mins to run, and Finally generate 0 files.
I needed to rant, I understand LLMs are just models of words built and stolen from the most intelligent and dumbest people out there. But Im an idiot for getting my hopes high. I cant build anything new and unheard of. I used to do that. I once made a textView + image print util for a bluetooth printer just to say FU to libraries and heavy sdks. like literally rasterizing shit to bluetooth packets. I needed to let off some steam. I havent been here in a year so I dont know what reactions I can get from this rant. I bet someone will just say yeah we tired of 'Fuck AI' rants. but shit, it hurts. When I gave up on that visualizer, I downloaded an app, I think its called project M, like in reference to MilkDrop.. like the Winamp Milkdrop. I opened it, played something on spotify, and let my eyes go blind9 -
Anyone ever just get seriously discouraged about peoples view on how easy/difficult it is to code?
A client has requested that they want a system built so they can create surveys and send them to people via email all in one tool. Im not a good front end designer but I know how to develop it. So they hired a designer to send me screen mockups and I will develop them. Easy enough.
This is where the bullshit starts... The designer was supposed to send me the V1 designs last Friday so I could begin building. I told them that I could have a rough version of some pages (with placeholder text and whatnot) ready for the following Friday (tomorrow). However the designer didn't send me the designs until 5 minutes before we were all meeting yesterday. We were all going over the designs in the meeting and this is how the conversation went (roughly):
Client: Wow these designs are amazing, I cant wait to see what it looks like when it functions. Are we still going to have a demo version by Friday?
Me: Well seeing as I just got the designs today, Ill have to look them over and get back to you on a new timeline.
Designer: Yah sorry about the delay, designing can be tricky sometimes.
Client: No worries, I understand. However I want to stick to the same timeline and have the demo by Friday.
Me: Well as I said, Im only getting the designs now, this is the first time I'm seeing them so I'll have to look them over and re-evaluate.
Client: Yeah but the designs are done so it will be easy for you to code it by then. It's all right there in front of you. I need to run, excited for Friday! Bye!
Designer: Bye!
Me: ...........
-- I know its partially my fault for saying I could have a demo done by Friday assuming the designer would have it done on time but COME ON. I hate when people say something is easy when they have no idea what it entails or how to even do it.1 -
Yesterday was the last day at my job.
We had a nice review party (the team pushing back to Scrum)
After it they have said some heartworming words, I cleaned my PC and left .
I was amazed to hear all the good words, as I felt the team think the opposite of me.
For example, I felt the team thinks I'm pushy, they said im modest.1 -
Started work at 05:00 to catch a flight, just finished work now (20:00)
Tomorrow morning i have to be up at 03:30 to catch a flight back, my boss has also booked me in with a all day meeting with our largest client tomorrow so won't be leaving the office until 18:00.
Atleast im going to the midnight viewing of Capt. America tomorrow (if I'm awake)3 -
That time when I requested someone from a different department to include the ID row in their database excerpt. Me, having the lowest possible status in the company, did not know the who I wrote to was the boss over at the other department. So I ask straight forward: "Could you please include the ID row?"
Then a damn long email comes back stating that there was absolutely no time for stupid shit as mine. There existed no ID row and I would only waste his time. All further requests should be route via my boss.
So, fuck, he's pissed. So what he deserve? A shit load of honey right into his mouth, like he wants to.
That company had a huge ass hierarchy in job positions and I was at the bottom. So I write my oh-im-so-sorry-mail.
~I never knew what position he had and that I would of course fuck off with my stupid request.~
What was his response?
Oh, yeah, thanks. Have a look into the attachment, is that the ID row you requested?
Yeah, as one can guess, it was.
Stupid honeyfucker. Of course an ID row exists, duh. -
> Ask scrum master question on teams
No response for 45 mins
> Ask colleague on teams
No response for 45 mins
....
Fuck it. Im going to the shitter to take a big fat shit!
*12 shits later*
Come back and see a missed call and 4 new messages from them both
.....
Cant even take a fucking shit properly! Fuck off6 -
So im pretty sure I made the biggest/dumbest fuckup for the year already...
Deleting the majority of our RHEL server's root partition.
Blonde mistake for sure.
Technically i didn't actually delete it... just fucked up the block device so it's no longer recognised as existing.
I could go fishing for data and put it back together... but since i have the boot par and all the uset account configs... plus i actually documented all remarkable server updates cuz im trying to get better at the whole 'having a team' thing... im just gonna play it safe and go through it all like old school video games when you die right before the checkpoint so you need to go through the same paths again and again... but not too fast or youll fuck up somewhere easy and itll drive u nuts when u gotta reiterate again.
@jestdotty here you go. Always saying I just mention positives about myself... cant get much worse than this.10 -
I recently upgraded my computer to a ryzen 1700x and 16gb 3600mhz memory and an asus rog crosshair hero vi board(From an 8350)
My pc ran soo smooth, games even more so
The games ran great, but my personal performance went down.
I didn't understand why. Im probably just losing my edge.
I trained and tried. But still, it felt off.
Today I realized that with my new motherboard, I got a new mac address. And my friend is a bit of a neat freak with that stuff. He has a whole system for ip addresses.
So i told him, I wont have the correct ip address. Then he started laughing and asked my to browse to a certain site www.privateinternetaccess.com
There at the top it said: "you are protected by pia"
Devices without an ip address bound to their mac address, will automatically use the vpn according to his rules.
My ping improved by 10-15ms upon getting my normal ip address back and my game performance is back.3 -
this really happened:
Interface Team Lead: "hey I want any time deployments and better QA"
Me: "ok sure. I have CI/CD, but yiu need to work in feature branches / tags, and make sure your code passes automated builds and unit tests"
Team Lead: "I dont have time to test it makes me unproductive! and creating a branch is an extra step which is going to set me back. Im telling the boss you are impacting performance!"
Me: "you want better deployments and QA, but you can even create a branch or tes your work?"
Team Lead: "We have deadlines!" -
Fk you Google!
My Samsung note 10 screen went dead near a week ago... it's a secondary line so waiting for parts wasn't the end of the world.
Ofc the screen (curved and incl a fingerprint reader thatd be a major pain to not replace) was integrated to the whole front half... back panel glued, battery, glued immensely and with all other parts out, about 6mm space only at the bottom to get a tool in to pry it out.
New screen (off brand) ~200... all genuine parts amazon refurb ~230... figured id have some extra hardware for idk what... i like hardware and can write drivers so why not.
Figured id save a bit of time and avoid other potentially damaged (water) components to just swap out the mobo unit that had my storage.
Put it back together, first checked that my sim was recognised since this carrier required extraneous info when registering the dev... worked fine... fingerprint worked fine, brave browser too...
Then i open chrome. It tells me im offline... weird cuz i was literally in a discord call. My wifi says connected to the internet (not that i wouldn't have known the second there was a network issue... i have all our servers here and a /28 block... ofc i have everything scripted and connected to alert any dev i have, anywhere i am, the moment something strange happens).
Apparently google doesnt like the new daughter board(i dislike the naming scheme... its weird to me)... so anything that is controlled by google aside from the google account that is linked to non-google reliant apps like this... just hangs as if loading and/or says im offline.
I know... itll only take me about the 5-10m it took to type this rant but ffs google... why dont you even have an error message as to what your issue is... or the simple ability to let me log in and be like 'yup it's me, here's your dumb 2fa and a 3rd via text cuz you're extra paranoid yet dont actually lock the account or dev in any way!'
I think it's a toss up if google actually knows that it's doing this or they just have some giant glitch that showed up a couple times in testing and was resolved via the methods of my great grama- "just smack it or kick it a few times while swearing at it in polish. Like reaaaally yelling. Always worked for me! If not, find a fall guy."7 -
It realy just warms my heart when the customer provides us with software that I need to go through manually and test every method individual before we can start implement it. Then I have to spend hours testing every fucking bit of it to make sure the modules we control with said sw doesnt meet their untimely doom cause the sw is too broken to actually run.
Any.net developers on this plattform? If you doesnt use these xml comments for commenting methods, you're on my hit list.
I realy hate these back-alley developers. Sorry of I sound salty and whiny but seriously. These past 3 weeks, most of my time Ive just worked around issues instead of solving them, cause their sw just keeps chaining good coding down to the ground. And theres no documentation cause "we have higher priorities ", testing is done by us at release cause "its faster and we dont make mistakes" and worst of all, our contact quote on quote "senior experienced developer lead design im far up my own ass and way more experienced than you" guy is a consultant who is only reachable about 2h on a daily basis.
Tldr: we live in a society. -
TLDR, i am not performing as I used to in my job before i made my side hussle and idk if i should do anything about it.
every since covid started and companies started laying off people, I started realizing im in danger when no company was able to match my current salary, and the ones that do would, make me do a hunger games hackerrank competition with thousands of other people which I don't really wanna take part of..
My company even laid off a lot of people due to budget cuts a while back and i didn't feel secure at all, and knowing that i might end up with less salary should i get fired and settle for the next company that accepts me, kinda made me lose any trust i had for the whole being an employee thing... I have financial goals i want to meet and depending on this one company to not fire me is scary...
I registered a tech company and hoped I could take on some high budget projects, got nothing the first year but slowly i started getting some projects and now im hiring contractors to help with projects and its going great and im really happy and excited about it.
But i often need to manage said contractors, have calls with clients and even do some coding myself. Some of that i end up having to do in secret in my company time... we work in a big co-working space so i get to sneak into a meeting booth and do all that.
my manager lives in another country and basically im in a situation where i can get away with it without anyone noticing.
However, I used to be one of the top contributors in the company. I used to finish a butt load of tasks every day and i ended up being promoted to manager, but i still get some coding tasks. But generally, if it weren't for my side hussle i would still be a top contributor and shine like i used to, but now i mostly do what is expected on me, and im afraid someone would ask me at some point why im not as productive as I used to be.
nobody asked me anything but i just feel kinda guilty and miss having the one job to focus on and taking credit for a lot of things and helping everyone, but at the same time i dont trust that the company cares about me enough to give me any guarantees or stocks or bonuses so i feel i need to keep growing my side hussle to have a safety net..
thank you for reading my rant1 -
soo after finishing 1 year of my 2 yr CS program, i moved back to my hometown so my partner wouldn't have to keep commuting for her career. couldnt get a cs job here with no experience and only 1 yr of school and like basically no portfolio to show for myself, i took a customer service job in a tech company with a lot of support for career pathing.
end goals are to end up working for their software dev team, mid goal is to switch into their web dev team from customer service since the career pathing is WAY easier from customer service to web dev, then web dev to sw dev rather than customer service straight to sw dev
so in the meantime i need to be practicing and building my portfolio but FUCK i have NO motivation and with coronavirus fucking up my life and everybody elses all i wanna do at the end of the workday and on weekends is melt into my bed in a semi-comatose state
i woke up early today to get some work done on my portfolio but all im doing is watching grey's anatomy and playing mobile games
i used to feel so motivated and excited to code but the excitement is gone and now even doing stuff for myself is a lot more like work than play
just need to rant it out rn4 -
We have a system at work with captcha....
I may have renamed a few thousand images and people have been getting pissed...
Of course I remember the shift in filename so I just correct them and they look at me like "how the fuck is that a 6" and im like "well I think it's a 6, the computer thinks it's a 6... Have you had your eyes tested recently"
Half the office are wearing new glasses, the other half have decided that Google has "gone too far" and that "I bet their algorithm has fucked this up"
I'll change it back in a few more days with a note in the changelog about how a "particularly aggressive AI got out of hand and was being too selective"1 -
!rant
But still kindof a Rant...
I Just got my Oculus Rift (Summer Edition bundle)
And I was Soo happy to try the Oculus Touch Controllers!
Except, the Setup was pretty hard because I dont have so much room to move in and the Setup always said: GO FURTHER BACK!
Until I realized that it was because of the Sensors which I put in an Angle not 90°...
Oh hell I was trying for Like an hour until it worked.
But then the Experience was one which I NEVER had! (I Tried VR Rollercoasters, waterslides in VR, PSVR, The HTC Vive, and the gear VR, Oculus DK 1 and DK 2)
It got me a little dizzy after an hour and a half of smaching Robots into pieces...
But still really AMAZING!
So my advice, get it when its on Sale with the Oculus Touch or Just right away.
TL;DR
I bought the Rift and im really happy about it.4 -
Okay. So I'm in class right now. And we'll do a rather big IT project (in groups of 2) later this year. And one of my classmates (I hate him AF but he doesn't know because he doesn't get shit) just asked me if I can make him a social media platform. HOLY FUCKING MOTHER SHITTING FUCK. CAN YOU PLEASR JUST STOP TALKING TO ME YOU PIECE OF SHIT. YOU DONT DESERVE TO LIVE. GO FUCK A TABLE!! IM NOT GOING TO CREATE ANYTHING FOR ANYBODY. AND YOOOUUU LITTLE FUCKER ARE ASKING ME TO DO SOMETHING FOR YOU?? EVERYONE FROM MY CLASS IS AT LEAST SOME KIND OF NICE BUT YOU PIECE OF CUNTSHIT NEVER EVEN DID A SINGLE THING FOR ANYONE. AND YOU ARE ASKING ME TO DO SOMETHING FOR ME. LIKE WHAT HODDAMN HOPE DO YOU COME FROM. COULD YOU PLEASE JUST GO BACK INTO THAT HOLE??!!!2
-
End of my rant about 35 day recruitment process for anyone interested to hear the ending.
Just got rejected by a company (name Swenson He) for a remote Android Engineer SWE role after wasting 35 days for the recruitment process.
First intro interview went good, then I did an assignment that had 72 hours deadline (asked for couple days longer to do this task, did it in around 40 hours, it was purely an assignment not free work, I could have done it in a day but I choose to overeenginer it so I could use the project as a portfolio piece, no regrets there and I learned some new things). After that It took them 2 weeks just to organize the technical interview.
2 days after the technical interview I received an offer from a second company with 1 week to decide. I immediately informed the Swenson He about it and politely asked whether they could speed up their decision process.
Now I know that I could just sign with the second company and if the big Swenson He would decide to bless me with and offer I could jump ship. But out of principle I never did that for 7 years of my career. If Im in a situation with multiple offers I always inform all parties (it's kinda a test for them so I could see which one is more serious and wants me to work for them more). Swenson He didnt pass the test.
6 days of silence. I pinged the techlead I interviewed with on LinkedIn about my situation, he assured me that he'l ask his hiring team to get back to me with feedback that day.
2 days of silence. I had to decide to sign or not to sign with a second company. I pinged the techlead again regarding their decision and 10min after received a rejection letter. There was no feedback.
I guess they got pissed off or something. Idk what were they thinking, maybe something along the lines of "Candidate trying to force our 35day recruitment process to go faster? Pinging us so much? Has another offer? What an asshole! ".
Didnt even receive any feedback in the end. Pinged their techlead regarding that but no response. Anyways fuck them. I felt during entire process that they are disrespecting me, I just wanted do see how it ends. Techlead was cool and knowledgeable but recruitment team was incompetent and couldn't even stay in touch properly during entire process. Had I didn't force their hand I bet they would have just ghosted me like they did with others according to their Glassdoor reviews.
Glad I continued to interview for other places, tomorrow Im signing an offer. Fuck Swenson He.
