Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "back at it"
-
*Client calles me at 7Am*
Client: why did you make everything smaller on my website ?
Me: look at the right side of your URL bar, do you see a minus sign ?
Client: yah, so ?
Me: click on it and set it back to default.
Client: oh ok this is working for me now, will this fix apply globally across the internet
Me: ...
Client: oh I think I asked a stupid question, thanks mate have a good day.
Me: you're welcome...17 -
A man was crossing a road one day when a frog called out to him and said, "If you kiss me, I'll turn into a beautiful princess." He bent over, picked up the frog, and put it in his pocket. The frog spoke up again and said, "If you kiss me and turn me back into a beautiful princess, I will tell everyone how smart and brave you are and how you are my hero" The man took the frog out of his pocket, smiled at it, and returned it to his pocket. The frog spoke up again and said, "If you kiss me and turn me back into a beautiful princess, I will be your loving companion for an entire week." The man took the frog out of his pocket, smiled at it, and returned it to his pocket. The frog then cried out, "If you kiss me and turn me back into a princess, I'll stay with you for a year and do ANYTHING you want." Again the man took the frog out, smiled at it, and put it back into his pocket. Finally, the frog asked, "What is the matter? I've told you I'm a beautiful princess, that I'll stay with you for a year and do anything you want. Why won't you kiss me?" The man said, "Look, I'm a computer programmer. I don't have time for a girlfriend, but a talking frog is cool."11
-
Boss: "it's not the same font"
Me: "yes, it is"
Boss: "don't argue with me. It's a different font"
Me: "ok it's a different font" (it's not)
Boss: "change it please"
15 minutes later and I've done nothing at all to it. Boss comes back.
Boss: "see? I knew it was a different font. This looks perfect now. Why were you lying to me before? I don't like you arguing with me"11 -
So there was an inspection from government for our bank's IT security. I gave a tour to our server and security systems. I threw all possible acronyms as much as I could remember. Inspector nodded and noted down never uttered a word.
Finally, he breaks his silence, looking at a device he points out and says "What's that ?"
I look at the device then stare at his face back again at the device and to his face I reply "That's AC, Air Conditioner".19 -
CEO hired graphics designer without HR help after first meeting and that person first day of his work borrowed money from people and that’s not end of story.
Same guy came back at night and robbed the workplace with his friends, didn’t came back to work. Company bought couple of big iMac for new graphics department back then, all gone.
When company reported incident to Police it turned out he travel and steal from companies all over the country and they’re trying to catch him for a year.11 -
Boss: Can we add a [Close] button at the top right of the modal instead for all the items, the back at the lower left seems out of place.
Me: What modal? You mean move the back button to the top right of the page?
Boss: And make it say [Close]
Me: But it navigates Back. It's not a modal so it doesn't close. [Back] makes more sense than [Close].
Boss: Ok
...
Boss: Change the [Back] on the modal to [Close].
Me: But... fine...
Buttons all now say "Close", they all have double quotes. No one has said anything.18 -
Windows 10 once again held my computer at ransom! When it finally came around after the update, all it really seem to do is place Edge back on my task bar. No... Bad Microsoft, I don't use or want Edge.6
-
TLDR; funny revenge prank from my manager
So yesterday (April 2) I decided to prank my manager about me resigning (I've been working with them for 4 years) I wrote a legit looking resignation letter. (No signature) and at the back page it has a small font "April fools".
I asked my junior to help putting it on my managers desk since I was working from home. When my manager saw it he immediately had a meeting with my technical lead. he didnt notice the april fools at the back so I sent him a short email to look at the back and he laughed.
Come today, I recieved an email from our it team with the subject "POST RESIGNATION PROCEDURES FOR JUNNERS". It has some legit looking contents as well as a hyperlInk for a resignation checklist.
It felt like im having a mini heart attack since I thought it was legit. When I opened the hyperlink I was shocked.
I love my job 😂6 -
I worked at a place where the help desk guys did the good ol' "I'll send an email from your laptop if you walk away without locking it and tell everyone lunch is on you" routine. After it happened to me about 3 times I was like, "I gotta get this help desk prick back!" So after several failed attempts at walking by his pc when he walked away it instantly hit me how I can punk him back.....SO, I logged onto SQL Server, clicked open a new query window and typed up a dbmail command and on the @from parameter I set it to the help desk guy's email address. His face was PRICELESS when I was shooting off emails to the entire IT dept on behalf of him WHILE he was sitting in front of his PC. Lesson is: don't fuck with dev help desk dude! 😎😜2
-
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
A few years back, there was a super repetitive task I needed to do to create a bunch of new screens for a new feature.
The task was so repetitive that I just couldn't bring myself to do it, and was avoiding it as long as possible.
Finally the day came where I needed to get it done. I sat at the computer readying myself to finally start/finish the task.
As I was going through the files, I could see all the work had already been done..? Confused, I opened up git history, and saw that I had checked the files in a few nights back.
Best I could do was trace it back to a house party where I was the last to go to sleep.
That was the day that I realised the power of auto-pilot :)1 -
Yesterday I won an old Mac mini at work, then I lost it on the bus back home, but got it back today. What a roller coaster of emotions 😅8
-
Waaaay too many but let's go with this one for now.
At my previous job there was a web application which was generating about 1gb of log data a second. Server was full and the 'fullstack engineers' we called had zero clue about backend stuff and couldn't fix it.
Me and another engineer worked our asses off to figure this out but eventually the logging stopped and it went back to normal.
Great, right?
For that moment. I was the on-call server engineer and at like 3am I got called awake because this shit was happening again.
Sleep drunk with my phone I ssh'd into the server, not sure about what to do at first but then suddenly: let's chattr the goddamn log file...
$ chattr +i /var/log/logfile
Bam, worked, done, back to sleep.
(this comment + param marks the file in a way that it can only be read until the mark is removed, so you can't write to it or move it or remove it or whatever)13 -
Jobless.
Nah, just kidding.
I'm a qualified teacher, so I have that to fall back on.
That or fixing things, I suppose. I would then design something to corrupt that AI and then I can get hired back when the AI starts its reign of terror.
"Oh no! The AI became sentient and started intentionally fucking code up (and then proceeding to manically laugh at it ((ha...ha...ha...)! Who can save us?"
"I have a team of highly skilled devs, programmers, and a dude who works in a cellphone shop at my disposal. devRanters assemble! (then I just fuck up the code I made initially to make them sentient and commit it - problems solved.)2 -
The magical solution to everything.
It reminds me of the time when we were watching The Great Gatsby movie in honors English class. The the projector wouldn't work.
As a joke, one kid said, "try turning it off and turning it back on."
The whole class roared with laughter, until it actually worked. They stared at it in silence.3 -
Have you ever written a piece of code so awesome, that you just had to go back, and look at it?
I have.9 -
1. Submit my resume, get an email asking to schedule an interview
2. Schedule the interview
3. One day before the scheduled time, I get an email saying that the interview is being rescheduled to another time two days later (no explanation for why they did this)
4. I clear out my schedule and wait for the interview call (it’s suppose to be at 2:30, but I wait like 15 minutes early because I don’t want to miss it)
5. I don’t get a call
6. At 3:00, I call the company and ask whats going on. They apologize and say my interviewer will call me back as soon as he gets back from lunch.
7. He doesn’t call.
8. At 4:00 I call them back. Apparently the guy who was suppose to interview me went home. I ask them wtf they are doing and if this is how they treat their employees. They said they would reschedule the interview and call me back once they did.
9. No one calls.
10. I wait a week, call them back, and am told that the funding for my position didn’t come through (what does that mean? You’re not hiring programmers to design the software for your billion dollar war machines anymore? Seriously?).
I’ve had it with this company. I don’t know if it was just this incompetent recruiting group or if this is a company full of scumbags, but I mean, really?1 -
This isn't my own creation, but I couldn't find it shared here yet.
It is a poem:
< > ! * ' ' #
^ " ` $ $ -
! * = @ $ _
% * < > ~ # 4
& [ ] . . /
| { , , SYSTEM HALTED
It reads as:
Waka waka bang splat tick tick hash,
Caret quote back-tick dollar dollar dash,
Bang splat equal at dollar under-score,
Percent splat waka waka tilde number four,
Ampersand bracket bracket dot dot slash,
Vertical-bar curly-bracket comma comma CRASH!6 -
This morning I couldn't delete any of my projects and my workspace kept refreshing. I was going mad about it. Then I looked at my keyboard and realized I was clicking F5 instead of Delete. I'm going to get a coffee. Be right back.3
-
I played a prank on my coworkers. Covered the bottom sensor of the mouse with part of a post-it note. I went home for the night.
The following morning My boss was the only one in at first and spent an hour unplugging and plugging it back in. He was just about to go out to buy another mouse when someone else came in, immediately looked at the bottom, chuckled to himself and took it off.5 -
Don't ever ever forget to push before leaving office.
I repeat : Don't ever ever forget to push!
Sends app to client.
At home and decides to check if the changes actually worked just to realize it crashes because i forgot to comment out my dummy test data.