P.S. From my experience as a remote B2B contractor if a company is serious the entire process shouldn't take longer than max 2 weeks. Anything outside of that is pure incompetence. Even more serious companies can organize the required 2-3 meetings in a week if they have to and if they are interested. Hiring process shouldnt take longer than MAX 3 weeks unless you are applying for some fancy slow picky corporate company or a FAANG, which is out of topic for this post. -
Yet another day at my company, Im rewriting some old code for client (rewriting old, php 4 system for vindications managment) and you know the moment when you are focused and someone comes to you to absolutely ruin your focus. Fine, whatever. Oh, for fuck sake. Again dev is doing as support becouse one moron with second can't login into zimbra admin panel and add fucking mailbox. I show them exacly how they login, remind them they are admins too, slowly show them, so you click "manage" than you click that gear icon and than you click "new", fill in email address and password. As simple as 1-2-3. Okay, fuck it, time to go for a cig. I just finish up few lines and stand, grab my vape and start walking towards door. In door I find my buddy with 2 random people. He told me that they are interns and that I should show them some basics and stuff around that. Oh god, fuck my life. If anything, Im definitely very bad teacher, mainly becouse I often have problems with saying what I mean in the way that somebody actually understans and knows what I am trying to say. Whatever. Fuck it all. I grab two of our old laptops that nobody used in like a year or so, and first thing I quickly figure out, is that one day for some what the fuck reason I dont even dont bothered to remember I installed Arch on both while I dont usually use Arch. I just needed it for some specific reason. Whatever. So I guess I will need to upgrade fucking system. Our network isn't really great so that was like... hour or so. In the meantime I figured what they know about coding in general etc, and holly shit. One of them (there was boy and girl), girl, apparently never ever in her life even touched code. Well... fuck. Why am I wasting my time? Becouse there was some programme or some shit like that... Someone could tell me before so I could mentally prepare.. fuck it. whatever. So while laptops are doing their pacman thing, I sit with them and slowly start to explain based on my machine some really basic concepts. Second guy actually had some expirience, he knew how to make some really really basic logic and stuff, so he had another world of problems, becouse it was PHP and, as we all know, everyone hates PHP, and... yeah.. You can probably imagine his approach. Yes, you get user input in super global array. I really wanted to say "Now shut the fuck up and write that fucking $_POST".
hour or so passed, I was close to giving up to not let my anger rise (im not really good teacher... I mentioned it. I suck at teaching others) but luckly machines upgraded. He wanted to use visual studio code, she didnt care too much, so I installed phpstorm in trial mode. whatever. Since that's linux and they were not comfortable with that, I walked them through installing LAMP stack, and when finally it started to look like LAMP stack, I requested them to google how to install xdebug, becouse xdebug is very usefull and googling skill is your best weapon on that field. I go for cig, come back and what I see boiled me a little bit. The girl was stuck looking at github page randomly looking through xdebug source code and idk... hoping for miracle (she admited she thought there will be instructions somewhere) and the guy was in good place, xdebug has a place to paste your phpinfo() for custom instructions. But it didn't work for him, he claims that wizzard told him it cant help him.. hmm intresting, you are sure you pasted in phpinfo? yes, he is sure. Okay, show me.
Again mindblown how someone can have problems with reading.
so his phpinfo() looked like that:
```<?php
phpinfo();```
I highlighted on the page the words "output of phpinfo". He somehow didn't see it or something. He didnt know, he thought that he needs to put in phpinfo so he did. OMG.
Finally, I figured out I can workaround my intern problem, and I just briefly shown them php.net, how documentation looks, said to allways google in english, if he uses tutorial to read whole fucking thing, not just some parts of it, and left them with simple task, that took them whole day and at which they ultimately failed.
To make 3 buttons labeled "1" "2" "3" and if someone presses one of them, remember in session that they pressed it and disallow pressing other ones.
Never fucking again interns. Especially those who randomly without apparent reason almost literally just spawn in front of you and here, its your fucking problem now.
Fuck it, I have some time to get back to my stuff. Time is running so lets not waste it.
After around 15 minutes my one of my superiors comes in and asks me if I can go on meeting with him and other superior. My buddy goes with us, and next 3 hours I was basically explaining that you cannot do some things (ie. know XYZ happened without any source of information) in code, and I can't listen for callbacks from ABC becouse it wont send anyc cuz in their fucking brilliant idea ABC can't even know that this script would even exist, not to mention it wants callbacks.
Sometimes I hate my job.4 -
wwoooo..
back from the dead with linux :)
like i said my internet wasn't working last time. trying to fix it i uninstalled something essential and obviously at this point im banging my head lol managed to get files back and wiped for reinstall. the wireless is back though!!2 -
Our company got bought over from a global private entity 3 months back (advent international) and the reciew process started and it turns out, im part of the bunch that may be getting retrenched as per the meeting we just had, our positions being redundant and just last week had a over the top performance review.. Now i need to figure out what to tell the family when i get home. This Fucking sucks im not going to lie2
-
When ryzen released I bought a 1700x a little while after with 3600 cl15 memory.
Back then it only ran at 3.6ghz cpu and 2800 mhz cl16 memory.
Now im on 3.75 ghz and 3333mhz cl14.
I honestly didnt expect this to happen1 -
!rant
Guys, Im curious, what you would say about situation if you are in need of some quite simple tool and you write it but becouse you need it today, not tommorow, you just dont give a heck about all the fancy stuff and (lets say for php) you start to write all in 2-3 files like you was back beginner?
Or you just nope out of situation?
Do you refactor that when you bored just becouse this cant be on my disk, noone can see this abomination?
Or you delete after usage (only to relaize 5 minutes latter you need it back :P )
Im curious your opinion.
PS.
nope, if you came to bitch about any of opinions even opinion "well, i wouldnt give a fuck and just not do it", go away and get lost.
E: typo12 -
manually writing multiselector widget with jquery and javascript, because you need to be able hackily pass in metadata for some stupid fucking edge case that the previous generation didn't want to deal with
please euthanize me, i fucking hate frontend and im sure it hates me back3 -
The moment I realized im an actual dev:
I used to always copy/paste embed codes and not think of how they work. Embedded iframes, embedded video, embedded appointment forms.
One day, I'm given an embed link and I freakin knew what everything meant. I knew the HTML, I understood what the JS call was, and I saw how it communicated back to its site. It was super exciting to finally understand what I was copying/pasting... Like I finally opened my eyes and saw the real world.1 -
Havent been home for 24h. Now im coming back home and i can't explain how much shit im holding in. Im gonna explode and drop that fresh smelly shit and nuke the whole house5
-
[linux distro stuff]
Hey guys!
Im considerig switching to linux because:
My macbook does not support mojave and the new ones are expensive af.
Windows 10 is bloated and not a great user experience(removing stuff from the control panel and adding it to the very stripped down settings app, privacy etc..).
I love open source software
However i did not used linux for a long time, back then i used ubuntu and SUSE.
My considerations:
Debian - because .deb on them haters
OpenSUSE - because i used it in the past and it seemed very stable and fast
Arch - i heard from a lot of sources that it’s “da best”
My use case is game development and 3D modeling. I use gimp, blender vscode and unity (the game engine) at work i sometimes use autodesk stuff (motionbuilder, 3ds max) because of fbx.
For audio stuff i use audacity
So overall i’m looking for a distro that is fast, lightweight, i can develop on it (mostly 3D stuff) and occasionally play some games
Anyone has experience with the mentioned distros? What distro would you use for this?6 -
Have a question about raises.
Working in europe as a junior dev (had 2.5 year experience prior) but lowballed myself (because I had a 1.5 year gap from development) and started working here for 2.5k euro/month salary.
After my 3 months probation I noticed that Im doing better than 60% of my team and as soon as my probation ended I messaged my manager and asked for a raise to bump me up to 3.5k/month.
I am waiting for a raise for the past 7 weeks already. My manager keeps telling me that decision is greenlighted because I got very strong and positive feedback. However CTO is on vacation, once he comes back manager will be on vacation and so on. Basically a corporate clusterfuck.
So basically I will have my raise request approved what? 8 weeks after my original request? Also add a couple more weeks because I guess new contract will be signed from the beginning of next month, not retrospectively. So when I will actually get that increased salary? What the hell.
Since my original request havent even reached CTO yet Im thinking of amending my original request and asking for a bump up to 4k or quit the company and go contracting for the same 4k and pay 17 percent for taxes instead being employed fulltime while paying around 43% for taxes.
I am just pissed off that its taking 2 months to just get the 'okay' and I guess will take 3 more weeks to sign the new contract. It shouldnt be like that, I lost money while waiting so I think it would be fair enough to ask for a bigger bump.4 -
What do you guys do to prevent or reduce back, neck and/or shoulder pain?
Im only 18, starting to have a pain in the back every second week or so :s24 -
I love my gf but she broke her leg 4 weeks ago and since then both of us are stuck in home WFH. I feel like my soul is being sucked out, I am being suffocated with the neediness, responsibilities and I alone have to take care of everything in home including taking care of our dog, food on the table and running errands. Its hard to even force myself to have sex anymore since my hormones are fucked up and Im in a constant state of stress that I rely on now just to get through the day.
During the day to numb myself emotionally I cope with coffee and smoking. During the evening to relax I cope with alcohol and nettlix and to sleep I take a xanax. Staying until 3-4am kinda became my alone getaway time.
I pray that in 2-3 weeks her leg heals and she goes back to the office and then I will again have my daily 10-11 hours of uninterrupted work/personal time again.
Were together for 4 years already and she expects me to propose to her and make babies soon. I dont know if I am capable of having a family if Im thinking of breaking up after 4 weeks of taking care of her. Idk what I will do but for now it is what it is.31 -
Update on: https://devrant.com/rants/5877229/...
So. I finally called the number two weeks ago. (Been sick in between. 0/5 would not recommend.) A person with a heavy Indian accent answered. As far as I could tell about what he said, that number couldn't really be used to reserve the certification testing time. Bloody great. So he proceeds to eat half the letters of words and emails to 'someone' about reserving the testing time hand writing all the accommodations I've been granted. Haven't heard back since, don't even know if the email was ever sent.
Screw Pearson VUE and their so called accommodations. >:C
So, next Monday, I booked myself a 3h torture session before I forget every bit of Azure trivia I've memorized the past two months as I start a new client project soon. >.> And after that I'm gonna be spending the rest of the week in fetal position under covers in bed. -
I'm about to graduate and I'm fucking exhausted ALL THE TIME. When I'm not in class, I'm at work. When I'm not at work or class, I'm working on projects. Trying to cover all my bases has left me incredibly anxious and unable to rest, so I don't sleep well and I'm fucking tired constantly, making it more difficult to do *anything*.
And if I hear "it's almost over" ONE MORE TIME :| yes, I know it is, that's why I'm freaking the fuck out, because I have 3 major projects I'm trying to balance on top of my internship.
I'm also trying to lose weight so I have to curve the stress eating. I cut out nicotine but I'm slowly picking it back up because
If I'm constantly stressed
And I can't rest
And I can't enjoy food
And I can't enjoy hobbies
Im basically just sitting here for HOURS every day losing my fucking mind without any distraction. 3 weeks until I graduate and it feels like an eternity. Every day is pain.7 -
Some bitch posted a story "Fear God and obey God's commandments, because thats the only thing asked from mankind ❤️"
This fucking story fueled me
It enraged me
Blood boil
So fucking much that i had to let this shit out here
First of all, "FEAR God..."
If you fear someone who is supposed to love you, does that look like a healthy relationship to you?
"I love you so much", said the boyfriend to his girlfriend, "but if you dont love me back then I'll set you on fire so you can burn in flames and torment"
In that case do you love him because you genuinely truly love him, or do you HAVE TO love him because of fear from burning alive in fire and torment?
Think about that fucking scenario for a while. Imagine if that scenario happens in our world. The guy would be labeled as a psychopath and get arrested IMMEDIATELY.
But it's completely ok when God does THE EXACT SAME THING, just because hes God?
I'm a christian and even this fucks me up when i think about it. The more logical mind and critical thinking i acquire the more i see through the non logical bullshit.
My faith is shaky.
Im genuinely starting to think over 50% of religious people believe in God not because they genuinely believe, but because of fear of being set on fire and torment forever.
It smells to me like its a fucking MIND CONTROL FEAR DRIVEN CULT.7 -
i never knew id reach that point when i need to take a break from programming and everything that has been causing me so much stress for the past few days. and to be honest, it actually feels great to be focused on only one thing instead of stressing out on different projects and debugging them all at once.
in a few days, ill prolly go back to programming some side projects. its not like i can keep myself away from them...
programming is like a magnet for. that magnetic force is growing stronger day by day and im being pulled closer to it. im happy about it except for some occasions when i get too stressed.4 -
I think Im subconsciously planning my suicide. I already abandoned close relatives and friends. I refuse to work or apply for Jobs. I am lazy and spontaneous. Im back on drugs. I take unnecessary risks. Time is moving fast but slow at the same time. I’m fine with the monotony of slipping down into a deeper hole. I don’t know what hope is. Some days I don’t eat at all or get out of bed. I even started confessing my feelings to people I love but have been scared of. I feel that there is nothing left to do but get rid of this alive feeling and reality as I know it. And related to all of this, I feel apathetic and bored.9
-
[Fairly existential career question] How fulfilling would you say your career in development has been?
[Long rant] for years I had been planning on becoming a rabbi, majored in religious studies etc, until I realized there would be no way out of my rapidly growing debt if I chose to continue on that path. i had to drop out 3 years into my undergrad due to financial issues, and as it is now working full time im barely holding my head above water. I spent a lot of time being sad about it until i decided to change things and started getting into accounting before I discovered coding. I am SO GLAD I discovered coding cause accounting was so boring...Now I'm excited to be going back to school for software development and I'm in a bit of a pink cloud having discovered something thats both exciting/fun/challenging AND lucrative... But i do worry about 5, 10 years in the future, will i still be as stoked about it? Religious leadership was and is something I know i would feel ~fulfilled~ over a lifetime, and while my newly discovered passion for coding literally keeps me up at night getting fired up on solving problems and writing my little newb programs, i think I'm afraid of burnout?
[Tl;dr] I'm making an education+career switch to software development and i wanna know how folks feel about their career years into it, do you still love it just as much? Feel jaded? Regretful? Happy?4 -
I have a job(not really paid enough), and tomorrow I have a job interview for a front end developer at a company thats around 1 hour drive where I live, so the company is in the different city. Main reason I want a job(a good paying one) is because I want start living there.. start my own life. Everything would be fine but Im 22 years old and 3rd year in college. College is in my hometown where I live now. So every week I would have to catch a bus to my hometown to go to college, and then back.. My parents don't really aprove of this, and I will get no help from them if I move away.. Yeah, waited for this interview tomorrow for a month, and had many arguments and fights, and even one "panic attack". Pretty stressfull time for me now.. Can't wait to just see what will come out of this..
If I get the job, it will be a huge step for me, and probably lose some people who black mail me to not move away.. either I succeed or I fail..6 -
Seriously guys, how do you deal when remotely collaborating with lets say not the most motivated and competent devs?
Our scrum team got formed about 6 months ago from leftover devs of other teams, choosing a couple competent devs at the core and other devs who were kinda gotten rid of by their old teams, and after 6 months of working together I can see why.
Situation is that we are 7 devs in our team and 4 of devs are not pulling their weight. They are seniors on paper, but in reality not really.
They rarely take something complex to work on and even if they do, they make sure they take as much time as possible. Two of them are contractors who I imagine decided to treat the job as a paycheck and nothing more. There is no initiative, no push to make things better and in general attitude is to do bare minimum: only what is being asked and then delaying the hell out of tasks.