*On a bus back to the office at midnight*5 -
>Have 64gb memeory stick with software and precious memories (back ups of childhood pictures and stuff)
>Go to girlfriend's house
>Let her borrow it because she needed it for photography (pictures in the TrueCrypt file take only about a quarter of the drive)
>Get dumped by girlfriend after a while
>Shrug and be a little sad
>Find out that i dont have a local copy of what was there
>Don't have courage to ask for it back or even speak to her
>Cry because of now gone data
>Cry because no back ups.
Moral of the story is dont fuck with your back up and also, don't give people precious data, even the ones you trust at the time.4 -
Leave work with two working monitors at my desk, come back the next day to one monitor and a missing HDMI cable. Find out marketing took it for a presentation, don't get it back for three weeks. Finally get it back for a day, become super happy to finally have both monitors again. Come back the next day and PM has stolen my HDMI again, no extra HDMI cables in entire office. Apparently HDMI cables are valued like gold around these parts.10
-
So the other day my Huawei phone got a push update, but after installing it, seemingly nothing happened.
I just took a look at my Android version.
I was rolled back from Android 8 to 7.
Let the softroot begin!16 -
Never used Linux before. At least not enough to say I've worked on it. But these discussions in here, they've pushed me. I'll do it now. I'll try Fedora. Right now! And never come back...till it's ABSOLUTELY needed.25
-
Some days back before, it was my birthday so I invited my friend who make apps and games with me and I said "lets eat raspberry pi" so he came to my house and said where is the pie. I pointed at the green board at the table. LOL2
-
This morning my girlfriend told me about the network at her school constantly disconnecting, to which I jokingly replied "So, it doesn't deserve candy". She came back with "But it's already asking for so many cookies"...
-
I always find it more productive to have at least two ongoing projects at once.
That way, if I get stuck on a bug/frustrated with the first project, I focus on the second and more often than not, when I go back to the first project I realize that I had made a dumb mistake and keep going.2 -
My Perfect Day : Assumption
Woke up at 6. Went for morning walk or do yoga or some sort of stuff.
Came back at 7. Went for daily routine, like bathing and all.
Went to prepare breakfast at 7:45. Prepared some eggs and bread and coffee.
It is 8:15 now. Reading news papers or watching tv and doing breakfast.
At 9 check mails and prepare some stuff.
At 9: 30 went for office. Reached office 5 minute before 10, safe and sound.
Came back at 7 by evening. Did some rest. Prepare dine till 9. Take a bath. Complete the dine.
At 10:30 ready to sleep.
Actual Scenario :
Woke up at 8:30. No time for yoga or morning walk. No time for preparing breakfast as well. Went straight to bathroom. Came back in 20 minutes. Made a cup of coffee. No time for newspaper or tv.
Feeling lazy and tired already. At 9:10 went for office. Before reaching office stopped at fast food joints. buy some junk food. Eat them. Got traffic jam and reached office late.
Started working but feeling lazy. Boss asked twice about the project status and i am unable to think a single line of code.
However, days passed. Boss scolded me. I promised him to finish the work after reaching home.
Reached home at 7:30. Late for no reason. Went straight to bed. Sleeps a hour. But took 20 minutes to leave bed.
Started working on projects i did not complete in the office.
Time fly and it is already 1 in morning. No dinner. Tired as fuck but hungry as well. So made some eggs and eat. Wrapped the task but it is 3:30 in morning and i jumped to bed for sleep.
Loop.3 -
Final exams are next week and I'm behind on studying...
If I uninstall devRant, I'll install it back. If I block it using clearlock, I'll find a way to bypass it.
I remember once I accidentally found a way to use devRant on multi window view. I might figure out how to do it again.
So... If you see me on devRant yell at me to get off. I'll be bitter at first, but appreciate it later :)
Oh, and feel free to be as mean as you want. The meaner you are, the less likely I'll go back on.22 -
Coding is like pizza
You love it and can't get enough, but you torture yourself indulging in it at nights, wish it didn't make you seem fat and attractive to the majority of the population, and it will never love you back -
I often times write code and think to myself "I don't have to comment this, it's obvious what is going on", only to find myself back at the same code, figuring out wtf it does...1
-
Networking class. We're learning to configure switches, or at least trying to. A full hour goes by and the thing is not making a single beep. I frustration we lean back. Then my friends sees it. We never plugged in the power cable.6
-
Sister: *walks up to me at my desk* Hey, I was wondering if you can undo what you did to the internet and put it back and make it work better in my room and also make it faster
Me: Sure
Yeah, I’ll get right on it and go hit the fucking magic button in the router settings called “enable extended range and make it go faster”.1 -
Devrant feature: It would be cool that when you wanna write a comment, it doesn't open a new page, but a textarea appears at the bottom, so I can re-read the other comments and the rant without going back.19
-
Past few weeks, I have started to work late night and sleep whole day. I go to office at around 7pm and returns back next day 8-9am. I found it super productive.
But, my manager wasn't happy about it and now, she shifted daily scrum at 1 PM and emailed me to make sure I attend it daily.
Now, I have to fix my sleeping cycle... Nights are so great to work. Silent and nobody around.
Now, from tomorrow, I got a new challenge everyday to make it to scrum daily.6 -
Fuck public transit. If I see on Google Maps that there's gonna be a bus at that place, at that time, there better be a goddamn fucking bus AT THAT PLACE, AT THAT FUCKING TIME!!! No instead let's scrap some shitty lines!
HOW ABOUT WE START SCRAPPING SERVICES JUST BECAUSE WE FEEL LIKE IT, HUH?! Back to postal mail and newspapers you go! You know what, for such fuckers let's just cut their entire internet access. Fucking pieces of shit!!!5 -
Had a company BBQ lunch today then someone turned on some dumb movie and everyone is sitting around laughing at it. I'm like how soon can I leave and get back to coding without looking rude....1
-
Dear IT,
STOP FUCKING RESETTING SERVERS AT 9PM AT NIGHT, WHEN DEV PRODUCTIVITY IS AT IT'S EPITOME!!!!
DO YOU EVEN FUXKING UNDERSTAND THAT IT TAKES 20 MINUTES TO GET ALL THE SERVICES BACK FUCKING UP? ALL THE FOCUS BUILT UP, GONE IN A FLASH BECAUSE YOU COULDN'T KEEP IT IN YOUR PANTS TILL LATER.
sincerely,
mahaDev,
mind-fucked software engineer.4 -
Once you realize your server is hacked, just disconnect the ssh and forget about it. It is known as Schrodinger defense.
The server will be both okay and fucked at the same time until someone get back into the server.1 -
You need to answer your manager, but don't have a clue, try these randomly:
I'll circle back to you
I will run the numbers on it
Let's go back to the drawing board
Let's touch base in a bit. Ping me
I don't have the bandwidth right now
It's on my radar
Let's put this on the back-burner
I have too many balls in the air right now
I have a lot on my plate
I'll get back by close of play tomorrow
I'll have to deep dive/drill down into this and get back
I have a hard stop at X hours
Let's park that for now
It's in the pipeline2 -
Back in school a class mate used a bat file to recursively create a directory an then enter it and repeat.
The directory also ended with ascii 255 which looks like a space and when placed at the end is invisible.
This was in msdos and there was no mouse or autocomplete, also no deleting of non empty directories.
The teacher finally gave up and admitted he could not solve it.
You had do make a new script first to traverse to the inner most dir, then recursively back trace removing directories.2 -
650 line hand constructed xml file missing a tag. Took me 3 hours to find. I looked at the section at least 3 times but my brain would not pick out the mistake. Online cal validators all pointing me to the wrong places.
It takes persistence to be a developer so pat yourselves on the back.5 -
> starts coding at a young age
> makes it my whole personality
> goes through a rough year of quarantine, graduates high school, changes changes changes
* no. coding for a super extended period of time*
now I'm slowly trying to get back into it consistently. miss you besties lol hope yall are doing ok I'm back and I'm better and also older. I think the last time I was consistently on here I was 17 lmao
I work at another bank now. I finished my first year of engineering at my uni. Ontario is slowly opening up. I'm doing better :)3 -
The push back phrase my manager uses when I try to discuss a requirement which I think is incorrect:
"It was discussed and agreed upon at the beginning b/n PM and engineering"
To hell with that, if 10 people arrive at a stupid decision, its still a stupid decision
I just sit back until the project progresses much further and wait for another senior dev whom they can't ignore to bring up the same issue.
It is supremely frustrating 😤2 -
I REALLY HATE TECHNICAL PHONE INTERVIEWS!!!
I was asked: "What are the differences between C++ and Java?"
I got a mind blank at that point... Good thing it didn't last long and I came back with a reply.
But seriously, if you can't speak English clearly, why? Why? WHY?!
(I lost a whole question because I couldn't understand the interviewer. ☹)
At least it went "well" and now I have to improve the "technical" document and do 2 tests by Monday!11 -
"When you’re a carpenter making a beautiful chest of drawers, you’re not going to use a piece of plywood on the back, even though it faces the wall and nobody will ever see it. You’ll know it’s there, so you’re going to use a beautiful piece of wood on the back. For you to sleep well at night, the aesthetic, the quality, has to be carried all the way through." - Steve Jobs6
-
!dev
I hate it when the inspiration finally comes... and you can't use the PC to compose. Because you're currently at school, or for whatever reason.
Now I'm scared that I will forget my ideas, before I get back home...
Damn, happens everytime.
( ◕∧◕)32 -
When you fix your mates PC and upgrade windows on it and month later he comes back because his scanner is really slow, his wife doesn't understand English anymore and cat decided to leave his cat life to become full time florist at local bakery shop.2
-
So i look at my phone checking how late it is...
I put my phone back into my pocket...
My brain is like "time = null;"1 -
Occasionally i got my badass moments at work.
But that one bachelor party in Barcelona where about 10 of my pals and I came back from a soccer match topped it all.
As we got back to our AirBnB apartment i went to the bathroom and scanned the WiFi.
I found the IP address of the bachelor's party man of honor and MITM attacked him.
So each image from any http server would automatically get swapped with a picture i took just an hour ago from the game we were at.
5 minutes later i hear the screams "OMFG WE ARE ALL ON THE NEWS GUYS!!!" and "LOOK AT SPORTS SITE X AND NEWS SITE Y!!"
The saga continued with some cheers in the beginning and some confusion, but ended when another friend rat on me..
But boy it was glorious 😂 -
*windows update gets stuck on a black screen*
MOTHERFUCKING WIND-oh wait it rolled back the update and booted fine on its own.
Hey, progress.
Gotta hand it to whoever at Microsoft implemented this, was smooth af.4 -
When the new keyboard you ordered arrives at work (it's for at home) and your team lead remarks 'that is a big dildo you got there'. I did fire back by asking him if he was jealous which led to sudden silence. Still disappointed in him, we do rib each other all the time but this feels sexist and inappropriate. I'm used to it and laugh it off but I'd still expected better of him.13
-
I know this isn’t dev related at all but...
Nor is it a question, as my fat finger set it to...
Eminem just dropped a surprise album at midnight last night. No promotion, no bullshit. Just straight hip hop.
And the album cover is a throw back to the beastie boys!
If you can’t tell already, I am super pumped about this!!!17 -
I wonder how many decades it will take until employees stop to fucking stick their passwords to the computer screen at their station. It is a complete fucking nightmare if you are responsible for the network!
Can we bring back the guillotine? But it must be stub!
Those nitwits shall suffer!19 -
1. high severity production incident was asked to look into at the end of the day.
2. needed fix in ui.
3. fixed and deployed in 1 hour.
4. issue remained. debugging began.
5. gave up at 1 AM and went to sleep.
6. woke up at 6 and after debugging for 2 hours, identified to be a back end issue.
7. worked with back end team for the fix, and 6 hours and 3 deployments later, it worked.
8. third party vendor reported they are still not receiving one parameter from us.
9. back end team realised they forgot to ask ui to send another parameter.
10. added the parameter in ui, redeployed ui.
11. build and deployment tool broke down. got it fixed. delay of 1.5 hours.
12. finally things are in place. total time 26 hours.
13. found half bottle of vodka, leftover from last weekend. *Priceless*1 -
TL:DR: I'm terminally addicted to Tea.
I have been drinking tea twice every day since 6th grade. I'm almost 30 years old now.
One day I decided to quit tea altogether. And at 6 PM that same day, I started to lose color from my eyes. The whole world turned black and white.
At about 7:30 PM, severe depression kicked in and I started questioning why the hell I wanna keep on living and not end it all.
At that point I ran to the kitchen and made tea and drank it. 2 mins after that I started to see colors again and the depression went away.
It's kind of funny now that I look back at it.19 -
Bought a new Chinese phone a few months back but the battery is already bad as fuck (my fourth Chinese phone, first bad battery). Define bad, every minute of devRanting was 1 percent of battery gone.
It was empty after like two hours of usage :(.
So just went back to my old phone (6000 mAh) and after two hours I am at 86 percent!
Man, this relieve 😀23 -
5 months ago I've decided to back to the programming after 8 years of Civil Engineer careere. Today I'm working at amazing tech startup (BaaS) and every day is an awesome experience, I think that it was one of the best decisions in my life.4
-
That moment when you take a look back at your old portfolio websites...
I have to cringe and laugh at the same time rn. The way I styled it. OMG...
Self note: You will still cringe in the future, when you are going to look back at your current portfolio website.5 -
"Rant/Story"
Dayum.
Prestory and afterstory:
Today I have slept for around <2 hours and had to drive to my college.
The real shit happens right now.
Story:
During these almost 2 hours, I have dreamed about going back in time, but being limited on the same day's hours.
In other words... It was e.g. 16 o'clock and the time travelled back into the past. Like into a "0830 ish" morning. The day would then come to an end and start with the next day. For example from Monday to Tuesday.
I was able to look into the future whenever I wanted to.
Even though I was driving my car in the first gear, it would drive into the reverse direction.
Time suddently switches direction and everything is going as it should be. Greeting people in the streets as I would do normally.
And all of the sudden time decides to switch its direction again and I have to do things in reverse.
At some point I found something like a hidden room which had a door. I opened it and went into the "room" (it was a special place. It had no walls at all). It had a door at the other side of the room. I went through it and saw another one in the last room. It felt like, if I decide to go through that door, I would instantly die. I therefore moved all the doors back into the dream world.
Such a confusion gave me a fucking headache lol.
After waking up from such a fucking complicated dream, time irl felt fucking weird lmao.
My alarm began to do its job. It tried to wake me up at 6:30 am, at 6:45 am and at 6:50 am.
But all the time along it felt like it began to wake me up at 6:50 am down to 6:30 am.6 -
Heights of laziness.
My dad's laptop having "WINDOWS OS" got full of viruses and my dad wanted me to repair it since I visited my home.
But I insisted him to get it repaired at some IT shop. Went to an IT shop, my dad introduced the shopkeeper that I am his son and is a software engineer. That moment, I really felt bad that even I could have done formatting and installing applications back.
Now, let's hope it comes back full healthy and clean.19 -
Normal human: Visits web store -> orders for product -> leaves store.
Me: Visits web store -> Stares at header -> Stares at logo -> Check if colors match -> Scroll to footer -> Frowns at ads -> Scroll back up -> Multi click product item for debounce -> Fuck i clicked twice but it added the product thrice -> Closes tab -> Drives to local store -> Purchase product -> leaves store.8 -
Not a rant, but still relevant:
GET YOURSELF A PROPER ERGONOMIC CHAIR!
I'm pushing 30, but have been coding/messing with computers since i was a barely a teenager.
I code at work and i code at home, and while i consider myself decently fit and observe decent routine regarding standing up regularly at work, my lower back is still all kinds of fucked. (Facet Joint Disease - look it up if you are bored)
This is SUPER common in our field and i figure most of you here are working more and more from home, from you couch probably. This is killing your back, and let me tell you, coding is freaking difficult when you feel like the thousand knives of the management layer is in your back literally instead of metaphorically.
You will be sitting in the same damn chair/set of chairs for the majority of rest of your life, make sure its good, preferably before your back is screwed.5 -
When your internal timezone automatically changes over the weekend and you have to get it back to "normal" but then somehow end up not sleeping at all 😅😐😑😪2
-
Started off a developer 6 months back. I seem to have lost control of my life. I wake up at 8, be at work at 9am, get back home by 7 or 8pm, dinner, learn, work on my platform, sleep at 12am or 1am and the cycle continues.
I have no time for taking care of myself, no working out, no grooming, no family time, no time with friends, nothing naada! It scares me that I don't have that balance.
I always feel like I'm not good enough and I'm curious by nature, because of these, I sit my ass down and work / learn like crazy because I want to be good but I fear for my health, I'm 22, so I can live for now like this but this lifestyle will ruin my future, I've started getting back problems and shit, that was the wake up call!
How do you guys do it? work - life balance? I believe this information is vital for everyone starting out as a developer.5 -
Looking at the version history of Git (which is obviously tracked by Git), it goes all the way back to the initial commit...for some reason this blows my mind.2
-
My internet went out the other day and I genuinely didn't know what to do with myself! Pacing around my apartment until it came back 2 hours later.
I think I need to get out more or at least get some friends but, you know... people.4 -
One of my employees just gave me a panchito(basically a fried tortilla chip with cheese, avocado and meat) and went away. He legit bought it from the cafeteria, walked all the way to the office to give me one, and left to eat it back at the cafeteria 🤣🤣🤣 bless him.
-
"I don't care if it's world class in the back end! It has to look pretty. The back end can be hanging by a thread for all I care, front end is what the customer buys!", The Almighty Project Manager
Yeah...thanks...that's why loading a table is taking 3 minutes and 'v2' in an entire Refactoring of the back end. When deadline comes, read quote above to get a glimpse at the future.3 -
Leaving work with no bugs in the code! Everything works flawlessly!
Coming back the next day and all of a sudden nothing works and we need to spend the whole day getting it to work as well as it did yesterday.
There seems to be programming gnomes, ruining our code at nights!3 -
Sitting down all day doesn't do my back much good, so thought I'd look for an electric back massager. And there's plenty around - great! So I do the normal thing I do and take a look at the reviews...