Im not exaggareting: Im talking about every possible way of dragging out the tasks: delaying communication, sitting around for a few days while not asking for new tasks to work on if they are blocked, also avoiding standups. Working for days on very basic comments in their MR's. Getting "sick" for a couple days on deadline when things get tough, so that someone else would come in, refactor and save the day. Once or twice it could be a coincidence, but nowadays I can already guess ahead of time what kind of trick they will pull now.
Our project is an android app where we have to support few different tablets, so the most recent new trick that I witnessed is devs avoiding hardware delivers, sometimes for months. Idea seems to be if you dont ping your team that you dont have hardware, then you can avoid working on related tasks with that hardware.
Worst part is that they get away with it. Our teamlead is a senior dev who is first time teamlead, doesnt code anymore and doesnt want to rock the boat. He is the type of teamlead who sets arbitrary deadlines, makes it sound that they are urgent and takes a few days off in the middle of chaos just before deadline. Restrospectives don't help at all and if I try to bring up stuff directly to him he tells me to bring it up during retrospectives. We discuss issues, rant a bit ant then continue carying on like nothing happened and nothing changes.
So little by little in the past 6 months we came to this point where 2-3 devs are carrying the weight of the team and are in a constant crunch mode, while others are allowed to slack. Its becoming ridiculous.
Problem is that this is starting to affect our morale. Only way that is left to keep my sanity right now is to pull away sometimes and also slack. Then I come back at full capacity, give my best for a couple weeks until I have to go and fix some basic leftover task that has been purposefully dragged out for 2 months and left unfinished, then I just want to scream and I know that its time to disconnect again.7 -
Hi fellow ranters,
Its been awhile since I last was here posting stuff..
So, I've commited to my effords getting shit done in golang. And I met a lot of painpoints, and I mean...
A
Lot
Of
Them.
Anyway, most of them are solvable by changing mindset or having some macros set up for no-one-fucking-wanted bloody boilerplate code that is omnipresent fucking EVERYWHERE.. **cough**
Steering back on what I want to rant about.
We with our team have one major problem with golang. There is no standard for docs in code...
Like, Fing legit. Everyone uses notation for closest to theirs heart language, so you get inconsistent-as-fuck notations for parameters / function descriptions.
We have functions that look like
//doSth does something
and also
// doSth
// @Summary does sth
// @Description does something but in more words
// @Param
and so on and so on
And trust me Im getting mild example.
Why this language does not have A F...ING (well defined, using proper definitions) STANDARD YET?
EDIT:
bonus context: We decided that too much of our code is undocumented and we go through efford of documenting it, but everyone sees it differently, and we can't agree on one single standard... So we decided to not refuse PRs due standard, as well, nobody would ever had PR accepted3 -
I recently started a new job where I’m working with someone who is vegan. This is great and I have no problems with it at all. My diet also leans heavily towards vegan and I understand and sympathize with the reasons that can lead to this choice.
However, I seem to keep ending up in inadvertent conflict with my colleague in ways that surprise and baffle me. For example:
* After buying and showing him a vegan product I had just purchased (and commenting that I had done so in the hope of avoiding a more animal-product based health solution), I found myself harangued at length about how healthy non-vegan foods weren’t actually healthy, and “Would you eat a human? Have they done trials on the benefits of eating humans? No? Exactly!”
* I sent an all-office IM asking if anyone wanted a cheese sandwich I had accidentally bought (accidentally in that I thought I had bought a different filling). I received an email back from him demanding that I don’t include him on any further “offensive” emails. This was followed up by an office update telling all staff to use work communications appropriately.
I enjoy my job and I did enjoy working with this person, but now I feel quite thrown and unsure of how to react to him. I’m pretty annoyed at being accused of being offensive for my use of the words “cheese sandwich” and don’t want to bring it up as I can’t see a way of that conversation going well (I’m not planning to apologize; I don’t think I need to?!). I realize the obvious solution is just to never ever mention food (or nutrition or words that aren’t vegan) again, but I need help with how to get back to a place where I feel like I am comfortable in my work environment rather than slightly on edge in case he kicks off at me again for some insane reason.11 -
I work as part of a small international team in a big corp , we work product quality of sorts but work closer to dev than qa , last week we found several giant issues and reported them in . Dev and Qa teams of said project are Indians . Meeting starts , two of my colleagues are indian as well , so dev , qa and all the other involved parties from india decided they should join in from the same conference room . My manager(he's a brit) presents the issues . Dev manager starts talking , qa manager talks over him , they start to formally yell at one another . One of them (couldn't figure out which one) started asking my two colleagues which one of them found these issues . At this point I had already passed a headphone to my ex-colleague who still sits next to me , he looks at me when he hears the question . I panic . Colleagues say they don't know (*phu* I didn't CC them in emails and my manager didn't tell them ) . My manager tells them to calm down , take responsibility and find solutions else he'll veto the product back into fullblown development . Other managers start growling and fighting again (more than 10 people were in the same room arguing) me and my ex-colleague decide to go take a coffee since I didn't have a saying in the meeting . We get back 10 minutes later , indians are still arguing over my manager trying to explain the issues a 4th time . I IM my manager and ask to drop the meeting , he gave me the ok and I dropped out, my head was hurting after an hour long meeting of angry indians arguing in a conference room and it kept hurting the whole day...yeah...meetings...fun time...
-
Im ranting in progress of the issue so i dont get the urge to do any of the things not seem as acceptable to fix this issue.
Issue: yesterday i activated a device i havent had any (even prepaid) service on in years, and had a 'new'(to me) number assigned...
Today, after being sick so muting nuisances immediately for rest, i check, 3missed calls from the same, less spammy looking number. I havent use this number for even a txt code verification at all... aside from 1 call to comcast (for the blissful irony of seeing if its an option (they need to survey physically) since im suing my current isp who didnt take my VERY NICE and explictly required in their business t&c, refund for the issue's duration.. after months of tryjng to directly get a message (not using my not technically hacking expertise like just scrubbing for email formatting and popped up in their inbox (calling them is more frowned upon)...
Their conclusion as to "why" (they nvr solved the issue... dhcpv6 was in aggressive lease mode(no response per lease(NOT batches) of about 60 for about 20 devices which i ofc use my /28 static ipv4 block... not ipv6 (they also claimed there was no logs til i dug and found verbose, long history high/med high debug level logs in their prop. dev's gui... which they forced me to use, has 2 separate cores/stacks which is done for 1 reason only... constant simultaneous ipv4 and ipv6 (so ofc was auto enabled)...
Basically it was spamming do to a config issue with their scripts, and their WAN6 dev/script's config. Have found a single person who knows what ipv6 (or v4) or wan6 device actually means... their conclusion from multiple "specialist departments " ..."we dont support ipv6 so if u had issues caused by using something we dont support it's your fault... sooooo ludacris.
.... ok back to main point.
callback options
1 schedule a call back for "later"
2 dont schedule and hang up/try some other time
3. cancel callback and join the end of the cue(from previous message it told me a callback in 6-10m or lose your place in line and go to the end... hours later no call and they definitely have the number as it reiterated -.-
...
answer to wait in line>
experiencing extremely high wait time
>your current wait time 31-60m
2.5sec later.. let me connect you to a rep ...etc (identical as in callback options intro)
> your current wait time is 30sec
waiting nearly 25min whilst typing this.(i did make sweet potato stuff, propagated a rose, fed JSON some of his new, in closure buffet of things he previously never encounted and bought a literal ton of rubber mulch)40min to a rep 5more to solve (last guy at same position didnt know this option exited, despite me decribing it verbosely to him.
Everything the automated syst asks is about account numer... there is none ive never even had a burner that was at&t brand.
Wzf.3 -
Writing simple driver for AT24C256 eeprom on pico (RP2040)
It turned out it was FT24C256A, which should follow same protocol.
After literally over month of coming back to it, getting stuck again, rewriting things (including some functions of pico-sdk), i almost gave up a d started just yolo trying random shit.
Afterall the documentation on addressing the chip fucking missled me -_- (1st bit is r/w flag and 2-7 bits are address, counted from MSB->LSB)
I made it work yesterday.
In meantime Ive rewritten Wire library, Ive modified someone's else rewrite, extended sdk to allow getting i2c registers, tried to use tiny go just to learn it doesnt support i2c slave mode, resoldered entire thing few times, measured connections few too many times etc.
Frustrated I doubted I will ever manage to finish putting this project together because it looked like Im just too noob.1 -
I fucking hate working with older software
I have a visual installer project, and it automatically finds the dependencies to make the setup file.
if I rebuild a certain reference, in which I made no changes, and then refresh the dependencies, it will add another dependency that already exists, but outside the dependency folder. So now I have two exactly fucking the same dependencies.
i can remove it, but removing it doesn't change any of my files. So there is nothing to commit. If you restart the project, its back.
And first it required me to actually add the dll to the build folder before it would build. And suddenly not anymore.
Im pretty sure its either the outdated installer software or visual studio 2013 fucking with me.
It also randomly added a dependency from blend. Which is apparently a known bug, but never got fixed in the two updates after they recognized it as a bug.
Fuxx you microsoft... -
How to handle a company in which I work as a junior android dev for the past 7 weeks where there is zero mentoring?
I have 2.5 year experience in android dev and then I had a 1.5 year gap. I was looking for a company where I can get back on track, fill my knowledge gaps and get back in shape. So I accepted lower starting salary because of this gap that I had. Me and manager agreed that I will get a 'buddy' assigned and will get some mentoring but nope..
70% of my scrum team with teamlead are overseas in USA and I have just 2 senior colleagues from my scrumteam that visit office only once a week. Ofcourse there are other scrum teams visiting office daily but I personally dread even going to office.
Nobody is waiting for me in there. What's the point if when I need to ask something I have to always call someone? I can do it from home, no need to go to the office.
My manager dropped the ball and basically disappeared after first 2 days of helping me setting up, we had just two biweekly half-assed 1on1’s where he basically rants about some stuff but doesn’t track my progress at all. I bet he doesn’t even know what I’m working on. Everything he seems to be concerned about is that I come to work into office atleast 3 days a week and then I can work remaining 2 days from home.
I feel like they are treating me as a mid level dev where I have to figure out everything by myself and actual feedback is given only in code reviews. I have no idea what is the expectation of me and wether Im doing good or well. Only my team business analyst praised me once saying that I had a strong onboarding start and I am moving baldly forward… What onboarding? It was just me and documentation and calling everybody asking questions…
My teammates didn't even bother accepting me into a team or giving me a basic code overview, we interact mainly in fucking code review comments or when I awkwardly call them when I already wasted days on something and feel like I'm missing some knowledge and I am to the point where I don't cere if they are awkward, I just ask what I need to know.
Seriously when my probation is done (after 6 weeks) I'm thinking of asking for a 43% raise because I am even sacrificing weekends to catch up with this fucked up broken phone communication style where I have to figure out everything by myself. I will have MR's to prove that I was able to contribute from week 1 so my ass is covered.
I even heard that a fresh uni graduate with 0 android experience was hired just for 15% les salary then me. I compared our output, I am doing much better so I definetly feel that Im worthy of a raise. Also I am getting a hang of codebase and expected codestyle, so either these fuckers will pay for it or I will go somewhere else to work for even less salary as long as I get some decent mentoring and have a decent team with decent culture. A place where I could close my laptop and go home instead of wasting time catching up and always feel behind. I want to see people around me who have some emotional intelligene, not some robots who care only about their own work and never interact.6 -
I watched an episode of Brooklyn 99. Cop comedy show for those of you who don't know. They introduced me to the monty hall problem? My brain refuses to understand it and im rapidly losing my mind.
Has anyone here ever written a program that tests it? I can't read math theorems for shit. But I can read code. And I need my sanity back.2 -
So I don't know if any of you know what BPA (Business Professionals of America) is (and its okay if you dont because its for highschoolers)
They hold competitions for us each year and Im going to be on my classes web dev team as the back-end python programmer. Weve already assigned everyone to their languages and were going to study so we can be prepared.
For the competition we have a few months to work on a website that actually works, front end, back end and all. There has to be forms and maybe even signup sheets that actually work.
Its really exciting and I'm definitely going to post the adventure of programming it along the way on devRant!!
If you wanna learn more about BPA go to their website, if your curious about what some kids get to experience then I'd suggest checking it out!!! -
So I resigned from work 6 months ago and they counter offered with a sweet pay deal as they were totally fubar without me
That 6 month deal expired today and they are totally surprised that Im not going back to full time (so I can work on my start-up side project)
I've offered to go back part time on a more reasonable salary and they are totally pissed. Surely the writing was on the wall!!
Here is an idea. When your bus factor is 1... Hire some other people! -
Had to take all my annual leave this month because I didn’t take any during the year.
Im fucking bored. I wanna go to the office..
Don’t know what to do with my time. I stopped doing personal projects a while back because I never stick with one idea for long enough to finish it..
My job gives me a purpose..6 -
Im back at University and need to code Java for my Semester Grades. My main languages are PHP and JavaScript.
Reading a book right now where it says "Java Developers are happy".
NOPE aint nobody happy about Java. Sad fucking Author of the Book, go fuck youself and retire. Java needs to retire itself, there are more modern languages available.7 -
After a big part of the day spending in Angular i decided to do something else. I went studying a bit on how to increase conversion. Partially because this was the main goal of the webdev team in the coming months. The UX designer saw it and told me if he where me he would study more code and scripting.
Like dude. Wtf. Im doing this for 1 in the 8 working hours. Get off my back asshole.1 -
Dear Quora
I logged out of your site because somehow you had me logged in and I don't like being tracked.
In the future, don't be petty by reloading all my OTHER tabs the moment you detect im logged out, intentionally breaking/disabling the backbutton, and then demanding I log back in.
kthnxbai.
Sincerely
- unsubscribed from your useless god damn spam emails.
If I can't even fucking read your site after logging out, like I USED to be able to, and you go so far as to detect my log out on OTHER tabs, disable/break the backbutton on all the OTHER tabs, and reload the page, then your site is useless as dogshit to me.
If I were the CEO of the executive who made this dumbfuck marketing decision I would fire him.
And then spitefuck his wife to drive home the message of how god damned fired he is.3 -
I'm organizing my leaving handover etc,
Just spent the better part of 2 hours making sure a graduate, who due to come on the project has the environment all set up, which is cool dont wana see them stuck,
But when u ask a mid/senior level dev how his set up is goin and he replys with his user name and password for a VM and says, "Work away at it yourself" ,
thats when im trying to hold back my inner Hulk and not lose the Fucking plot! Lazy Cunt! -
OMFG. So my isp sucks. Like most isp do now adays. I was watching TV and I was trying to find a specific channel. I look for the channel list online. And oh my fucking God the site is horrible. They have some continuous loading script so I don't have to load all 2500 channels at once. But... It's fucking horrible I got to channel 120 then tries to scroll back up to see if there was a search bar. But guess what... It kept scrolled bg me down. Then I thought maybe if I refresh the page. Nope... It does not send me to the top it sends me to the fucking bottom. Since I can't clear cache on mobile im stuck scrolling up. Why can't they have a site that just fucking works.2
-
Im new to devRant and i’m just looking if i could get any tips, example projects i could do to fill my portfolio? Im trying to sharpen my skills in web dev (both back & front + React)question web development html nodejs react javascript frontend css learning to code expressjs api backend4
-
I spent the last 3 *fucking* hours trying to get bloody BibLatex working on my machine. fuck me upside down with a rusty chainsaw >:( How hard can it possibly be to get 1 fucking reference working for god's sake!!? Referencing its basically the whole fucking reason people use latex alongside typesetting math, why is it so fucking hard!! And to add insult to injury it was working fine in Overleaf, but i have to go through fucking hours of pointless googling and swearing if i wanna do the exact same thing in TexStudio. Fuck! LateX can go to hell, i could have written so much in this time if only the piece of shit bibtex would cooperate a bit...1
-
Im currently working on a game, response and feedback is much appreciated.