...but the reviews are completely unhelpful, because about 5% are the usual complaining it turned up late, 5% are maybe talking about using it as a back massager, and the remaining 90% seem to be using it as a vibrator. Some are even just bloody ambiguous. I'm still not sure if "takes a bit of work to get it in the right spot, but it's very effective when it's there" is referring to someone with a sore back, or someone who's sexually frustrated. Who knows, maybe both.
First world problems eh.14 -
After two weeks with Ubuntu - I'm done with this. I'm going back to Windows.
Why? Well, it fixes some Windows problems, but at the same time new ones are popping and they are even bloody worse.10 -
They say if you throw good stuff out at the universe, it will throw good stuff back. But all it ever throws for me is a NullPointerException.2
-
!rant
>dreams something good
>enjoying it
>feeling it
>mom wakes me up
>dream stops
>yells at mom
>gets shouted back
>thinks of dream again
>was soo good
>see tag5 -
One of the coolest projects I've worked on recently was this little adventure game I made for a game jam a while back, It was made from scratch with Golang and C over two days. It also features procedural level generation (that technically should allow the user to walk in one direction for at least 7 decades).7
-
Customer complains that the deployed desktop app is slow at site x.
I check it out with users at site x, and indeed, it does have a delay when trying to connect to a share on a server.
Checks with users at site y and z, no issues.
After a bit of digging, the resolve of a DNS record is most likely the culprit.
Send the ticket to the customer network team to investigate.
Get it back after an hour.
"We have pinged the DNS name, and it responds fine, there must be a bug in the application".
Oh and also, I wrote this rant at work, in my head, with a lot more cursewords involed.3 -
Oh my God I'm a failure. Been working on this booking system backend for two weeks, refactored some code, and now it doesn't work at all.
I've gone back through the entire thing, and I can't find the problem.
Open up indeed, start browsing for low-skill jobs. Maybe the carnies will have me back!
*Re-reads error message, adds missing underscore to function call.1 -
There are users that copy shortcut from their desktop somewhere to make a backup. We laugh at them. I just copied symlink to my flash drive and realized it only when I copied it back to different computer and target didn't existed.1
-
The piece of software I'm working on at my job just feels fucking stupid and brainless right now. I know it is not, I know it's working, I know it'll be actually useful to its users but I don't feel like that.
I usually go by telling myself "Most of the time I do like what I do, but sometimes it's just work that has to be done" - but for the last month or so it felt like my motivation is completly drained and not coming back fast enough. Just thinking about it feels like desperate, tired crawling on Legos.
On the other hand, at least I've got some motivation for my studies back which feels great. -
At first, I was skeptical and somewhat resilient of trying Arch Linux. As a former Debian based distros user, I have to say : once you go Arch you don't go back! Time to 🍚 it up a bit more!6
-
When you have the amazing refactoring idea you've been waiting for... but it will be hours before your back at a computer.1
-
So I just finished a little web design project that I created a while back.
Its a simple clock widget that highlights different words to create a sentence that describes the time.
I originally made it a few months ago, but never got around to finishing it up.
You can check it out at timeclock.ml
Just a little project that I though I would share!1 -
When you get called back into work at 5:30 in the morning for an urgent problem... Come to find out its because, "I forgot my internet access password, can you reset it...?" Are you shitting me? Fucking (L)user! In taking today off, fuck this.
-
Ctrl C, go over hear, Ctrl V. This might take a while, I'll go drop a deuce will this is copying over.
[ 3 hours later... ]
Alright, back at it. What's this dialog?
"The destination already has a file named...".
1% complete.
Well, fuck me in the goat ass. -
lately my IT mantra in the vein of "have you tried turning it off and back on again" has become "did you check the logs for error output"😡
NOTE to all developers of any level: if you want help do your due diligence! Check the logs, try to step debug and at the very least please at least pretend to perform a cursory search3 -
Who at Microsoft thought that this is a good idea?
I wish I did not update, last update I did was a year ago and I was happy with it, now Windows feels like chaos ... Half the things are Dark themed and the other half is not. Lets see what the future holds
Also that Windows.old thing takes up 20GB that even if installation fails, it never succeeds in rolling back ... At least I was never able to rollback ...15 -
My biggest fear about publishing open source code is people looking at it and having the same reaction a have when I get back at my old code.2
-
Got back to programming. After a failed period as tech lead at another company. It feels good to be a dev again.5
-
Is it so much to ask for ability to do my job remotely. I work on a fucking computer, I can do this shit at home. I don't need to drive 50 miles there and back to do my job.
Flexibility is a thing.5 -
My productivity reduces by almost half after lunch and reduces to 10% the day I leave headphones at home. It is only after tea break in the afternoon that slowly I start getting back on track again3
-
I am both happy and sad looking at the code I wrote some time back. It makes me realize how much I have learned and at the same time how stupid I was.1
-
Yesterday, I was looking back at a project that isn't a focus right now, and unintentionally realised the cause of a frustrating bug. It's a one line fix and the smallest PR I've ever done, and it was such a good feeling!2
-
So, I'm 100% sure that in a year I'll look back at today and ask why I thought it was a good idea to implement a feature this way.
Looks good to me today, that's all I know. I'm done ✅ -
I don't want to work on the project at my job anymore. It's an over engineered piece of shit.
I work on my pet project at home, but only for about 20 minutes at a time. After that, I feel the need to walk away and waste my time with other non-productive activities.
How do I get my love for development back? Has the corporate world killed it?5 -
I work with J2EE every day, especially Spring and Spring Boot.
I like it very much but when I am home I love tinkering with C++ (even tough I am a beginner in this language).
Is anyone else like this? It's like C++ has a misterious charm for me, not sure why. I also enjoy haskell and erlang, but keep at getting back at C++.7 -
Starting a new project:
1.Think of a new/exciting idea
2.Start imagining and planning in my head
3.Start working on my idea
4.Give up mid-way
5. Get depressed
6. Get back at it way behind schedule and still not complete it
7. Go back to step 1 except that's basically how I start something new and not just a project :)4 -
// example.json
{ "hasCustomerAgreedToTermsAndConditions": no }
Slightly irritated by my IDEs warning, I squinted back at my code. It took me a second too long to spot my mistake. First, I was baffeld at my own incompetence. Then I grew defensive about it. "Why not?!" I thought. "Less typing, so efficient, so much time saved, so wow!"
I realized at that moment, that it was probably best to call it a day and go to bed.
And so I did.3 -
Don't you just hate it when you search for a solution to your problem and always end up back at your unanswered SO post?3
-
How tf is Canva valued at >40 billion. Boggles my mind. Never heard anyone even using it!!!!
Is it a state sponsored hacking and surveillance project company with a pink tutu on the front and Cthulhu tentacles in the back?21 -
Sorry, I have to say this. I get patriotic at times.
Asian Cup 2019, we Vietnam had made it to Quarter Finals after defeating Jordani in the penalty shots.
I'm happy. It's stressful watching the shots. It's stressful watching the match but I'm happy. We're happy.
And now back to homework.2 -
I know people have mixed feelings about Uncle Bob and I really never followed the guy at all, but back in college I found his book Clean Code on a shelf and read it cover to cover. A lot of it really stuck with me. In fact, I might dig it up again now that I'm thinking about it.3
-
My boss decides on new languages/frameworks almost each new project...
These are the number of different languages/frameworks we are at...
Back end:
5
Frontend:
4
Sometimes it looks like he is trying to even out by 10 :)2 -
Person: "Can you speed up my computer? Don't delete anything though."
Me: "Your hard drive is at 99%... you need to get rid of some stuff."
Person: "Can't you do it with out deleting anything?"
Me: "We can move it to a cloud service..."
Person :"No, that won't work. How will get my stuff back?"
Me: "Nvm..."2 -
I'm watching a basketball game (NBA) and they had an issue with one of the clocks at the arena.
They of course fixed it by turning it off and turning it back on.12 -
One of the executives at my work insisted we rush to get a project done back in January so that he could use it immediately for auditing purposes.
Just pulled a report and found out he hasn't used a single thing we built for him not even ONCE since we pushed it. He hasn't even logged in. So livid.2 -
Hmm... That's 2 yrs from now.. o.O
Mmm...ok... Keep the job, rewrite old crap (I mean code) I'm maintaining & rock at it..
Personal issues wise, get married get own flat/house & hopefully get back to climbing at least on weekly basis.. Ooh & maybe a doggo & kitteh.. xD
P.S. maybe find a phone that will outsurvive me.. or at least survive me for more than 3 months.. :/6 -
I got travel advertisments on my Windows 10 lock screen. I didn't remember how to get rid of them, so I had to search for it again. I was lead to this piece of fine irony on my screen.
Staring at it felt like staring at the concept of art while it's staring back. This experience left me emotional.
Thank you Microsoft and Windows Central. Thank you art, life, and love. Thank you ads.5 -
Selenium++
Woke up at 6am today and couldn't go back to sleep...
So I my Watcher app to support Selenium and provide it to all the extensions (plugins) via the common Interface.
Now I don't need to check the Anime site manually when they release movies or blurays...
And have 1 hr to eat breakfast and get some coffee as I have a release at 9... And now I'm sleepy... -
!Rant
Looking at various Devs & non-devs like myself, ranting, posting meme's [my bad];
I realised why we keep coming back. Nope not because of the notifications, but because devRant feels like home dare I say it, it feels like family.
Thank you @dfox @trogus & the other creators who aren't that famous [my bad I don't remember your names].
Thank you.5 -
This happened at the beginning of my first job:
Me: I want to clarify some things that wasn't specified in my task. I want to see if I need to do them and how I should solve it.
Senior dev: Don't worry about it. If testers pass the task back to you, then you do it. Just do as it is.
Me: 😓2 -
had an interview at a place that went good at the technical part but I didn't do great at their 'abstract' questions. the guys interviewing were complete stone faced as well, no personality, pretty sure I wouldn't have liked working there anyways. a few years later and they are still looking for people. the recruiter rings up and I said I wouldn't want to re-interview unless the process had changed. he guaranteed me it had. so I went back in and it was exactly the same. exactly the same technical questions, followed by more abstract questions. different guys but same no-personalities. never going back
-
!rant
Selected at a better college
@ceee @Floydian @RememberMe
Remember what I told you more than a year back on that Skype call?
I fucking did it13 -
TFW you hear noise from the kitchen at 2AM, you go to check it out and it is your brother opening a can of SPAM, getting the content out of the can, chopping an onion (crying while doing so) and then just holding back laughter all the way back to our room.
😂😂😂😂😂😂😂😂😂😂😂😂😂😂😂😂😂😂3 -
I took a computer apart despite my mom and dad telling me no and that I'd electrocute myself. After I took it apart cleaned it up and put it back together, it was at this point I knew I had the control over these things.3
-
Quantum computing is at least trying to be the next "ML".
People seemed to ignore it over decades but suddenly a few months back, everyone got excited on Google's headline progress.
Later, people realized it is not a big deal and everyone moved on.5 -
I guess it would have been the school choice back then. Teachers were almost all really bad, going though a powerpoint at mad speed instead of making sure we got it, and the other students were elitists: you don't know how to code / use this framework? Why haven't you commit suicide yet?
This school was a big part of how I lost all confidence in myself, and how hard to build it back. And the major actor of my depression. Yay. -
Yesterday night!
Yeah it was Saturday night but not for me. I was at bus stop and my jiofi device was in back pocket and after some time I was coming back to my room and thinking let's switch on wifi. After that my mobile was not connected to jiofi so I thought may be jiofi out of charged. Later on when I was checking in my pocket I realize that I missed it on bus stop!
Actually this jiofi device is my first salary's garbage:D
That's why I was little bit worried.
So I went back to stop and saw nothing was there. Disappointed but wait, suddenly devRant notification came and mobile vibrated so I checked and I seen that my mobile connected to jiofi and then I checked carefully, it was there!
Actually jiofi was placed in opposite face so that light was not visible but I got my jiofi back.
Thank you devRant notification:D2 -
This hurricane fucking sucks. My power was out nearly all day today. It went out at 6ish this morning, and didn't come back on until 4-5ish in the afternoon.
I was coding on my laptop, trying to reproduce the sampling procedures we talked about in AP stats (hoping that I'd better understand the material if I could connect it to stuff I was doing in another class), and there was a piece of syntax I had forgotten over the summer, and it irritated the hell out of me that I couldn't just Google the answer.
Eventually I just drove to a Starbucks and hung out there for about an hour or two till the power came back on. I was terrified the power would just go out again before I got back home.3 -
I always love getting yelled at by a client about a feature that they “use everyday” and critical to their business is just not working. Go back and look... it appears that it broke a while ago (in this case a couple months).
It’s my fault, but I do start to question other blanket statements they make. -
Apparently we're playing musical chairs at work... I work from home for one day and now my chair is missing. If you borrow a chair put it back where you found it. It's common courtesy.1
-
One of the things I like are - website redesigns. To look back at one's old work and think, I can't believe I thought it was a good idea to release such. Shows progress.
-
Sometimes I look at my old code and I wish I could go back in time and punch my self in the face for writing that shit
But then I look at it as I'm actually improving so guess it's ok?
Spent 4 hours fixing callback mess I had in my ReactJs project, making it all as Promise and async hope I don't fuck up this time -
Can I just say, I hate migraines. There is nothing worse than trying to focus with a worm gnawing at ones eyeball. Ended up leaving work at 13:00, wishing I could teleport home. I take that back; driving for an hour with a migraine is worse. Almost 19:00 and it is finally gone.3
-
No brain. Half 11 at night is not a good time to learn a new programming language. Please be quiet so I can get some sleep and go back to working on really boring things tomorrow without being grumpy about it
-
When I got X up and running at 1am for the first time on my first computer, 486 SX 25MHz with 8 MB or ram.
The program SuperProbe is probably depicted now, but it got me up and running back then. -
Continued rant of : https://devrant.com/rants/1152021
Ok, I am using this program again, this time with 43 programs (i guess), and it saves me at least 30 minutes.
Some were interested how I made it, well, another person (who is not in devrant) helped me (and he is not from stackoverflow) make it.
You can see how it works (the frontend) by looking at the image below.
I am afraid that I can't release the source now, and maybe not soon because of personal reasons.
Back to the point, I found a massive bug there, you can see "Finding uninstaller" in the middle of the two, and I can't fix it, so I shall just leave it alone.
It is Saturday now or Sunday I guess, take a good rest, and get back to work in Monday! (or school for students) -
Was working on an algorithm a few months back. I was not liking how long it was taking to process some data. A colleague of mine said: "Just throw out the data that is past a certain distance. You don't need it." At first I was shocked. Throw out data... Seemed so wrong at the time. He was correct, and it made sense. What was I saving it for? Posterity?1
-
i can't be the only one who had some stressful situations in his career that made him suicidal. looking back, i find it cringey that i used to care about small things at work including politics3
-
Trying to sleep knowing you have at least 5 bugs to try to fix when you wake up so you go to devrant to complain about it just to go back to thinking about the bugs and not sleeping.1
-
Spent years ranting about being a contractor and freelancing. Finally got a job at a big company. Now I'm hating it and missing my old flexible work life. Hello dev rant, I'm back!4
-
"I might need to come back to this page later" always leads to about 50 tabs being open and me just opening the site in a new tab because that's just quicker than finding it.
I need to get better at managing this2 -
our company just lost one stream of revenue that was responsible for 40+% of the companies income. I'm hopeful they can get it back, but I think I should start looking at job listings...1
-
Sometimes I've looked back at some code I've recently written and thought, this makes no since... Instead of rewriting it, I just leave it confident in my brain at the time...
-
Today my senior colleague asked me to write an inline style and make it !important and I started at him for 2 minutes before smashing the keyboard on his head and then I realised that it was just playing in my head so I stopped staring at him and went back to webstorm and wrote that !important inline.3
-
Just got my Linux dev environment set up, even got an alias working that would launch all the software I needed to test my code. Then today decided to change primary drives. At least I know how to set it back up next time, right?2
-
When ryzen released I bought a 1700x a little while after with 3600 cl15 memory.
Back then it only ran at 3.6ghz cpu and 2800 mhz cl16 memory.
Now im on 3.75 ghz and 3333mhz cl14.
I honestly didnt expect this to happen1 -
Send back my PC for RMA two weeks ago (likely dead CPU, but I just didn't know anymore)...
They send me a mail confirming that they have received it and a mail that they would start on it (along with some terms)...
Two weeks of waiting, no news at all...
Mailed back: "Oh sorry, we forgot to add the line asking whether you agreed with our terms..."
Two weeks of not being able to properly sit at my desk, play games, work on code reasonably (with my 3 screens) and edit videos I still need to finish because they forgot a stupid line in their mail --'2 -
!Rant
To Coders suffering from back pain, try this.
Worked for me so i'm sharing it. The demonstration starts at 3:25.
https://youtube.com/watch/...1 -
Back in the day, our computer at home was very slow and sometimes hangs. My siblings have always seen me kicking it out of frustration. Thank goodness for these fast computers these days. I think I am not that violent anymore.
-
Not working, not looking at the phone, not listening to music, just sitting there and doing nothing until you get bored enough to get back to it.
-
So what do you call it when you get bombarded by emails saying your servers are at 100% CPU, but once you fire up the monitoring tools everything is back to normal?
FUCK YOU AMAZON IT'S MY DAY OFF.3 -
Ask to get DB back ups done, contact DB team => cant log in => have 2 contact wintel team => they believe a reboot will sort it => contact customer => permission to bounce given => contact team to bounce => shifted back onto DB team => bd team open lync conversation about bouncing => no reply to mails if all is well in the world => sit at desk cant start dev cuz know will be sucked into aroganizing this brewery piss up with a bunch of bums....... cue putting on headphones and blasting some music at 11 ,,,,,,,,,,,, been waiting to deploy for 4 hours !!! FML2
-
I went to my friend's party on Friday and I got back like at 3 am and code till 5 then I got a bug on a php script to upload pictures to the server. wake up at 10 am fixed the bug with a hangover of cheap alcohol and went to sleep the rest of the day.
Am I killing it or what?😂3 -
When replying to posts, it'd be useful if we could reply in a textbox underneath the rant or comment rather than a modal window (at least on a desktop browser.)