-- idea--
I'm looking at creatures that will grow when someone that has bad thoughts or intentions.
-- story 1--
This boy grows up in a village that to his surprise, there no other kids in his village. The kids were mutilated. No one knows what happened. The ones with bad thoughts or intention will always be able to see that monster. As the boy grows up, he commits sin that are rather grave and when he grew up to 40 yrs old, he was dangerous person due to his character. His parents only saw his bright side of him and is rather unaware of it.
One day while talking to his mother, he felt rather uneasy, and went to the toilet, as he came out, she was no longer there. Thinking that she must be busy with house chores, he decide to head to the kitchen. Only to be greeted by his mother back facing him. She turned around and gave a big grin on her face that were as long as from one ear to the other. She then grew into a monster. The end
--
The story lacks a lot parts which I need such as gameplay, dialogues, and story itself.
Should I end it as the guy gets murdered? Or let the player think? Or leave as it is?
It's a 2d game though.
Ideas, suggestion or freedback is great!2 -
This is a fucking nightmare i still dont have internet connection ever since the shitstorm happened because of incompetent FUCKTARDS WHO CANT FIX THE FUCKING INTERNET IN THE WHOLE FUCKING COUNTRY ARE YOU FUCKING KIDDING MEEEEEEE
ALMOST 48 HOURS OF NO INTERNET FEELS LIKE I WAS A DRUG ADDICT WHO FORCEFULLY STOPPED DRUGS AND NOW IM HAVING CRISIS AND IM NERVOUS AS FUCK WHAT THE FUCK BRO I CANT EVEN CODE ON LOCALHOST BECAUSE I HAVE NO FUCKING INTERNET YOU FUCKING PIECE OFF SHITTTTT
SERBIA IS THE WORST SHITHOLE TRASHHOLE CUNT HOLE HORSECUM COUNTRY ON THIS FUCKING PLANET EVER
PLEASE NEVER EVEN VISIT SERBIA. ONLY GO TO SERBIA IF YOUR IQ IS BELOW 75 AND YOU DONT WANT TO DO ANYTHING IN LIFE BUT SIT BACK CHILL AND EARN BETWEEN $0 AND $300 PER MONTH16 -
I live in a college, sort of..
2 hours ago, the power was lost unexpectedly for less than a minute and then came back. Internet didnt tho.
They dont handle their own infrastructure in this college thingy, they hired a school to do it (it sounds fucked up, and it is a little fucked up).
Now little me is becoming impatient and offers my help. Gets rejected.
Additionally, i just started to have a fair sleeping schedule, and noe because the internet isnt working im about to fall alseep before lunch again.. i hate the people responsible for IT here..3 -
Ive been holding shits inside me for the past 2 days, friday whole day cuz of work, saturday whole day cuz of sexing my hot blonde gf, now i came back home, voted for a different president so my country can have potential to stop being a piece of trash and now that im home, the shitter does not know whats coming, its gonna be such a large dump of a nuke the shitter has never seen before. Im so full of shit i can feel it inside of me11
-
So im new here and trying to find my way. There is one colleague who's been sick for a couple of days and just came back.
Note on the appearence of this person: big, tattooed bearded, but im not scared easily ;)
Trying to introduce myself: "Hi, let's shake hands: i'm [name]"
Colleague: "Are you sure about that?"
Yeah. Great week with awkard interactions so far!4 -
I just finished a bunch of newly configured containers that I had to switch off centos7 to almalinux9. I have one thing to say,
Fuck NetworkManager!
I know im basically a dinosaur when it comes to any coding, especially scripting. I prefer notepad.exe or sublime to VScode... you couldnt pay me enough to use crap like vbstudio... but I know I need to get better at not just rewriting thing to suit my preferences since i have others working for or with me now.
so... I tried... I reeeeally tried to tolerate NetworkManager... tried to learn/tolerate dumb nmcli and it's matrixed array of dyslexic syntaxes. I just couldnt do it... that plus the damn default images having bs like an effectively blank, non-error-generating resolv.conf file.
NetworkManager got killed... I went back and edited my network-scripts and scripted those to other scripts for changing the statics around if/when needed... took waaaay less time.
I just dont get why something like NetworkManager even exists on any EL distro... yeah sure, wifi takes a couple extra steps and is super common now... but shouldnt be how any actual servers need to communicate. can people just not fathom putting shit in a few files in proper syntax anymore???5 -
So, i have that assignment about docker stuff. nifty piece of software i must say.
anyways im installing docker software on windows bc im thinking if i have something that gives me at least the correct structure and some skeletal syntax i will have a faster grasp of the thing. expecting some sort of high level ide but end up instead with what looks like a blank window, with the only obvious choice being sign into some bullshit i dont need. but thats another story
my point is:
when installing the thing it prompted me to install WSL2. which i supposedly am not supposed to have because my cpu doesnt support intel virtualisation. but being impatient (thats why i came to look for an assisted solution), i pursued the installation.
lo and behold: i end up with a shell prompt at the root of a linux filesystem!
i ran 2 or 3 muscle-memory commands and closed the prompt, i was in docker stuff up to the neck.
later on, when i go back to my project, in a virtual machine its sluggish af and screams at me that amd-v is not supported because of something something nested pages (will look up later how that one works).
dont have time to explore it some more yet, and especially experiment or even barely look at this glorious mess because i have something barely working and no time to have it fail.
but this story definitely left me perplexed.
and also : you can run WSL2 on an fx83508 -
So I needed a break from all the straight computer logic for days... so i figured i had 2 options, argue with chatGPT or go back to a dating app.
I chose the latter.
Im ocd with notifs... i NEED the bubble to be gone.
Found this gem...
"Hey beautiful Sara ;) my names is James king it very nice 2 meet u wow u look like a angel that fall from heaven 😘u mind me of a rose because how beautiful you are am how beautiful the rose is am I the best guy on badoo that u would ever talk with on badoo I actually look for Friendship and relationship ;) how are u today am wyd"
So... because im curious, esp when it comes to perplexing linguistics... im def gonna ask if English is his 1st language.
Normally i can tell within a sentence or 2... even tend to know their native tongue by then... this one has me stumped.
Anyone wanna guess if hes a native English speaker???
Maybe ill make a modest prize poolif there's a few entrants.
(he has plenty of pics so ill be able to legally find out in a few min... but ill wait til i dont get a response for a week)
Ill probably make a script to strip out the auto-messages... replying with an auto ofc... and the mundane crap that shows they definitely didnt go beyond the pics.18 -
oh man 2 1/2 weeks completely away from programming, IT things and so on.. was in trouble and in a shitty mood, but finally im back. hell yeah feels good.
salute guys1 -
Fucking google 2 step auth and their lack of customer service.
I have my account setup with my phone and a backup email account. No backup keys, since I only found out about those today! Thanks for letting me know this late in the game -.-
And yet. After I made a clean install of the os on my laptop. Tried to log back into my account. I am not getting text messages or emails to my backup emails (even though its allegedly sent.... And no its not in the junk mail) to validate my 2 factor auth.... Like fuck you!!!
If you gonna give us the ability to fort knox our accounts. At the bare minimum have some customer support to at least be train to answer a phone and tell me if your servers are having an issue or something. Im so in the fucking dark here and cant access shit.1 -
Very good new country that my job sent me to. But im running on this rain now back to the hotel so i can take the biggest fattest meanest smelliest shit ever4
-
Hey DevRant Fam, hope everyone is doing very very well of course, once again id like to apologize for my lack of activity, but i'd love to get some great advice from you guys!
Im nearly going into my last semester in which i will be going into my internship!, and recently id love to be open with everyone i got some harsh feedback, which is the first time ever someone opened up to me on this level... i was told that unfortuneately if i wanted to work in such a space as HFT or trading software i really need to up my game in problem solving.. i was told i do struggle to solve problems and personally i do understand how he got to that conclusion because it is the truth that it does take me longer to learn some concepts and its fine :-).
But i'll never give up learning something!, so my internship will be in either Web Development or Front end development, i have not touched base on web dev or front end development because i been heavily working on C# and Java (Android), i'd very much appreciate if someone could give me some great tips of getting back into web dev or front end, im very excited but nervous!.
also guys sorry i do ramble a lot.... but that's just my nature!
Also any advice on internships?, because this is my actual first ever real job in terms of development... :D
Kind Regards,
Milo <32 -
Previously: https://devrant.com/rants/1207077/...
Talked the bossman, he just asked that I finish the project before being put back on my usual ERP maintainer role.
I agreed to it and the faster this fucking plugin is done, the faster I can go back to my optimization and maintenance project :D -
Does anyone use pushover.net or know a reliable / cheap push notification app with an api behind It?
Im trying to setup some monitoring alerts back to my phone, using slack / teams etc for personal projects seems pointless.
Emails are currently being sent but this relies on me actually looking at them and I tend to miss a few important ones. 😂
Not to worried about daily / monthly limits, it's going to be < 20 notifs a day kind of thing on a terribly bad day.6 -
im on a backlog meeting and i need to shit so badly. ironically the meeting is "back-log" too and i need to shit a log from my back lol. i am full of shit!13
-
Last week I hired a friend of friend to work on my projects. Hes a young and friendly guy. However he never worked in actual office and it shows. During the meeting he brings his phone and in the middle of explaining he pulls out his phone to respond someone back. Basically lacks professionalism and has this young person cockiness where he thinks he is competent to handle everything while in reality last week he did 2-3 hours worth of work. I want to set up some boundaries but I dont want to seen as a harsh dictator. On the other hand Im paying him over the top even though he doesnt have skills, but the least I want to is a decent attitude and effort. How u would advice me to approach this and teach him to get his shit together? Im already becoming resentful and next week if he keeps treating his work like a school project I will let him go.
Im really trying to setup a nice environment for him to work at, I rented a nice office in a hub space and also bought entirely new laptop plus monitor setup for him to work. I even took him for drinks and lunches but for some reason I start to feel that hes taking that shit for granted and Im being too good.
Hes not proactive, it seems that he will do bare minimum that I give him.8 -
Im getting stalked so much by recruiters right now! Im ignoring a call every 10 minutes and writing back on mail/linkedin ever 15. Fuck offff! Please!
Im collecting all names, mails and numbers and maybe i’ll just fucking mass mail them all haha. And after that sign them up for freaking midgetporn muahahaha -
First XLR microphone setup, €265..
Sending my USB mic back.
I really hope im satisfied with the new stuff when it arrives. -
So for anyone interested in or following my drama regarding my breakup first ranted about at
https://devrant.com/rants/1651305/...
I figured I would provide an update. Things have been going surprisingly well. Yesterday after some initial avoidance and silence and anger we just kind of went back sort of to normal, just being friends instead of lovers. She went and picked up two cats from the shelter and we talked about logistics of how this whole broken up thing is going to work, then watched some tv and ate dinner and stuff. So not too bad.
Today is still not too bad, but as you would expect emotions are still a thing. We talked a bit in the morning but basically just about necessities. She then took her laptop into the bedroom to be alone. So basically just sad emotions all around today, which sucks but it could suck a lot worse. On the bright side, it is looking like we can keep the friendship intact after all our emotions settle down.
Thanks for all the comments and ++s on my previous post. It really helps to vent a bit and have other people care how you are doing.3 -
I had originally written a rant, asking about workflows. It then devolved into something much worse > Reddit-like taunting and whining.
Reference rant(https://devrant.com/rants/1554055/...)
Now before I go any further, yes I fell into his trap and sort of got taunted him back. Ill take half of the blame and hate that it might deserve.
So new question, why do people start off reading a rant (I thought my rant was a genuine question) and immediately enter a dick fighting contest? - myself included7 -
Usually an idea comes up in the back of my head... Then i wait. After some time, the idea comes again. Now ill think about it, when i lay in bed, when im in a train, everywhere. Ill think about the technical implementation. How ill present it to someone else. To my boss. To my little brother. I think about the counterarguments, ill simulate discussions in my head, how ill defend it.
And then, one day, while thinking about it, ill start writing it.
Edit: Its like my brain needs enough entropy to do something. Then it works, then it generates entropy again, eg youtube, gaming, working on something else, dreaming etc -
I decide to study Data Science the last 10 months, right now im very competent and have the skills get hands on real projects.
a few months ago i meet a guy on LinkedIn, i help him with some task for some stuff he was doing.
a few weeks ago he say he will hire me for work on an startup he is running with other guys.
after that he never get back to me and not get any response to my messages. i dont know what i do wrong.
now im here feeling cold and dont even know what todo for get some remote work as data scientist.
feels bad bruh :"( give me some directions, where to look for Remote Junior Data Scientist Job?9 -
Just received an email from a company i applied while searching for a new job. They sended me this little assigment to show my skills since they had the feeling i couldnt show them much.
(they browsed through 3 of my websites while i was there, including a check on the code)
It was a simple layout assigment. Just a responsive page with a hamburger menu (also mentioned during this interview)
It took me a couple of hours to create it and ive send it back in the hope of some positive feedback.
Feedback: assignment was pretty good but it show a lack of php experience. I was clearly more on the .NET side.
....
I just sended html, css and js files as requested. HOW THE F* DO YOU COME TO THIS CONCLUSION?!?!
Damn idiots, im glad i found people that actually do know how to hire people!2 -
opinion:
If something goes wrong is the 1st response to investigate
Or
Jump on IM and ask the person who last committed?
I would be in the opinion to have a look yourself and try identify the problem before fucking ranting at the last person who touched the code,
Reasons, Maybe that last person is busy and doesnt want to context switch back for a simple problem that would take less than 5 mins fucking investigation time, 1st thing in the morning too doesnt help!1 -
I love this weekly group rant, it made me think back when my mom started to work in a kindergarten and she used to take me to work when i was 4-7 years old ('94 - '97).
There was this "TV" and all the kids used to smash the buttons on it. It also played sound, but there was always a lot of kids there so I was shy to ask them if I push the buttons too. But I was the teachers son, so I didn't had to sleep in the afternoon, and then I discovered this computer thing I was amazed, it was like nothing I saw before, you push it and it does what you pushed and, *_* this smiley is exactly me back then. It was probably an old commodore with green text on the black screen. It was the moment when I decided to get more information about this wonder.
In elementary school (around '98) we had this computer room and as I was one of the best students back then I was granted access to it. It was a huge success in a post communist country to get money for new computers to teach us kids to use them back then, so only the chosen ones could use them, and I was one of them, one of the best time time of my life, honestly. At this moment I knew for sure, I want one and when I grow up I gonna work with them. I had no idea what you can do with it but every adult is talking about how well paid are the people who use them at work. :D it sounds funny now
In '89 or '99 we visited our family in a town far away. My grandfathers sisters boyfriend had a computer and he said, look I also have internet. This face again *_* what the hell is internet. So he explained me this internet thing which "makes all computers connected, but you have to pay for it and it kinda works like wired phones you know. Here you put the address and you can open the website"
me: website, whoooa *_*
8-9 year old clever me: "but how do you know what are the addresses, do you have a phonebook for these addresses?"
he showed me google, and a slovak and czech search engine, I remember searching for "funny pictures" on the slovak search engine, because I was thinking If I search google, its english so he would pay too much :D
I didn't had a computer until I was 13 years old, but then I started to messing with Microsoft Front Page 2003, was amazed with the html and css generated by it and started to editing it.