Sometimes I want to refer back or double check something as I'm replying to it, and the current modal dialog makes it a tad annoying to do that at present.2 -
Decided to get rid of a system app but forgot to disable stupid System Integrity Protection (OS X stuff) first so it flipped back at me with a thousand of "Permission denied" errors.
Whispers behind me (it was in the public):
— What is he doing?
— I don't know. I think recompiling the kernel... -
Worst experience with a manager was with this project manager at my first job.
One day the other developers and I were staying back a little late to try to make some progress. The manager offered to go out to get food for us. It must have been two hours later when we realized he was not back. We were ready to go home and starting to get hungry. We called him and he said he got caught up but was on his way back and would be there soon. It was more than an hour later when he arrived with the food. I quit that job shortly after. -
@tahnik so I surfed on over to devrantron's repo, and I had to say that I found that "gave up on hot reloading" commit hilarious, because I was looking at how to get it to work a few months back and was like "FUCK that shit"--it really spoke to me XD2
-
wwoooo..
back from the dead with linux :)
like i said my internet wasn't working last time. trying to fix it i uninstalled something essential and obviously at this point im banging my head lol managed to get files back and wiped for reinstall. the wireless is back though!!2 -
At the airport with the missus going back home, making time in the duty free. One of the people working on it asked a very dry "what are you looking for?" with no salutation whatsoever. I was this👉👈close to answer "a new job!"
-
This is how non devs imagine our devs. They tend to think a huge change is this quick. Meanwhile back at the ranch it will take a while and a lot more concentration.
-
*Writes CloudFormation Template.*
*Launches Stack*
Starts Murmuring,
"The cycle repeated
As explosions broke in the sky
All that I needed
Was the one (JSON Invalid Format :| ) thing I couldn't find
And you (Teammates) were there at the turn
Waiting to let me know
We're building it up
To break it back down
We're building it up
To burn it down
We can't wait
To burn it to the ground
Me: "FML :| "1 -
When I'm working through back end stuff ....
I'm at the point where I need a physical button on my desktop where I hit and it just fires off the API and I look at a monitor and there ya go, the output.
Grabbing my mouse and etc each time I iterate not sense.3 -
>closes laptop to let it cool down at 5:10PM
>5 minutes later, boots back up on its own and doesn't go back to sleep
>opening and logging back in
"We have an important update for you planned for 5:30PM"
OH NO YOU DON'T, you fucker!
Shit like this makes me wanna call Windows the McDonald's of operating systems.3 -
"Keep Ithaka always in your mind.
Arriving there is what you’re destined for.
But don’t hurry the journey at all.
Better if it lasts for years"
https://poetryfoundation.org/poems/...
For the sake of clarity, I just hope I'll never "make it" in what I do. I just hope to keep going on learning, experimenting and discoverying.
Whenever I'll get tired I'll look back at my past and then I'll decide if I made it.1 -
Back when I was a total noob at programming probably 6-7year back. I once fucking try to memorize even-odd number program for the practical test because I was unable to understand anything related programming.
It was like - read 20times the include statement and try to remember what was in between < >.
I totally feel embarrassed now after looking back, that silly me didn't even try programming properly.1 -
Can we all please try to keep emotion out of coding? It never ever helps to get upset at a code review.
Please please please accept constructive criticism, and dish it back to me! You can hate my code just don't hate me. :/2 -
My manager keeps pretending to punch me in the groin when I walk past. This happens at least once on every shift. I have asked him to stop doing it more than once, as it makes me jump back and I suffer from a back injury, so it can be quite painful. He laughs about it when he does it, and I am sure he does it in jest, but he refuses to stop doing it. He simply laughs and says he would never actually hit me there, but it’s automatic to jump back out the way.
My friend who is a store manager in another store informs me that because of where he aims, it can be deemed as sexual harassment. Is this the case and what is the way forward?4 -
Man .. sitting for hours ,staring at computer screen is damn tyring.
I'm having concerns about my health already ,I wonder how people in the industry manage it.
And yeah ,my back aches so bad😭😭13 -
Is it normal to get proposals like "look at x.com , we need exact replica with exact features. Build front end, back end and make it live."6
-
Looking back at my post and comment history, and damn, it feels like someone hacked my account and wrote random posts and comments. I disagree with half of the stuff I wrote 2 years ago.1
-
So another infamous code (or smart code) you decide, there's class 'error' in the template/html and here this genius is removing it and adding it back? is this even logical at any level,
I mean just hide() and show() would do the job6 -
The coffee at my work sucks! :(
Recently, the coffee machine was broken and a better one was installed until the other one got fixed. It made decent coffee, but now we're back to drinking piss. Teasing!2 -
I have until Friday to write a service that's going to consume our backend api.
I'm doing it with Python, the back end is in Node. It's going to be the first pyhon service in our company, so everybody is looking at it to see if we could/should do more Python!
Under pressure! -
Good to be back at work.
But kind of annoying when you check the server and it turns out that the 3rd Party API fell over and the guy responsible for it is still in holidays.. -
Back in the day my dad had this Fortran book he was studying at the time. I had just learned reading but and remember looking at the funny book and wondering why I can't understand anything. Still have that book as a fond reminder =D
My dad noticed me trying to read it and got me this funny BASIC for kids. At the same time we got our first computer. At that you couldn't buy games. Usually the books had the source that you had to type in and compile.
So this funny BASIC book with funny pictures had the source for moonlander... And man was I hooked. Next came the "monkeys throwing bananas" =D
Back in the day everyone was also on the dark side. Prompt was always white on black ;)1 -
Client (who hosts our programs on their website) sends an email there is an issue! Resolve is asap. - I drop a brick if my boss finds out about this he will kick off.
I look into it the best I can but there is no testing environment for their website so do the best I can on our environment. Every thing seems to be doing exactly what it should and can't reproduce. So I email client I can't reproduce and everything looks fine are you sure it's not at your end?
They email back I got someone at our end to look at it and he's sure it's your end. So I spend a rather long time looking into this and still find nothing so email back for more information and a video of them reproducing the issue.
They email back: umm sorry seems it was our side that was causing the issue, only noticed it when making the video.
*sigh* more time wasted thanks clients! -
Going back to a project from a few months ago, a fellow dev has committed 'test this' comments with my name...
Hitting up git blame shows my tests were written 2 weeks before! If you're gonna be passive aggressive, at least do it right :/ -
My dad took me to a conference in town about microsoft XNA back when it was new. I was too young at the time to understand most of the content discussed, but I was blown away by the idea that with a bit of practise, I could make my own games too and much, much more. It was at that moment that I knew... the developer life was calling for me 😊1
-
It gets fucking old, yet it always keeps coming back like Christmas.
If I had a fucking euro each time a CTO asks me why they need CORS and TLS to use webrtc (even on LAN??!1! 🤯), I'd be fucking rich.
At least this time the time I wasted explaining it again was paid for at a much higher rate...7 -
There was this guy at university who pronounced 'branch' like 'brunch'. It was so hilarious that my friends and I had to hold our laughter back.1
-
So last year in school, we did a project where we had to program a movie collection. So obviously we wrote "cat" a lot, for category.
So late one day, we just named a few variables "dogs" for the hell, then we'd change it back later... We forgot.
Realized it later when we had handed it in, and were defending it at the verbal exam 😂 -
> client has no infrastructure of the project
> dev like me still work on it
> I constantly request for mock-ups and infrastructure
> client never responds back, instead he raises issues ahead of sprint
> I snap back at him
> Client wants call now
> What the fuck
To be honest, I'm gonna take a stand here...fuck this shit man, no clear way of working2 -
@devs with sizeable student loans:
How are you finding paying back your loans? Is it super tight? Not at all? How long are you/have you taken to repay?
I know this will be different for everybody but I’m interested in seeing a variety of answers!11 -
Back when I was my first year of computer science me and a fellow classmate went to the IT store to buy a hard drive. We walked past an iMac and my friend (who was top of our class at the time) looked at it and said: "That is a nice screen! But where is the computer". Laughed my ass off, and we are supposed to be cs undergrads...1
-
being middleware... had to split up back end work in two parts which wasn't necessary but for 1 day it is split up and at the end 3 days delayed because of split up... controlling temper was the biggest challenge of that part.
-
I decided I'm going to repartition my laptop so that I'm able to dual boot Arch/Windows.
I really dislike Windows and got rid of it permanently because it kept deleting my (back at the time) Fedora partitions every couple of weeks.
Now I just really miss playing some of my old favorite games that I cant get working on Arch3 -
Training in NodeJS for 3 years so my first contracts ask me to do Reactjs, fire me and then got hired only return to WordPress and Drupal which I havent touched since 2016.
Guess I'm back at PHP and working crazy hours fixing legacy code.
This time I think I'll master it because I lost my job last year, got sick, move back with my parents and have bills to pay.
I'm still sick but I'll keep pushing... -
What I can't stand is when someone "name drops" a company they previously worked at. Such as, "...back when I worked at <insert Xxxsoft>" or "At <so and so place> we did things differently..."
We get it, your résumé is impressive. But it especially peeves me when they've been working at their current job for over a year and still mentions their old jobs.
1. I also worked at <XXXX-place> and it wasn't all that impressive.
2. If it was SO great, why aren't YOU still working there?2 -
First day at Jetpack Compose: Wow, how cool!
One week of Jetpack Compose: This preview never works right!
One month of Jetpack Compose: Damn! There's no mature component to this shit!
Two months of Jetpack Compose: There's no going back and start using embedded applications as intent.
Don't get into it.4 -
Don't you just hate it when someone borrows things from you and they don't even have the common decency to give it back the way it was borrowed.
Like come on! You borrowed my charger and gave it back to me without its head. Then when I asked you to find it you got mad. Is your fucking head straight? You even had the guts to shout at me. Stop playing like you're the victim and get real.2 -
So my peers are making a hybrid android app and I'm managing the back end, at the start of the project I told them to publish it to the play store to test if it will pass any rules ( I assume there are automatic inspection or whatever) we are near the launching fase and we don't even have a dev account there yet...
-
Legend says there is an Atom installation where the "Open empty editor at start" option actually works.
I don't know why but it never worked for me. First the editor always opened a specific file I hadn't edited for days, now it always restores the previous session and opens TWO fucking tabs with the welcome page.
Back to Vim.7 -
When depression is hovering your back, it sucks when a potentially project breaking API update from a third party appears with shiny new features and your team glamour that we should implement it soon, but internally you scream that will break so much stuff and clients will be mad at you
-
.Net Dev here with a degree in graphic design. Almost 9 months into my first dev job, 85% of it has been dealing with god damn webforms. Unfortunately, sometimes it doesn't play too nice with a bootstrap / jQuery especially with code behind and when you have post backs. I never thought I would say this but fuck the front end lol at least when it come to this dumpster fire. At least I'm learning a lot but damn I can't wait to get back into an MVC project or service work.1
-
Slowly adapting Go to some microservices projects I have. Shit is intuitive as fuck and I believe it has to do with what lil knowledge I had of working with C back in uni and by myself. For the web Go fits quite nicely. Really loving my time working with this language.
Now, if i could somehow throw it into the mix at work and build something with it it would be quite fun.1 -
The more I look back on it, the more I really see that this job has really thrown me to the wolves time and time again, only to laugh as I come back beaten and bruised.
They’ve given me objectives that were deceptively broad, no guidance, and then misguidance when I came back with a well researched opinion. They wanted me to estimate large projects without having worked on a large project. Plus, college leaves out the huge part of software work: deployment. I had to figure all that out on my own too.
The more I look back on it the more I see this place has been a complete shit show from the beginning. It was just the first job I didn’t have to do manual labor at so I valued it highly.
It’s time to move on to somewhere I’m not the constant scapegoat. -
I’ve lost my groove. I don’t know how to get it back. I haven’t done any developing just for the fuck of it in months. At least not since I lost my job. I can feel my brain turning to mush. Anyone have any zen shit to kick me back into the zone? Is that even a fair ask?4
-
I've realised that I should probably get another desk at home if I want my productivity back. It's small, rickety AF and my wife keeps putting crap on it. Any other tips for keeping productivity up @ home?7
-
Back in the day I was a website administrator. At one point it involved cropping images in Photoshop for 6 months then doing data entry to new website. Man that sucked.
Encouraged me to learn to program then became a web developer at the same company. -
I've been running Linux on my laptop natively for five months (since the 2nd week I got here). My boss and everyone on my team is okay with this. I've used Linux at the last three companies I've been at since 2012.
All I asked for was a Windows VM so I could use WebEx (which I did at my last job; used Win10 in Virtual box just to share my screen via x11vnc and reset my password occasionally). At my last job, they said Linux users were on their own, but they at least gave us a Windows ISO, license and ability to connect it to the domain. It was a west coast company, with 500 people in IT and several Linux users. The IT team at my current shop has known I've been running Linux for months.
Now the word has come down that I can't have Linux on my laptop and I need to put macos back on it (it's actually on there; just dual booting) for security or some shit. We have a massive deadline and project due in like two months and it would throw me off for several days if I needed to bring in and setup a personal laptop.
Fuck asking our worthless IT department for anything. I told the lead engineer I'd bring in my personal laptop before going back to Mac.2 -
- Hey, could you help me understanding your method? I'm trying here to implement it on my side but it doesn't work
- I'm not at home right now and don't remember the code i wrote. I will look at it when i get back home
- Ye but can you explain it briefly?
- I JUST FUCKIN TOLD YOU I DONT REMEMBER IT EXACTLY, I AM NOT AT HOME AND I DON'T FUCKIN HAVE THE COMPUTER WITH ME. WHAT HE FUCK WAS SO DIFFICULT TO UNDERSTAND?2 -
Some days I hate my work - other days I love it. Usually what happens is I make some poor decision that I have to live with and get super angry with myself, feel my colleagues are disappointed, go home, feel sad, sleep, go back, talk to them about it and try to learn from my mistakes - and then I'm back at loving work. Repeat. Software development is so much more than writing code.
-
Stupid Windows Update back at it again with the Fall Creator's Update. More like Fail Creator's Update. My poor laptop took it too hard and the built-in mobile hotspot feature is currently bugged and not working, with the ICS service in task manager stuck at 100% you usage. Restore to previous version or not to restore to previous version? That my friends is the question. *picks up Ubuntu 17.10 live disk*2
-
So I bought a new phone, I was super excited getting it, I even got to open it at work with my colleagues watching. It was really nice, the S8 is an attractive phone... Until it started crashing very very regularly. I want to go back to my old phone, that's how bad it is. Turns out this is a common experience, how can this be at the top of all the review lists if it has this problem? Is the assumption that you are going to install stock android as soon as you get it? Or is someone paying for reviews?4
-
We've only met once and it was love at first sight. But now we're apart because some forces are conspiring against us x(
Give me back my storm trooper mug ! -
So if you ignore Android Studio's update messages and be rude by disabling that notification, it will get back at you and stop giving you any suggestions 👌👀
-
Tried to propose using Clojure on a project at work. Manager comes back with, "That seems nice, but why isn't it mainstream?"2
-
Thinking of developing a mod for a game I play, but only thinking about it so far. No coding yet. Probably no coding until I'm back at work on the 26th.1
-
I just can't sit at a computer anymore without opening my terminal anymore. Is it wrong I kinda want to go back to when that's all we had?2
-
Hi guys, I'm hoping you can help. I've looked everywhere and I've not got a clue what it is.
I lost my back door key (5-pin pin and tumbler lock) the other day, and I can't afford to get a new one right now.
I tried picking it earlier, and I discovered it's got a spring at the back of the plug (which I've never come across). I lined up all the pins but for some reason it's not opening, and I have a feeling it's either got an anti-pick pin or it's to do with that spring.
Has anyone with lock experience got a clue what could be doing this? I'm at a loss.5 -
Any suggestions to work on coding (php/sql atm) during downtime while at work? I've been learning css and js (front/back) for a year while unemployed. Just got IT call centre job in highly monitored corporate environment. Have potential side programming job but need more practice.4
-
When client from previous project comes back after a year for changes claiming it was never finished, asks to work with someone else who isn't as busy... wait for it...
... and gets pissed at both of you when the new person sends an estimate to do work on something closed for 12 months. -
Dealing with big projects can be troublesome at times. You take your mind off once and then it takes a lot of time to get back into it.
-
Back in school projects, I used to take way too much tasks in a user story because I knew that at one point, if it was someone else working on it I would end up fixing it anyway. Now I have trust issue -_-2
-
One day i do some code at home and i commit it ... Back to my office i realise its not my last version of my branch ... Fml ... Git push1
-
[on any forum hosting the very question that keeps you awake at night] I'll come back to explain how it was solved!
-
Devrant keeps crashing on iOS and I’m getting really sick of it. It’s been at least 6 months like this.
Edit: Also on iOS, the “X” button on top left overlaps with the “back” button to go back to the previous app (i.e. search)7 -
Semesters about to end. The group project is coming to a close and I'll no longer be a TA since internship next semester. I'll finally have time to go back to my projects
Let's see how disgusting my code is after not looking at it at all for months
Let's see how little the comments help me remember what i was doing in each project5 -
Office gadget?
My coworker gave me 30€ for an account we share. I didn’t expected that and he doesn’t want it back. Now I tough I buy something useful or at least funny we can use in our room.
Do you guys have any gadget u really like?4 -
Hello, people at devrant, i have this problem. When i apply to jobs, most of the employers dont answer, then for the few employers that do answer, when i reply back, there is no response, even when i ask them about it. I was wondering who here has a similar experience or know y they do this or how to fix it.13
-
Went out to run some errands after being stuck searching for a bug. Came right back to my machine and looked directly at it.
-
Way back in university, I was trying to do an assignment for an OOP class and it had to be written in C++. I was writing a simple function since I was a beginner at it and I couldn't understand why my program wasn't working. I spent an entire practical class lesson trying to work out what the hell was wrong and in the end, I got my friend to look at it. After only 2 minutes of looking, he asked if I had declared my functions. Obviously I had not.
-
That feeling at the end of the day when the real world gets in the way of coding and you have to stop. Now I now it will take me all morning Monday to get back in the loop
-
Working in IT all day at work (not coding), yet I am excited to come back home to code and learn new stuff I don't do at work... Difficult to resist, too much cool stuff out there every day!!!3
-
I bought the new dell xps15 57 days ago and now it’s ducked (pun intended).