Now Im a front end web dev -
!rant
I had that installation of windows 3 to 4 years now.
I'm using a third party software for backup so everyday at 23:00 the backup service starts. The image is stored on a second HDD.
First i want to point out that i set up the windows maintenance around that time too. So any updates should occur then and i remember finding my PC at login screen couple of times meaning a restart had taken place.
Everything was fine all this time.
Couple of days ago i returned home late around 2 am to find a blue screen saying that the computer did not boot property the last time. Had two options, just restart or try to fix.
Of course i will fix it, come on.
Everything failed. Everything. Even safe mode won't boot.
Who cares i have the back up system image. Boot from the bootable usb stick and restore. Well nothing is happening. It's just freezing at 5%. Cancel. Try again. Cancel. Verify the image. Success! Try again! Nothing.
Damn. Im really tired, off to bed.
Woke up tried fixing and restore but to no avail.
Fuck it i will just install Windows fresh. I was set up after an hour or so installed the necessary drivers and such. Let's see that image of any file i want to get back.
Image is corrupted. What the fuck? How? Damn it. Mount and recovery also failed.
That's it. I did not lose any important files. I save everything on a different drive and also the backup.
But I'm wondering what had gone wrong.
My guess windows rebooted when the backup was running. If that's the case shouldn't be a check if such service is running?2 -
Bullshittery continues. This time around, absolutely innocent, clamav is root cause. For once not incompetent idiot, but piece of software. IDK if that makes me happy or upset.
So our email server that I configured and took care of died. RIP. Damn, better put it back together ASAP. So Im under pressure, while still pissed at everything that I ranted before (actually my last 2 rants were throttled, and in total all of that happened past 60 minutes but devrant rate limiting) I start auditing logs. You imagine, we kindda need it NOW, and it's second time last month clamav is pulling stunts and MTA refuses (properly) to work without antivirus. So pressurized, I look at logs, what the fuck went wrong.
clamav deamonize() failed - cannot allocate memory
Hmm. Intresting, but sounds like bullshit. I know server is quite micro becouse they wanted to save on costs as much as possible, but it has well over half a gig free ram just before it crashes (like 800MB) with that message. Is it allocating almost gig in one call or what? Looked carefully at trusty htop while it was starting, and indeed, suddenly it just dies with quite a bit of ram free, almost as much as it weights already. And I remember booting it up when I was configuring it, and it had fair bit of headroom.
Google, help me friend... Okay, great, so apparently at some point clamav loads virus DB into ram (dafuq?), and than forks, which causes spike of 2x the ram usage, and than immidietely frees it up.
Great, that sounds like great design decision... At least I know, I can just slap on SWAP file, restart it and call it a day.
It worked, swap file is almost empty (used 15megs, 900 megs free ram, whatever).
That leaves me wandering, who figured out to load DB to ram? That means pretty much that clamav will eat a little bit more ram each vir db update, and that milisecond "double ram" spike will confuse innocent people who just wanted to run clamav and it worked last *long period of time* and now crashes without warning without any changes to configuration.
Maybe there is logical explanation, I want to know it.8 -
Day 8 of devWholesome...
GUYS IM FINALLY BACK! I am so sorry for the stop in posts, however I would like to make it known that I am still a student and still need to pass school. devRant was just not my priority at the time, but with the break coming up and weight off my shoulders I can continue doing these posts. In proper fashion, I want you to tell someone you love, "I love you." or "I appreciate you" today. You never really know when that might get taken away and I don't want you to miss the chance to do that. Make sure you eat all your meals, drink your water, and as always, make the most out of your day!
P.S.
I missed doing this so much, I am glad to be back at it!2 -
So basically I joined this new android dev job 3 months ago. I did android dev for 2.5 years and then had a gap of 1.5 years where I did game development so Im comming back into android dev as "junior" however Im tryharding to prove myself and reach mid level as fast as I can.
I had it planned like this from the beginning: original plan was to do really good during probation period so I could ask for a raise (which I did). Now while Im waiting for answer (which will take 2-3 weeks) I need to keep the show going so I am sacrificing evenings to accomplish goals. I ham going to these teambuildings, I am volunteering in this job fair event and Im joining bars with the not-so-social devs 1-2 times a week just to "fit in" and be noticed. After getting a raise I plan to take it down a notch and somehow relax....
During the usual work week I rely on stimulants (coffee/cigarettes/concerta) to get me through the days and then I use xanax or alcohol to relax. Worst part is that I am totally drained exhausted after long working week. I dont want to go out with my girlfriend. My libido is at its lowest and we do it maybe max 2 times a week and it feels like a chore to me. It feels like I exist only for this job and only to please everyone around me and it drains me out completely.
I feel like I am burned out. I wish I could just quit this job and run away somwhere warm for 6 months to chill alone and take it easy and recover but I cant. Im stuck in a trap. I have to pay off mortgage, I have to pay off bills. I am approaching 30's soon and I became fat and balding, I want to loose weight, I wanna get a hair transplant to at least enjoy my 30's properly. Im only 28 but I already have a lot of grey hair just because of immense ammounts of stress I have to deal daily because of my ADHD and anxiety. Also my gf is kinda dissapointed that I havent proposed her in 3 years of our relationship. I feel so much pressure and obligations to the point where I feel that theres no point in living if I just exist for the needs of others. I cant imagine getting married and having a child now - life is already complicated chaotic mess as it is.
I dont't know why I throw myself 150% at projects and hyperfocus so much to the point where it becomes my priority in life? Am I compensating for my lack of executive functions by throwing lots of effort and care in hopes that I will be validated? How to learn to take it easy instead of always thinking that what Im doing is not enough?
It's not even the problem of this job. Its just me. I had my own company for 2 years and I was dealing with same burnout problems...2 -
Hey guys,
I'm waiting for the first round interview result...I know my result...I didn't do well...I don't know why im waiting, may be karma turn back and change my results...3 -
Im not a thumbnail maker but what does this look like? im using scratch btw lol has a lot of block lag that when u play projects you freeze for a bit , same with blocks , the only thing that kills lag is something better than chromebook or my pc definetly run 3d scratch games on that xD includeing an android emulator so i can go back to scripting!, (what does this look like tho?)22
-
Why you should use sketchware and not use it at the same time regarding: encryption
sketchware the app is known to build apps by dragging elements to the screen then coding them with blocks or even write your code with the built in ide but there is one thing every developer fears. ah yes. the reverse engineers (or modders)
random guy [rates: X]: sketchware encryption is trash! are you serious?! string fog?! class rename?! i decrypted this whole app with the software i made >:D
sketchware dev wrote back to random guy: string fog isn't working because you decrypted sir! there is nothing we can do sir but email to our email and we will get back to you in a few and fix the problem
i have to say this is why i stick to android studio too many skids decrypt the C++ files or the mod menu just to edit stuff :) i also build some games im learning android studio game development but at the time lets have fun and mod other peoples games1 -
Heyyy DevRant Fam! :D, hope everyone is doing very well today! i would love to get some input/advice from my fellow developer friends here today... so Milo has gotten himself into a sticky situation... So recently i had a little opportunity to get some mentor-ship or internship through a family friend, and im sooo excited but nervous at the same time.. i sometimes think to myself am i really 'good enough for such a position'?? but however since I've never really experienced this sort of work, whats their to lose? or is this a bad way too think about it? :D
so ladies and gents, I'm really interested in the stock market and that sort of finance, and i think id be a good fit to build tools for traders, if i cannot get into that sort of position, why not work back office and have more of a support role? I'm always very happy to work my way up as I'm highly motivated!, however in the case that i manage to get into such a position, I'd love to know, what sort of things do i need know to be able to land such a position? if you can give me any tips or advice id be extremely grateful! :D
If you have managed to get this far into my post, I'd love to say thank you so much! and i really apologize for rambling on... i generally always do that.... and also i want to say thank you so much for taking the time to read my question <3 really means a lot to me!
just quick note letting everyone know as a hobby project I'm building a little list app where i can save my favorite stock tickers/symbols into a list and see the price changes over time (through alphavantage's API) :D
Kind regards,
Milo <3 :-) -
Had a freelance client half a year ago, they called to do some edits and adding features yesterday. But i dont work im web development any more and no longer feel like doing it. What should I do. Can i just bail or do i give the their money back or whats the best course of action here?5
-
Hire are a few tips to up productivity on development which has worked for me:
1) Use a system of at least 16gb ram when writing codes that requires compilation to run.
2) Test your code at most 3 times within an hour. This will combat the bad habit of practically checking changes on every new block you write.
3) Use internet modem in place of mobile hotspot and keep mobile data switched off. This will combat interruptions from your IM contacts and temptations to check your WA status update when working.
4) Implementation before optimisation... This is really important. It's tempting to rewrite a whole block even when other task are pending. If it works just leave it as is and move on to the next bull to kill, you can come back later to optimise.
5) Understand that no language is the best. Sometimes folks claim that PHP is faster than python. Okay I say but let's place a bet and I'll write a python code 10 times faster than your PHP on holiday. Focus more on your skill-set than the language else you'd find yourself switching frameworks more than necessary.
6) Check for existing code before writing an implementation from scratch... I bet you 50 bucks to your 10 someone already wrote that.
7) If it fails the first and then the second time... Don't try the third, check on StackOverflow for similar challenge.
8) When working with testers always ask for reproducible steps... Don't just start fixing bugs because sometimes their explanation looks like a bug when other times it's not and you can end up fixing what's never there.
9) If you're a tester always ask for explanations from the dev before calling a bug... It will save both your time and everybody's.
10) Don't be adamant to switching IDE... VSCode is much productive than Notepad++. Just give it a try an see for yourself.
My 10 cents.1 -
Worst part of being a dev?
When you need to work together with people that are too stubborn. Recently I needed to work together with 2 guys and when they started ranting on me for literally nothing, I realized not everyone is able to work in a team.
Now im ranting back on them.
What are your experiences with people like this and what do you do to make teamwork more enjoyable? -
Hiya haters and non haters =) what has been going on while i was away?! that last rant about scripting was cringe all i should have said was andlua.
Hi everyone im back and now on return statements on JS on code cademy easy!
i know how to make classes, and more
i also started learning Ruby, python, and thinking about java1 -
I. FUCKING HATE MY STUPID ASS UNCLE. HE IS SUCH AN ASSWIPE BRO ISTG he moved in with us and like I didn't think it would be such a big deal but HIS ASS SCREAMS AT ANYONE WHO DISRUPTS HIM WHILE HES LITERALLY DOING POT IN THE KITCHEN AND LIKE.. BRO DISRESPECTS HIS MOTHER WHO KEEPS THE ENTIRE HOUSE STABLE. HE TAKES ALL HER MONEY and doesnt lay her back like EVER?? And HE FUCKING RUINS EVERY HOLIDAY WE HAVE. And i cant even say anything to him because i have to respect grownups like man.. he aint even man enough to be respected 😹😹😹 he thinks hes scary bro like no. hes just a self centered lazy ass bitch. Im waiting for the day he moves out lmao.3
-
Went to take a shit
But before i rolled my pants down i thought about having to waste time to roll my pants down waste time to sit down waste time to shit waste time to wipe waste time to get up waste time to pull my pants up waste time to back to chair and frankly.... i got quite overwhelmed already so i said Fuck off just stfu and shit inside my guts. And so i did. I refused shitting in toilet and got back to my chair to let my stomach now shit inside me and shit all over my guts. Fuck off. Dont give a fuck. Im too old and too fucking tired to waste so much time shitting. From now on ill have to hold my shit and shit inside of myself until i really really cant take the load and need to dump it somewhere outside my body
So because of that I'll literally walk full of shit. I'll be The Shit. Full of bullshit. Exactly how full of bullshit are the recruiters are the entire job market, and especially, how FULL of BULLSHIT is the ENTIRE CORPORATE WORLD6 -
Ok being a developer and a technical assistant at the same time
Yesterday was out in the field we where fixing network at one insurance company and extending telephone line to of the offices....man what a labor intense job....
we had to drill a whole on one of those metal trunking.... man those fuckers are hard as fuck
having had spent the whole fucking day out the office i get a call saying 1 of the laptops at the office didnt have OS installed and one had a defected screen and they where in stock
and Im supposed to be checking these laptops when they come before going into stock
and Im like WTF!!??? confused and shit + being tired
got back to the office and fuck it was a shit show
the whole technical department got fucked over this and Up to now I have no fucking idea how those laptops got into stock and we missed it
My only answer is they never came for checking and if you try to air that out they will say you are try to blame some1 else for the fuck up and FUCK it
We had to write reports this morning me had 2 from the tender issue
fuck this
fuck this
fuck this fucking shity place -
Hey guys, i made a program years back and just refactored the thing and gave it a nice GUI. I made it mostly so I can use it in my daily life which I do but now I might release it as open source and give it to some friends. But I’m facing A problem i never faced before...giving it a name. Need some help 😂
Basically, i have tons of series, so i created it to maintain a nice naming convention for the videos but obviously can work for any file list.
- it renames them in a couple of different ways (replacing string occurrences in the file names, appending - prepending strings, completely renaming it alphanumerically. Anyway I use those features most (OCD i know)
- it also grabs subtitles for movies and series (parses its way through subscene and yifisubtitles until it gets to download the zip file and extracts it for me) .
- It also plays random episodes for me when im confused what to rewatch ( just opens a random file in a directory u point it to)
So any name suggestions ?1 -
Anyone know of a good docker backup tool?
I'm working with fairly limited space here so Im looking for a tool to allow me to backup and restore my docker instance without storing easily recreatable data.
That means that what I want to backup are:
- Container specs (inspections or the like)
- Contents of persistent, non-nfs volumes
Since the image and the contents of my nfs volumes are stored elsewhere, and my space is limited, I decided not to back them up. Same for non-persistent (unnamed) volumes since they mostly contain stuff that you don't want to recreate on every container update or recreation but can easily be recreated if needed.
The hope is that this approach should give me a pretty slim backup while still preserving everything I need to recreate my whole docker instance.
Thanks in advance!11 -
My week is up with Linux , im back on windows I tried about 10 variations 🙄
Best I could get was manjaro with KDE
It was pretty close to what I was looking for but I still have to install some of the programs I need using command line 🙄 how do they not have installers for them yet ... Crazy maybe they do.
I need a virtual machine which is fine I can still use my graphics so it's fast! Play games etc
But it crashed and died.
Not only that but every version of Linux.. it felt 🤔 shitty like the mouse was bolted tight to the screen and only heavy movement would do anything . Yes I have high mouse sensitivity (very high) but it feels sooooo rigid
Here's the thing I like what Linux is trying to do... It's just horrifically executed the learning curve to extreme and there is no central this is how you do it. With good reason yes but if you give someone to many choices they can't decide and give up and I think that's the only reason Linux isn't winning . It's to complicated.
Android is the only Linux OS I love manjaro did well .
But android is simple effective and does what it's meant to without any help
All other Linux os' are .. developerised as in only a developer really truly stand a chance to grasp it no normal folk out in the world.
People say Linux doesn't have long left to go... To me it seems like they are still miles off no closer then 5 years ago.
That was my experience at least ...7 -
Flutter may be great. I want to learn it, so i decided to make this small app in Flutter.
About 2 hours later, and I STILL HAVENT POSITIONED THESE FUCKING BUTTONS AS I WANT IT.
I calm down a bit, and decide to not give a shit about the position of those buttons.. Moving on to launch an URL when one of them is clicked.
Found sweet few lines of code i could copy/paste. Ans tadaa, didnt fucking work. Fuck. Googles a bit, turns out i forgot that hot reload is not for major changes, my bad.
I decide i want to add a few extra features, so fuck Flutter for now, im going back to Android Studio.
Reading Flutter is great, writing it with no knowledge of Dart is.. what the fuck did i even think.7 -
WHAT. Just happened
I experienced the weirdest mandella effect
I went to take a piss in the shitter 🚽 and while i was pissing i looked down and i SAW the piss going in the shitter 🚽
Looked up and a few seconds later when i finished pissing i took a step back looked down AND THE WHOLE FLOOR WAS COVERED IN PISS.
How??
It turns out i never pissed in the shitter somehow even though i was literally right next to it touching it with my legs, i didnt piss on myself but did on the entire floor
How????
Am i going fucking insane?
Or is this a mandella effect?? I KNOW what i saw and i KNOW what i remember seeing, and pissing on the floor was not it!
Im losing my fucking mind!9 -
now... Im just tired and bored of what i do. i had a very hectic year rewriting a core functionality in my company, it was full of optimizations, logic improvements and learning new things.
I took 10 days off hoping id come hating my job less. I learned kotlin and worked on a personal server side project with it during the vacation and honestly i loved it. I missed learning new languages and concepts.
so i thought, well if i enjoyed coding during the vacation then my burnout is cured right ? well once i went back to work today I felt like shit and couldn't do a thing. disgusted of the idea coding for my employer. Too tired to continue my personal project after 8 hours of my job
I guess im back to square one2 -
Got a replacement laptop last Friday after I sent the other back for a repair and installed arch (manjaro) but I think im gonna go back to Fedora which I had on before with xfce2
-
Well i got my motivation back.
So i decided to make a game in unity.
It is going to be simple FTL like game. It is going to be much simpler than that mamoth of a game in 3D that i planned. I want to learn and have some fun designing the game from scrach. Yup and creating all of the assets.
If I manage to create a decent game im planning to sell it for like 5$. It might boost my funds a bit if i manage to finish it.
I have few great ideas how to develop that game. Mechanics, community support and others. Of course first i have to make a boilerplate. I cant start on those ideas if i dont have anything to work with! I hope it will be fun! Wish me luck! (And i wish everybody else luck too!)2 -
I feel like I'm living in an unreal world at the moment. People here are actually eager to sometimes leave their job, but I just I had my last day here and the goodbye drinks, and Im actually sad to leave this company.
I was not forced out, but the TLDR is that this company has quite a substantial financial bump a few months back. I literally graduated yesterday, so back then I was like I needed a somewhat stable company to actually start my work life (although I worked for 2 years at this company during school). At the same time this company (which is financially going uphill again) made me a very generous offer to stay, which I did not deny nor accepted because I'm already committed to this new company I'm going to start at this Monday.
Really weird feelings, and I'm truly sad to leave. Especially after having one to one's with my close colleagues who genuinely praised me for my skills, from who I also know that in no way they are influenced by the boss of the company.
Man, I doubt any have been in a similar situation, but is there any advice which could make more confident I made the right decision that I stopped working here?2 -
💧
There was a 1 second delay when loading images on home page with a bunch of hot model babes in a masonry grid
Why? 💧💧
Maybe pagination is fucked. Lets reduce it from 100 per page to 10.
Still same shit.
What do you think why this could be?
Comment below 👇 right now
(The images im loading are just dummy images from unsplash)
I tried using rxjs. Observables. Flatmaps. Custom array push. Array loop. Change detection to update UI. Chatgpt.
Nothing
Every time i switch tab and come back then theres another second of delay with blank page before content appears
Wtf???
Turns out -- unsplash api was returning me 6K to 8K Fucking images. HEAVY. HEAVY FUCKING IMAGES. and i was apparently displaying 6000x8000 px images, 20 times per page. Thats a lot of fucking pixels! I reduced it with ?w=500 in unsplash api at the end and magically there is no delay now and everything works in an instant.
Fuck off6 -
//norant
I used to run linux with photoshop and illustrator on wine but I recently switched back to windows so I can run the adobe stuff natively and im using the new linux subsystem and honestly , it works pretty darn well.3 -
I'm new to Python and have been using PyCharm. I like it. I've tried just about every IDE on the market now excluding maybe a couple of the ones who don't have free versions and I always end up back to Pycharm.
I like how it's strict about formatting. My opinion it builds good habits. I watch a lot of tutorials on youtube among other things and I'm learning slowly but still I getting there.
My conclusion is that their seems to be a complete lack of consistency in the Python community regarding PEP and formatting standards. One person does it this way. Another does it that way. Makes it extremely frustrating when trying to learn because you have all these people doing things slightly different.
One guy says dont use camelCase another says yes. Granted some of these tutorial are a couple of years old and I know things change but I can't imagine it changes that much from 2 to 3 yeah but when you can't even be consistent with your spacing of your print functions or comments it's like nails on a chalkboard.
And thats just the beginning. I'm a tabs guy some are spaces. That's a whole other rant or whatever. Hardly the point really. Lots of different inconsistencies but I'm running out of characters.
Maybe im just not finding good videos. They all act like they know what they are doing and to an extent I suppose they do.
It takes a lot of guts to put yourself out their like they do ready to be scrutinized so you have to at least have a clue of what your doing. Some of these people have 10s of thousands of subs and I find myself picking apart every little thing they are doing and find many times they are teaching wrong standards. At least that's how I see it from the little experience I have now.
I'm just beyond frustrated and would appreciate any advice that a person wants to give. Keep in my I'm new and may just be misguided so try not to be to harsh if I've drawn an incorrect conclusion.13 -
Alright I know what you’re thinking. “Bubbles, again? You’re doin this aga-“ yes I am.
As some of you that tune into my rants on the daily should know, I have the tendency to want to LEARN and just throw my thoughts in here cause you all understand me more than most people. WELL IM BACK AT IT AGAIN, and with the anxiety of when to do things.
I’ve been preparing my C# skills for a job and currently working on projects (one at a time) to put in a portfolio and just help me learn by making cool things. BUT I also have books I want to go through and read to teach myself C and Security stuff which is spread out in three different books. But I don’t want it to seem like I haven’t put my time in with C# and took my time with it. And I just idk when a good time to transition into all that. Which I feel like after a few more C# projects I’ll be okay. Then go through those books in the order I have chosen.
I get a lot of enjoyment out of watching people on YouTube program and talk about what they’re doing. Idk if that’s just me.
I feel like I’ve been making some real progress on my project though. I’m quite proud of myself
I also have a small story saved for tomorrow so stay tuned for a barely entertaining short story
I hope yall have a great day -
>start doing html email today
>back to 90s...
>start hating microsoft..demit outlook
>im gonna stuck with this for few days
>arghhhhhhhhh
>ok.... -
!dev Nice surprise... Hopefully...
Been having a lot of teeth problems and need like 2 crowns and 1 filling now... Old fillings just suddenly fell out. My regular dentist plan is ok for cleaning but isn't so good for these expensive treatments. And it seems the dentists in network are sorta so-so... The original fillings were done by them like last year....
Well somehow it popped up into my mind that with COVID.... Given its a health crisis and the govt is bending over backwards to deal with it... it may also let me change insurance plans during the year.
Usually enrollment is once a yr until you change jobs... But when I googled I saw that apparently they did.... Though it's upto the employer and the insurance company. They have to negotiate and allow it. Not required to by law.
So anyway last week, I called up my HR asking if they allow it. The rep said they'd need to ask higher up and get back to me this Monday.
I never got a call though but today I took off to deal with all the health stuff and just take a personal day. So I called my "current" dentist insurance to ask what I needed to do to see a specialist for the root canal crown as regular dentist can't do this one.
But they couldn't find my policy because it turned out it was cancelled last week. At this point I'm likeOK WHO FUCKED UP... WHAT THE BLOODY FUCK... IM UNINSURED NOW?!!!
I login to the company benefits site to get their support #. But it also shows my current plans. Where it shows that it got switched.
I still had to call the new insurance to get my ID info...
But I'm like hm... This seems to have worked out well... Assuming everything goes as planned. Basically got 1/2 year on cheap normal coverage but now that I need it, got to switch to the more expensive coverage, which now comes out better: lower overall costs, and better drs...1 -
i just took a ride with my brand new bitch (3rd one in the roster) for our 2nd date. we kissed on first and now on second date she loves me.
while kissing, she cant stop kissing me. she said she never fucked a guy as friends w benefits but im pushing her to do it for the first time.
I'm the motherfucking slut maker.
I'm the creator of sluts now.
I take control.
I turn good girls into sluts rn cause my aura is beyond the universe and all these bitches can feel it by saying "i have that something" whatever it is
Now, i cheated on my blonde ex whore, and on my brand new gf, with this 3rd girl (I'll cheat on the 3rd girl too)
I will break as many females psychologically as possible and that is the price they have to pay for the psychological damage caused to me by my blonde ex whore.
I'm turning into a player rn and I'll fuckk all of them
They are all obsessed w me cause I'm different from the rest
They cant resist to let me fuck them
My aura attracts them
Because my behavior is nonchalant
I am on a great arc
2025 looks promising as Fuck
Also my current job offered me to work on another projects as a senior DevOps engineer which finally includes rancher kubernetes grafana prometheus harbor splunk etc, which pays me 4-8k euros a month
life is finally starting to become better but i went through Fucking hell to get here!
I got whores and i got money.
Im almost stress free.
The only thing left is to get more whores (3 arent enough, i need a roster of at least 10+ to be on the safe side), and i need to become a millionaire from theft in crypto
Then i fk 100s of whores all day and drive fast bmws
Btw i was driving my new hoe in my bmw late at night rn and a c63 coupe raced me. That mf gapped me! So i put sport + nitro mode on and gapped that mf so he quit
My bitch was holding my hand and said he gave up (but he actually let me win lol cause he saw i was with a bitch) i cant race a c63 coupe with a base model bmw bruh🤣
while we were kissing in the car (3rd bitch) i was leaking so much fucking precum (i fucked and cummed 3 times my blonde ex whore prior to this on the same day), and i was still horny af. this bitch got my dick rock solid hard
so then i came back at my blonde ex whore to grab my laptop and i kissed her, literally 2 minutes after tongue licking the 3rd side link
my ego is so fucking high and it will only get higher from here
it feels so good having aura, beast car and a roster of whores.
my day today was so fucking wild and random
my life is finally starting to make sense and become worth living
whores, money and fast cars is all i need in my life
(my new gf whos in love with me was the least important and she had to wait for hours for my reply until i get finished fucking my blonde ex whore and taking my 3rd link on a date and kissing (next date needs to be fuckijg w my new side link))
time to search for the 4th side link
I LOVE THIS💯10 -
8 hours of coding later and Im back where I began, and Im not even a dev, Im a sysadmin with a little PHP background tasked to write a Sku generating bundle for a PIM running on symphony.
<Insert I have no idea what Im doing dog meme here>1 -
So...
I'm pretty sure that my satirical, educational, metaphor-esq, response was warranted... but just to check:
I'm having an issue with an online gambling platform... I'm in the USA-- recently several states allow online gambling. This specific one is a huge company so extra careful about proxies etc. To play via browser\desktop you need to install 3rd party, constant, network verification software... network architecture pro with my company's network, manually written ofc, running my static IPv4 /28 from my home = f that
app version even told me i had to uninstall rustdesk (it thinks i obeyed)
the issue is nothing controllable from client side... it's the same problem regardless of device, os (android phone, tablet, and iPad... fresh factory settings, bare bones and container versions... yea I was using it to procrastinate), network type, etc, etc
so i finally take the time to take a video of the issue (would be super confusing via screenshots)... even compress it to 1.5x speed and 240px, leaving the full screen (not cropping) and metadata intact. I point out that im a dev, and even worked for online gambling platforms...
i quickly mention all the noob troubleshooting bs, that i literally know every bit of data that moves on my network... that this issue is identical on both an iPad and android phones (so totally different apps\OSes)... the "live support" already tried(my req) totally deleting then reissuing the problematic promos... 'deleted' one persisted...etc
I clearly lay out all this info, even suggesting they forward it to someone in tech... give them the specific model numbers and OS builds of the primary devices(ipad and android phone)
...
I get back, an equally long, form response... summary:
we r soooo sorry you're having trouble
we care sooooo much about your\customer experience!
the tech team says (heavily implying it got escalated\forwarded) if you try these things itll fix it:
*imagine every generic troubleshooting guide from the early 2000s, plus a few notes like "(smartphone)"*
...and i shit you not, it even gave instructions to restart devices, power-cycle my modem\router and clear my browser cache. (all clearly nonsensical to anyone who read my initial email with a vague knowledge of English and/or tech)
Despite only having 1 valid hand to type with, i type nearly 70wpm (on my prefd keyboards)... so I lectured them, explaining their disrespectful bs clearly... and including a dumbed down metaphor relating a friendly request for a specific salsa recipe using\not using specific available ingredients... and replied to with a children's description of what a tomato is.
Explicitly gave a second chance to actually read the initial issue\email and forward or respond appropriately.
I was way more polite than my depiction seems...too polite.
soooo... i sent an additional email response...
i changed the subject so it'd still align with their ticket system but also identified the rep, with heavily implied disdain.
the contents of the additional response:
Dear 'Mary',
It seems that I forgot to include a very important resource for you.
I apologise. Please follow this link and complete all steps\levels. I want you to have a great online experience!
https://bestdosgames.com/games/...
Best Regards,
Sara Range
things like the "Best Regards," are artifacts of their formatting.
so... im not sure if i was too much of a dick, not enough, or if it even matters because it may go over their head.
opinions pl0x?6 -
This is not dev related but oh man after 2.5 years i heard back from them that they apologize and so i apologize them back for being rude. So here goes the story:
It was my first time visiting my father in law's aunt by myself for some specific reason that i forgot (perhaps maybe about fixing her son's motorcycle, but im not sure). Short story, when the job's done i was invited to dinner and they came out about all of their food is organic, i asked why. And they answer they didn't like chemical processed food, then i instantly said somethings like : "well do you put Natrium(Sodium in english) Hydrogen Carbonate in my cake?" And they looked a bit irritated and said "of course not, i wouldn't.why would i poisoned you" And i replied "hahaha i was messing with yall, but yeah i think you put NaHCO3 hahaha" And i instantly got kicked out. And i haven't heard them back until now. And they figured it out it was Baking Powder. It's not directly to me tho, they sent their apologize thru my mom. But still. I haven't laugh a lot for a while 🤣4 -
I realize that my story made no sense so Im back to square one.
The story was suppose the playerz an option on how they want the outcome to be but I wanted it to show the horror of a straight storyline. Rip -
Why recruiters are sometimes taking so long to answer? I did my final stage of interview with the companie's client (out of 4 stages in total) last Thursday.
Client came back with positive feedback at Monday at the end of workday. Today is Tuesday and internal recruiter was supposed to call me to make an offer and discuss starting date.
Now again workday is nearly over and no contact from her. Tomorrow is a national holiday so she will get back to me at best on Thursday.
Goddamnit why it takes so long, if Im starting next Monday I need to prepare myself. Im seriously getting second thoughts such as even about declining the offer if they will try to lowball me. Previous week they really rushed the process and I had to do 4 stages of interviews and this week they are wasting my time. Am I being impatient or what?2 -
UWP suck, I don't wanna hurt yall feeling but it's time to face the truths:
+ SandBox
+ Less Job Offer
+ Development more Complicated than Web App
+ Microsoft not create perfect hardware to make sure our app get to more consumers (the Pro X is failure)
+ Poor Optimized
Poor Optimized ?
the Windows 10 optimization is joke, all my surface laptop, pro, book I have tested. They claim that consume less Ram, but when using it along side electron and Win32 app. It feel so much choppy and lag. I mean WTF ?
UWP was made for optimize low specs SoC such as ARM base, now my laptop running on a core I5 + GPU still lag ??
I'm sorry but this is just sad. Im moving back to win32. WinRT sooner or later will end supported
And Microsoft will improve the Win32 Api6 -
How do y'all approach media-endpoints?
Specially publicly accessible user-uploaded media
Rn I encrypt the path to the media-
/file and expose it, decrypt on the server (returning a relative file-path) which then fetches the file via File.Read and returns it as-is
I put a cache header and works fine
But something in the back of my mind makes me feel it isnt right
Like, normal endpoints and file-read endpoints shouldnt be in the same backend, potentially affecting each other
But since it's just a fun pet project so Im not paying for a 2nd baremetal server as a CDN/media server -.-
Worst case scenario I use it as-is, but would appreciate hearing other approaches9 -
I have been on a rollercoaster journey this year, long short quit my job, lounged around in emotionally recovery mode for a few months, went back to uni to study and recently i went and did some good ol networking and the results were pretty successful and ahhh life is moving to fast and im startin to feel invested in uni, but also money and greed is consuming me guuhhh doing both doesnt feel like a option haha1
-
I was doing android apps for a year and a half, but then during the pandemic my hobby gaming projects blew up and I had to quit my fulltime job and focus on them. Spent last year working for myself. I managed to save enough money and got a mortgage for my apartment. Now I feel accomplished what I wanted and Im tired of working alone on my own projects. Its sad doing all these mental gymnastics and not having anyone else to share the results with.
I'm considering getting back into part/full-time position. Main reason is the social aspect, as well as stability. I'm tired of stress, too much responsibility. I want a better work/life balance. Also I think I need a position where they would allow at least 2 days a week working from home.
How to recondition myself and first of all to motivate myself to get back into the rat race? I haven't done android app development in a year and a half, I'm rusty af. I'm a junior at best right now. Also in the past year I got fat and I'm too conscious about my beer belly lol. Thinking of loosing weight and sharpening my app dev skills first, only then applying.
Can anybody advice anything?1 -
So I’m learning JavaScript but with every project I’m delayed because I have to make the page for the project and it irks me because I hate front end. DONT ASK WHY IM LEARNING FRONT END SHIT ALRIGHT? Anyhoo uh yeah no this shit is holding me back because I want to do web dev for web applications but developing the front end is such a fucking hassle. Like creating divs for the apps to look how I want while being basic as shit and I know JS is for front end and I get that and it’s fun to play with but I just wanna get to the programming you know? I’m not a designer I’m just trying to get better at programming and have fun. And also fuck those times I changed something and it literally should have changed but IT FUCKING DIDNT!2
-
Im always trying to learn new things. Im passionate about learning new things, especially development. So much i started a small collaboration group of developers and slack group to collaborate new projects/ideas,get to know new people, and just to learn new things from each other. The group is not language specific developers only, but mostly consists of PHP/Laravel developers at the moment, so im always trying to grow that network as much as possible, so if you would like to join my network to collaborate new ideas or to just even talk to some cool cats, ill send you an invite any day. Anyways, back to my original reason for this post. Im mid level developer who considers himself pretty knowledgeable in PHP and Laravel. Im curious to what other developers use to learn new things. Im constantly questioning my skillset and compare myself to senior developers who always blow me away with their knowledge which often makes me feel like i dont know enough. Currently I use resources such as:
-laracasts.com
-serversforhackers.com
-digital ocean articles or any textbook that wont cost me an arm and a leg lol
I mean i just want to learn about tech related stuff always but currently interested in learning specifically about development topics such as:
- Server administration because i would consider this my weakest skill set (things like provisioning,nginx/security, deployment)
- Continous Integration (as ive never been at a job that practices it)
- RESTful APIs(as ive never developed one)
and so much more but i wont waste your time with my never ending list. What resources/tools do you guys use for your learning?6 -
So I got the new macbook pro 15 with touchbar .... this is my first macbook that I have ‚issues‘ with.
* the new butterfly keaboard doesnt feel as good as the old one
* ... abd its friggin loud!
* the keyboard backlight just randomly drops out and forces me to cold reboot WTF??
* they bigger left/right cursor buttons make it so hard to feel where you are, that I constantly confuse up and down
* the touchbar is basically unusable for a keyboard centric person like me. It forces me too look down to the keys!
* I constantly hit the esc bc im used to have one finger there to hit it if needed, but now im forced to hover it bc otherwise it is pressed
* and why of fucking why did apple remove magsafe??? Now i dont even see anymore if is is being charged without turning the screen on
* i hate the usb ports too, why not even add a free usbc to usba port? (Well, i guess bc it would make the macbook even more expensive... free wouldnt be free anyway i guess)
It is way more powerful though, but the time i would buy a personal one is over and will probably never come back.
Im a happy hackintosh user btw 😅3 -
after moving back to my home country, buying an apartment and after my career started to head to nowhere because there is nothing to code for me in work, just manager stuff, I am returning to coding after work to get back into shape, practice more, learn new stuff (and the old stuff)
wanted to create a small webapp with laravel/vue, holy fucking shit how hard it is (for me) to setup your env
install composer -> command php not found
o.O im pretty sure i had php on this machine HOW THE FUCK WOULD I HAVE ALL THESE PROJECTS HERE THEN
install php8.1 -> no such package
-.-
upgraded to ubuntu 22.04, install php8.1, composer
create new laravel project -> 3 errors, missing laravel/pint, phpunit
* visible confusion * i told you to create a project, if you need it, why didn't you... oh, wait
composer install -> same
well, * looks left, looks right * --ignore-platform-reqs
but still getting the chills from a new project, now I go sleep and tomorrow I start my journey to get back to business, wish me luck -
While fucking my hot blonde gf this morning the Fucking DUREX condom BROKE and i creampied her. Here are the reasons why its not my fault:
1--Im not retarded
- 4 years of fcking my hot blonde gf with no protection and nothing ever happened cos im !retarded. Its a bigger risk to fuck with condom than without, how is this fucking normal???
2--I use condom the right way
- i was holding the tip so air comes out, just like it was explained on the box, but while rolling it down i was still holding the tip to make sure the air doesnt come back up
3--She was wet
- she wasnt dry. My hot blonde gfs pussy was so wet from how horny she was so its impossible that it got torn due to dryness
4--First verification
- it wasnt torn or ripped. It was normal. Everything looked absolutely fine
5--Second verification
- when i put it inside my hot blonde gf and fk her i pull it out in the first 10 seconds just to make sure it isnt torn--it was good and nothing was ripped so i slowly put it back inside
6--Condom is not thin
- i took the regular durex one (fuck this fucking dead fraud company I'll piss and shit on their grave) so it wasnt the thin bullshit one
7--Dont got a big black dick
- its normal. Average. Not small nor big. So latex elasticity isn't my problem
8--50-50%
- every FUcking time when i fked my hot blonde gf with a condom i always stressed if it'll break or not. This is not the first time it broke. FUCK the product that is THIS MUCH unreliable, unsafe and fragile! I'll fuck the whole durex company up. Im not the only one who had this problem. DUREX IS THE BIGGEST OVERRATED SCAM COMPANY SPENDING BILLIONS ON MARKETING FOR A LOW QUALITY SHIT PRODUCT THAT DOESNT EVEN WORK
9--Package didnt expire
- i bought a new box in the store on 8th march for womens day (modern women value having gifted with condoms more than flowers). It wasnt bought in a shit china quality shop. I fked her in the car at night and also creampied her but the condom did NOT break. Then i fked her this morning in bed with condom from the SAME BOX, and now it DID break. Are you Fucking kidding me???
10--Emergency contraception
- i died from high adrenaline of running so fast to the store to buy her contraception. Had to run to 4 fucking stores cause all of them don't work before 7:30am. Finally found one in the 4th store and she drank Escapelle within 20 minutes of incident, as soon as it was physically possible
11--And now what
- now what. What do i do. I did everything i could. Nothing is my fault. My hot blonde gf wanted me to creampied her it was her idea so shes at fault partially. She will get tested in 15 days while this contraception lasts. Dont know what else to try. This bullshit never happened before21 -
Ok. I GIVE UP! ...for at least a couple hours...
I'm not a big believer in... well anything suitable to the literal definition of believe. But there's only so much 'wtf? How is this even possible?' and any answer u can come up with is nearly statistically impossible...
I am a neuro-atypical (and just extremely atypical even if i somehkw was neurotypical) being, based on logic, finely calculated statistical probability and the most raw data and as unbiased as realistically possible, algorithms and interpretation (usually recursive pattern recognition with several highly detailed historical sources.
...but at some point statistical improbability and a collation of separate, yet relatively closely occuring events/circumstances makes logic, itself a primary suspect of corruption.
What was the breaking point that caused me to (temporarily) give up and tell logic to f off for a bit cuz maybe the illogical and mythical is the real logic, leaving me in a losing battle with 'the' fates?
Trying to get all my sourcing/purchase orders in/paid for/on the literal boats b4 end of the workday/week in china...
1st, had to drop a supplier cuz they have limited reps. When the one ive had 7+ years left, i got the aloof blonde girl societal trope of a rep... who for the 2nd time (despite the several very blunt complaints above her, incl me) she sent out a promotional update to the entire client list (ie, inherently competitors) as CC not BCC... over 200 business email accounts with tailored info of their sourcing.
2- totally diff company/ industry a former rep i was glad be rid of apparently just sfarted back for "awhile" as i needrf to restock/scale...apparently she forgot everything we discussed at length... lke if you want a chance on my business im not gonna be wasting time looking through your gui "mini store to then inquire about everything individually insead of a simple spreadsheet(which i print and put in a 3-ring binder rotating current catalogues in the same format i require everywhere)
3.dog was an ahole, my packed schedule got delayed and morphed.. a bunch of little bs thatd normally have no extra thought impact, hyperfocused forgetting one of my alarms til i realised my idiopathic fever was back and i didnt take/apply meds (pain/muscle relaxers mainly so despite this odd free time and needing to shower. I gotta sit on my rear, leg elevated/non-productive far 40min b4 i can shower (as functional legs and lack of syncope is almost a req to shower)
4. A new-ish rep of a company/factory i like/respect enough to not mention in relation... he makes invoice 1.. slight error thst was easily resolved...#2 was flawless... he goes to officially generate the contract(alibaba... verrrry simple with lots of extra explanation buttons). Price and all items match, its near workweek end so i was waiting for it so i could quickly pay/have it on the boat b4 it left and few fdav days are behind...
I put in card info, get to the 2 cbeck boxes (imo should be only 1 but whatever) asking if billing address is same ss delivery(its always default yes)... then i see a few lines in chinese (i can read enough for business negotiations... typical words/sentences innately look different than things like individual letters/address and postal indicators.) After a few loops of double checking, mentally trying to dismiss my i Intial judgement cuz it'd be too ridiculous... even resorted to google .... nope... initial wtf was spot on... recipient name/address was indeed the company(multi factory producer)i was purchasing a wholesale, via sea freight, bulk of products from.
Im pretty sure the system would've flagged it as an invalid contract within an hr... but seriously... ive been handling alibaba (and other) international sourcing since before high school(mainly small businesses i made sites/little tools for that found anything with a light up screen intimidating) and a purchase then shipment to the originating company/factory actually entered into a contract(the form is sooo simple)... im faced with ridiculously improbable obstacles actually existing and changing in such nonsensical statistically improbable ways so often that 1. I wouldn't trust a dr (or most humans) that didnt 1st assume i was crazy of some form...unfortunately im not, despite hkw much simpler and probable itd be 2. Id be super suspicious/converned if statistic norms were my norm for over a day.
But seriously wtf???
Someone give me some wisps of a frame of ref here... where's a typical 'fuck this, im out!' Breaking point?1 -
I starting developing my skills to a pro level from 1 year and half from now. My skillset is focused on Backend Development + Data Science(Specially Deep Learning), some sort of Machine Learning Engineer. I fill my github with personal projects the last 5 months, and im currently working on a very exciting project that involves all of my skills, its about Developing and deploy a Deep Learning Model for Image Deblurring.
I started to look for work two months to now. I applied to dozens of jobs at startups, no response. I changed my strategy a bit, focusing on early stage startups that dont have infinite money for pay all that senior devs, nothing, not even that startups wish to have me in their teams. I even applied to 2 or 3 and claim to do the job for little payment, arguing im not going for money but experience, nothing. I never got a reply back, not an interview, the few that reach back(like 3, from 3 or 4 dozen of startups), was just for say their are not interested on me.
This is frustrating, what i do on my days is just push forward my personal projects without rest. I will be broke in a few months from now if i dont get a job, im still young, i have 21 years, but i dont have economic support from parents anymore(they are already broke). Truly dont know what to do. Currently my brother is helping me with the money, but he will broke in few months as i say.
The worst of all this case is that i feel capable of get things done, i have skills and i trust in myself. This is not about me having doubts about my skills, but about startups that dont care, they are not interested in me, and the other worst thing is that my profile is in high demand, at least on startups, they always seek for backend devs with Machine Learning knowledge. Im nothing for them, i only want to land that first job, but seems to be impossible.
For add to this situation, im from south america, Venezuela, and im only able to get a remote job, because in my country basically has no Tech Industry, just Agencies everywhere underpaying devs, that as extent, dont care about my profile too!!! this is ridiculous, not even that almost dead Agencies that contract devs for very little payment in my country are interested in me! As extra, my economic situation dont allows me to reallocate, i simple cant afford that. planning to do it, but after land some job for a few months. Anyways coronavirus seems to finally set remote work as the default, maybe this is not a huge factor right now.
I try to find job as freelancer, i check the freelancer sites(Freelancer, Guru and so on) every week more or less, but at least from what i see, there is no Backend-Only gigs for Python Devs, They always ask for Fullstack developers, and Machine Learning gigs i dont even mention them.
Maybe im missing something obvious, but feel incredible that someone that has skills is not capable of land even a freelancer job. Maybe im blind, or maybe im asking too much(I feel the latter is not the case). Or maybe im overestimating my self? i think around that time to time, but is not possible, i have knowledge of Rest/GraphQL APIs Development using frameworks like Flask or DJango(But i like Flask more than DJango, i feel awesome with its microframework approach). Familiarized with containerization and Docker. I can mention knowledge about SQL and DBs(PostgreSQL), ORMs(SQLAlchemy), Open Auth, CI/CD, Unit Testing, Git, Soft DevOps Skills, Design Patterns like MVC or MTV, Serverless Environments, Deep Learning Solutions, end to end: Data Gathering, Preprocessing, Data Analysis, Model Architecture Design, Training and Finetunning. Im familiarized with SotA techniques widely used now days, GANs, Transformers, Residual Networks, U-Nets, Sequence Data, Image Data or high Dimensional Data, Data Augmentation, Regularization, Dropout, All kind of loss functions and Non Linear functions. My toolset is based around Python, with Tensorflow as the main framework, supported by other libraries like pandas, numpy and other Data Science oriented utils.
I know lot of stuff, is not that enough for get a Junior Level underpaid job? truly dont get it, what is required for get a job? not even enough for get an interview?
I have some dev friends and everyone seems to be able to land jobs, why im not landing even an interview?
I will keep pushing my Dev career, is that or starve to death. But i will love to read your suggestions! how i can approach this?
i will leave here my relevant social presence:
https://linkedin.com/in/...
https://github.com/ElPapi42
Thanks in advance!9 -
So I was trying to diag this lady tower bc she claims she had a virus that I had told her was only adware. But annnnyyways I told her go ahead bring it in ill look at it. So I plug in my vga cord and no connection I used 2 diff monitors two different cords annnnnnnddd tried to plug it into the TV. There was no connection. Even opened it up everything looked fine. I told her for some reason Im not getting connection so come get it. Long story short she called me back to tell me not only does her computer works and but the virus are gone lol Waste of my time :(
-
Most of my previous experience is in Java but my current area of focus is iOS apps for healthcare. Patient casenote management system and an electronic form solution for paramedics in ambulances. Im currently using both Java and Swift for my dissertation, an iOS app with a Java backend using Dropwizard for REST. iOS can be good but Im eager to get away from Objective-C. I wouldnt mind going back to java full time or even maybe C# since they are basically the same thing.
-
installed linux mint along side with win10.
alocated 25gb space on my ssd for mint (as i would only install couple of browsers, git, python tools and atom)
26hours of happiness. yess im finally back to Linux 💒
Today: Turns on pc, unable to read or write root fs.
turns out lint used 11gb for boot fs and 12gb for swap! and now I'm locked out of my dev environment (wrote so many codes which is in boot fs)
F. M. L9 -
What do you guys consider as toxic work environment in dev world?
I havent had a toxic one by now (or i cant recognize how toxic environment looks like)
But i feel like i sharpened my dick so good that no one would be able to spread toxicity onto me. Im like a bee 🐝 sting me once first and you'll get stung twice as much harder. No one would be able to fuck with me especially women
Dont give a shit if ur a dev manager hr boss or God. Disrespect me first and watch me do karma back to you immediately15 -
Im writing a thesis for my degree. Does anyone know how to make word automatically update this literature so that the changes reflect in text?
For example the problem im facing is what if i want to insert a new literature between [1] and [2]? Now the new literature becomes [2] and the existing one shifts to [3]. But in the text, the number [2] remains the same, instead of being updated to [3].
Another problem is: what if i delete the whole paragraph that contained references to literature [3] [4] for example? When I do that I'd expect those [3] and [4] points to be deleted in the literature table as well and everything shifts back for 2 spots, but this doesnt happen, it remains in the table while the references no longer exists anywhere in the word document
I have to update manually everywhere and its getting really difficult...
Please help11 -
I feel like i have changed after years of working as a dev.
Granted i have only worked at one place. But still, back in university i swear i could just code all night. Finishing a project to submit by the end of week out of joy. There wasnt even money as a reward, only a good grade which matters very little.
Now i can barely get up in the morning. Man, growing up sucks. Or maybe im at the wrong place. Idk. Too tired to even think of it.1 -
So...im having a lot of issues with people messing with my emotions because of how sensitive I am.
I lost a lot of confidence in myself a while back and grew sensitive. I don't know what to do and I don't understand why people have to be so mean :(
A girl today was laughing at me cause I couldn't figure out something in class and I feel useless.
Two guys have already messed with my emotions and led me on.
A lot of people don't hang out with me like before and no one wants to hang out with me. Another girl said I was clingy and annoying and I don't understand what I'm doing wrong. I just want to be loved :((13 -
I love linux because i dont have to forced to do frickin update like windows did.
Because i have an experience after update linux mint i cant even start the main GUI program. After boot only show blank console. It seem linux update broke the compatibility between my graphics card.
At least now i dont have to update because thats an option. The output of update is not different than windows.there is a chance you broke your OS.
But the struggle is when i need to install new app in linux. Sometimes need more than hour to find out why it doesnt work from the first time.
Any help here?
So this start from the office. In the office i usually use low spec laptop that work slowly. Then i found this IDE called rapidclipse. Its very promising with GUI builder and can build cross platform mobile app using only java built on top vaadin framework.
When i use it on low spec laptop hackintosh at office it work well although it take more time than other kind of eclipse and i dont need to install any kind of app again, just download-install-create new project-run on tomcat-work well.
Then i go to home to try this new tool , IMO my low spec PC still have more power to run something than old hackintosh. Because usually i use android studio with no problem. In the old hackintosh it went too long to build gradle only.
Then i install rapidclipse, then run desktop shortcut. Then it said i need to install correct java to use correct JavaFX.
After search on SO they said i must install jdk from oracle.
Ok so i got openjdk in my linux.wtf what is the different idk but dont have time to find out.
I install jdk from oracle.
Than finally can open the rapidclipse.
Wow , this gonna be fun.
Then create new project. Just a new project.
So im waiting. I see the progress at 10%. But still no increment on that.
I switch to other app for several minutes.
Then when switched back th app still at 10% and now is at no responding state. So i force close.
After that open rapidclipse again.
The previous new project can be opened. Yay, i think.
But so many error there. Omg.
So i create new project again.
But, but, i just repeated the first error then close again then try it again for several time. But still same output.
After an hour, i give up.
But still, why , just why it work like this. No error or whatsoever.
Back later i have a problem like this on different app.
Idkwhy.1 -
So we work in sprints of two weeks, we are two people in our team, in the beginning, we get assigned work and we continue to work on it the rest of the week, but sometimes my manager adds last minute tasks or makes it so whatever i was currently working on is not important anymore after i have already cut a long shot through it
But anyways i understand thats how work is, but what seems to happen now as well is that i finish all the work assigned to me early so i can work on any bug fixes that may arise from such features or old bugs, so then for example he gives task 1,2,3,4 to me and task 5,6,7,8 to my colleague which is ahead of me in rank but not my leader per se, she has more experience as she worked in another company for 7 months before and i never worked before , but then i finish my work by the middle of second week and he ends up adding some of her tasks to me and forces me to finish them fast as he thinks they are no big deal (hes also a non technical manager) so i am always racing to finish whatever he throws at me last minute and ending up getting the blame if i dont finish those last minute tasks, also if i take vacation and come back instead of giving me tasks to do he just gives me bugs of recent features that was done by my colleague while im on vacation
And when i confronted him about it that at any point in time whenever i check how much work is left for me and my colleague, she has less work than me, he said “i will skip all this because you got this wrong” and then continued to just ask me to do more things on the weekend day
Ofc so i tried to make sure i dont finish my work before time so he doesnt do that
But instead he ends up blaming me and saying i should have finished2 -
💡 Have an idea to develop a system
*browse what language to use
*browse what template to use
*meh, I should write my own template cause I'm too smart
*F it, I realized im dumb, back to browse template
*browse why x better than y
*browse which company use x
*browse which hosting to use
*find admin template
*browse cat fighting with subtitle
This rabbit hole. And the project hasn't started yet for weeks and months. -
Need advice about switching to contracting.
TL;DR;
So I had 2 years of exp as an android dev, then I had a 1.5 year gap from doing android and now for the past 6 months Ive been doing android again fulltime. Im thinking of switching to contracting due to my debts and boring project and life crushing slow corporate processes in my current fulltime job, so I need tips and advices as to where should I start looking for new contracting gigs and in general what should I pay attention to. If it helps, I am based in EU, but am open to any EU/US gigs.
Now the full story:
Initially when I joined my current fulltime job after a break I had zero confidence, lowered my and employers expectations, joined as a junior but quickly picked up the latest standards and crushed it. Im doing better than half devs in my scrum team right now and would consider myself to be a mid level right now.
Asked for a 50% bump, manager kinda okayed it but the HQ overseas is taking a very long time to give me the actual bump. I have been waiting for 10 weeks already (lots of people in the decision chain were on and off vacations due to summer, also I guess manager sent this request to HQ too late, go figure). Anyways its becoming unnaceptable and I feel like its time for a change.
Now since I have mortgage and bills to pay, even with the bump that I requested that would leave me with like maximum 700-800 bucks a month after all expenses. I have debts of around 20k and paying them back at this rate would take 3 years at least and sounds like a not viable plan at all.
Also it does not help that the project Im working on is full of legacy and Im not learning anything new here. Corporate life seems to be very slow, lots of red tape kills creativity and so on. I remember in startups I was cooking features left and right each sprint, in here deploying a simple popup feature sometimes takes weeks due to incompetence in the chain. I miss the times where I worked in startups, did my job learned nre skills and after 6 months could jump on another exciting gig. Im not growing here anymore.
So because my ADD brain seems to be suited much better for working in startups, and also I need to make more money quick and I dont see a future in current company, I am thinking of going back to contracting. All I need right now is to build a few side apps, get them reviewed by seniors and fill my knowledge gaps. Then I plan of starting interviewing as a mid level or even a senior for that matter, since I worked with actual seniors and to be honest I dont think getting up to their level would be rocket science.
Only difference between mid and senior devs that I see atleast in my current company is that seniors are taking on responsibility more often, and they also take care of our tools, such as CD/CI, pipeline scripts, linters and etc. Usually seniors are the ones who do the research/investigations and then come up with actual tasks/stories for mids/juniors. Also seniors introduce new dependencies and update our stack, solve some performance issues and address bottlenecks and technical debt. I dont think its rocket science, also Ive been the sole dev responsible for apps in the past and always did decent work. Turns out all I needed was to test myself in an environment full of other devs, thats it. My only bottleneck was the imposter syndrome because I was a self taught dev who worked most of my career alone.
Anyways I posted here asking for some tips and advices on how to begin my search for new contract opportunities. I am living in EU, can you give me some decent sites where I could just start applying? Also I would appreciate any other tips opinions and feedback. Thanks!3 -
Having a dilemma... I need help with my gaming projects. I know a guy who I could train since he has lots of potential but Im having trust issues. Its because I invested around 10k into my codebase and Im afraid to give access to that guy since I suspect that he might use files and some day run away to make his own project. So im back to square 1 again which is loosing my mind with this huge workload. What should I do? Should I just say fuck it ant make him sign some air tight NDA agreement? Even then he could stand up and leave 2 months in and open a competitor project if he doesnt like my management style...3
-
rush job to get my year end review in before vacation
get feedback i need to write more and elaborate
haven't had that happen to me before, almost feel like im back in school
i struggle to remember anything to begin wtih2 -
Im trying to do onboarding to work for this client.
The job app doesnt say accounting or accountant on it.
They congratulate me and pleasantries and eventually say i have to accept nearly 4k check for “training materials”.
So i accept the check, they then say i have to buy installation and equipment including 2 safes (??) and other accounting training.
I say i did not sign up to be an accountant and i want other jobs instead.
They say i should wire the money back to their wire accounts.
So i do. Im offered two other jobs from this client and another check for even more in the mail.
They say i need to cash this check to begin training for these jobs.
I ask for a list if training materials and procedures for these jobs, and they still say cash the check even after i verify to them that i do not need / already have these materials.
Please give me insights on this because im extremely confused and frustrated with these people and i want my paycheck.2 -
uhh im pretty sure everyone here has seen my html and css skills. ill be back until i don't make trash out of thin air. and yes. ill be learning react :) and maybe cutting off js soon. for typescript its for my own good!3
-
My hot blonde gf wants to buy some stupid fucking versace sunglasses that cost 310$. Shes broke as fuck and doesnt have that much money
So to make it easier for her i offered to be her bank. I will pay the whole 310$ right now with my own money and she has to pay me back in maximum 6 months that money + interest. I charge her 60$ a month and she agreed
Good feeling knowing im coming over to my hot blonde gf crib, get my dick sucked fuck her hard AND get paid for it
I've almost completed life
Only thing left is to get mega rich
Nothing personal just business
Im a fucking businessman37 -
Help wanted, im having troubles with my boot order, for school i need to keep some windows program but i want my def boot order to be linux, its both showing in uefi but wen i select parrot to be first and safe it, reboot boom windows back on top, any thoughts how to fix this????2
-
My shitting streak has begun again. Fuck. Its cold where i live and in my house. Shitting liquid shit doesnt help because my asshole burns. Its not fun and not enjoyable. Im trying to hold shit inside me but it forces me to shit. And if i shit it burns. Imagine being in a cold -75° weather while your asshole is burning heat at +45°. Why is life such a constant stream of pain and suffering. I write this as i sit on the toilet and fight demons not to shit more in order to prevent pain
Why did our designer invent shitting and thought it was a good idea?
I can think of a better idea: whatever i eat gets dissolved into particles by acid that my body produces like an implosion inside a submarine and transforms into pure energy that my body absorbs and thus makes the body more powerful -- no need to shit it out because its now a bunch of fucking particles!
WHY wouldnt that be a better solution. Shitting is disgusting and makes no sense if this solution is also possible. And for an omniscient all-powerful all-knowing celestial being -- NOTHING is impossible to do.
what we perceive as "magic" is normal to an all-powerful celestial entity. Therefore any thought you can imagine, should be possible to do. Even the idea i just proposed because i proved i could imagine it so it must be possible to create such existence
And as i finish writing off this rant, my asshole burns less and everything is coming back to normal Thank God. The pain was bearly bareable. As a finishing touch of this rant imma go wipe my ass for 100th time today and continue working with nextjs on my project3 -
Do you ever just slump back in your chair when you decide to fix or lightly edit something and then suddenly a few things break for no reason? I do that a lot, especially when I'm working with Unity2D because the project im working on is in dependency hell. (Or what I, an amateur programmer see as dependency hell)1
-
Using chatpgt as my "rubber duck" has greatly improved the time it takes me to develop solutions. Ive been working at a small startup as the full stack dev; aka the entire IT team dev so having someone to 'talk' to that talks back really helps.
but damn, the way openAI brushes off where they get their training data and having so many artist friends IRL (painters, digital artists and musicians) really makes me hate what we have AI/ML doing for us.
seeing it used for the arts makes me feel so depressed because im reminded that big corpos really just want to make money for the investors.3 -
Learning C# coming from Java...
What's the fuss about properties? As i see it, theyre only usefull for binding, as else they just work as syntetic sugar instead of getter/setter methods.
But properties are also limited to give response back, like a successfull set, unless you start throwing exceptions..
And if a set property has if(age>5){this.age=age} then if i pass the property a 4, you will never know as a user that it failed (again, unless you start throwing exceptions)
Im kinda feeling like i want to use get/set methods until i need to bind, then of course use property ?? Am i all off here?25 -
i am back after a struck of some shit virus. our team has been created and will be executeing our first mods will be consist of apk editor, xml, quickedit, possibly game guardian / block launcher scripts i know getting people to watch like and sub to your videos is hard but its worth a try.
Items-
QuickEdit + by rythum software used to corrupt data
apk editor used to dupe any app or modify it
probably used for our mod menus idk
for gg im not rooting my device so rip, i hope over clock sells his airpods so he can come back on his tablet. he litrally posted a video about why he wasnt on his tablet rip )= SPO team is not gonna bust.13 -
finally came back home after whole night of fucking my ex blonde whore and cheating on my new brunette hot gf whos in love with me. the first thing im doing rn is shitting again. i wanted to shit since yesterday but had to hold it in due to fking whole day10
-
I was asked to make release branches which will change my gitflow. Am I understanding it correctly now? Fix me if I'm wrong
So I do my fixes in develop, once Im done I squash merge them into 1 commit. Then I make a release branch from develop, if everything is fine I release it. After release I merge back release branch to master and thats it?3 -
Ok guess my last post wasnt exactly appropriate... Guess im just happy to be back home and can code my own apps again.
-
i hate it when Im coding and my friends joke around and call me a hacker or nerd when they couldn't even print anything if i told them how to do it plus its not hacking if you believe its hacking when im typing code on python or c# online then you need to go back to school6