Last week the screen stopped working. I powered off and back on. Then I get a cpu failure light sequence.
I call dell. To my surprise they have given me next day support for free. The guy comes the next day.
He says he will come between 4-6pm. at 615pm he phones me and says he will be late. I hang out at work to wait for him.
Finally at 730pm he comes and doesn’t have a screwdriver for the laptop. So he leaves to go buy one. 8pm he comes back. It takes him an hour to replace the motherboard by which time I just want to check it works and then go home. It seems good and we both leave the dark office at 930pm.
The next day I notice the sound isn’t working. He also hasn’t closed the laptop properly and there is a dent on the right hand side.
Despite dell giving me next day support it takes a week for them to come back with a solution.
I now have to send it off to them and I’ll be a week without the laptop...
It was incredible when it was working. But laptops aren’t great when they don’t work!
Perhaps I should have got a Mac...4 -
I started using qutebrowser at the begining of this year and I havent looked back . Especially all this userscripts the help me skip youtube ads and a nicely done shortcut driven UI, would highly recommend it.1
-
I'm starting to feel pain in my little finger from using Control and Shift so much. I should change my keyboard at work, but it feels a little overkill to bring a 1.3kg RGB back-lit mechanical keyboard to work...1
-
!rant
Long time no rant..
Although work is way too much and stressful, things are actually not too bad at all..back to the office (voluntary), got back into to a routine, got a raise way below what it should be, lots of "off the books" overtime that I'll never be able to compensate, but.. still not to bad at all.. feeling better than I have for the last couple of years.. 👌 -
Have you ever hit Ballmers Peak, only to fly past it but still keep coding? Sometimes it's an adventure looking at the code the next day. Three steps forward, one step back I say!2
-
Special work area meeting. Partners from around the globe came in. Call in or you flew in. Close enough, have to attend in person. Hundreds of people there. Starts at 9, broke at noon, picked back up at 1, ended at 6. Focus? Improving sales. About 98% of the people there did not make sales. About 70% did not work on bids and proposals. It was extremely painful and boring. And my project manager didn't know why we were so upset the next day. It had been extremely "informative" to her.1
-
This project is such garbage. JavaScript built at runtime with JSP bindings, every form is submitted with Ajax even when it doesn't need it. Ajax calls with HTML in a JavaScript string sent to the server only to be echoed back to the front end to build DOM elements. I literally can't even.2
-
This rant goes way back.
> Be a student with student placement program at a big non IT related company back in the college days
> Given the job to work on a system to digitize their paperwork
> Had to go through 1.5 workdays of bureaucracy (?) to install Notepad++ and other basic open source tools to work with
IT'S JUST NOTEPAD++ NOT THE FKN MATRIX! JUST APPROVE THE DAMN THING!1 -
Why is React.js so hard to learn for someone from a JAVA back end background? I'm constantly asking myself "so should I set param as string? or int? Array? so many methods that's returning html tags! what collects all and makes it appear at WHERE??"9
-
!rant how many of you work as web developers (front, back, fullstack, devops, alien, ... ) without a CS degree ? And if it's the case, do you suffer from it at work ?6
-
Came back home to work at a gas station this summer vacation, and nothing technical works. One of my coworkers tells me someone came and changed all our harddrives because the keyboards fucked up, amd that it had been REALLY pricy. Was wondering what kind of harddrives we got. Took me an hour before I realised she was talking about the whole fucking computer... I want back to uni :(
-
So this second hand laptop I got (Asus Transformer 3 Pro) had too many scratches at the back...
I'm not really a sticker guy, but I thought I'd give it a try.
Wow that looks ugly.4 -
the worst person I worked with was back in school. he would make no contribution to our work and would have a go at me if I did something wrong and whenever I fixed a bug he would act as if he knew the solution the entire time. it was so frustrating2
-
Working on my thesis right now... Can't concentrate at all, I try to focus but constantly fail at it. Any ideas how I can get back into study mode?
Would love to got to the library to write, but due to covid it's obviously closed.4 -
So I finally gave up trying to get TypeScript ES6 modules to work. Back to CommonJS it is, because fuck me I guess. I mean it *did* work... Until I also had to use a commonjs module at which point tsc basically tells you to fuck off with that2
-
Haven’t been on here in ages. People still moaning. Found a rant or two with some severe profanity.
A community of somewhat likeminded individuals who at some point have gone through similar experiences.
I’m back it seems.
(Not today, old friend)1 -
No...
I didn't spend the whole weekend (some 20 hours) wiping my server and setting it back up because it was a steaming pile of garbage...
then fucking it up again and redoing the whole process again....
.... and for good measure again because stupid me.....
GAAAAAAAAAAA
but at least it is working now :) -
The biggest issue I have with bootstrap is that some old school back-end dev always insist on using it even if the design doesn't work with it at all..
-
I feel inferior.... :(
Maybe I used too many ifs...
and it took me 1hr it seems...
maybe i should go back to sleep...
actually i woke up at 2am and realized i was supposed to be taking a nap... so i sorta overslept by 6hrs... tho i still need to work tomorrow... ehhh... today.2 -
So as it turns out, the redemption of client money has failed.
About £4k just sitting there.
I was doing testing earlier, and accidentally left the endpoint at sandbox, all of the payments failed, so we have to mock the payment in now, once we get internet back.1 -
So I changed the language and keyboard layout on my windows machine and now it is stuck for 5 minutes after signing in, waiting for... something, before you can use it as usual. It's like I'm back in 1995. But at least I can use my new keyboard properly I guess.
-
When the boss needs you to clarify a peice of info he received from a vendor/client because there's one techie word in it or the conversion involved you at one time.
I just got an email and it says we can't do 'thing a'. Does that really mean we can't do 'thing a'?
Yes. I'm gonna get back to work now. -
My biggest dev ambition is working on software that people care about, specifically, developers.
I would love to give back to the community at large since I would not be where I am at without all of the help I've found within it. -
How do you find somebody to date? I'm at this point where I only go to the office and back and maybe to the shop and that's about it (Yes, I'm that lame). What do you guys do to "meet hot singles around you"?8
-
Ever had it when you’re on a project and your colleague is too slow so you basically have to do half the work?
Well yeah that’s my situation rn , guy too incapable of completing the project so i got to do most of his work.
I’m a bit of both I do front end and back end development mostly front end and that is what I prefer and I’m best at.
But I gotta do loads of back end work that a back end dev colleague should be doing
Smhhhh -
First year as a professional developer, and this Thanksgiving break is making it hard to get back into the code base here at work. Am I the only one?2
-
Hackerman strikes back. Always thought the new knowledge about stego tools, reversing, enumeration, privesc were just my private amusement. But could now use it, hopefully resolving a severe crash by dropping our binary into radare2 (cutter) and ghidra, identifying some dangerous code.
Also it gives you new angles to look at things. E.g. the vectors your code might expose...3 -
so i had this day at college we were supposed have a viva ( oral test ) ..the teacher asked me to print hello world..in java but no where can i use a static method including 'main'..well i made a static block instead and added System.exit in it.. and i had to write the complete syntax of main else it wont run..but my teacher snapped back at me saying it could be done.. with a non static main
..nodded an okay..didnt want a fight..came home..figured out the thing she said is now obsolete.. fuckin hell..update yourself at least..1 -
!dev
When a process works better than expected but you were hoping that it only works as expected...
USPS (mail service) is known for being crappy. I couldn't submit a temp address change via web bc I couldn't type my apartment unit # into their web form but a mail hold request where u manually just enter any address worked.
So I was at my parents for a month, just got back yesterday.
I put in a mail hold n before I left my apt, but expired on like Wednesday.
So when I got back Saturday, I expected a huge mail dump but I couldn't find any mail...
However last week I went to the local office and put in a Temp change of address bc there was a chance I'd go just to get the mail but not stay for other reasons...
Got confirm letter that it would be effective like Saturday.
I'm thinking it won't cover the mail held during the mail hold.
Well apparently it did... So now all my mail is at my parents but I'm back in my apt... -
When you have to be at work becuase it's work, but you finish all your work in 1 day regularly, and it takes QA 2-3 days to get back to you.... Massive downtime.2
-
Android Studio 3.2b4 once again regressed on "No tests found" bug for Kotlin projects.
I guess someone at big G decided to "comment out failing tests for now and come back to it before the release"
I feel like this rant should be riddled with profanity but at this point I'm not even angry just very disappointed 😥 -
First day back at work, lunch time now. So far I've been to one meeting and done no work. I can't get on to the vpn. We get OTP for the vpn via sms. Sms is taking so long to come through that it always expired by the time I get it
The kicker? I work for a cellular provider1 -
I've had it with discords interaction API. The docs are vague and cryptic at crucial times and overall it sucks balls. I've been trying to build a framework for myself around this, but this shit is impossible to do without hacks or inconvenient at best to work around and the worst part is that the discord quality assertion or anyone trying to bring some quality back into this mess has left a long time, so it will stay like that for an even longer time. FUCKKK!
-
!rant
My xbox controller broke today. The left thumb stick is stuck at forward input even if I drag it back.
😞8 -
Everytime i am forced to code with Visual studio I cant really remember why I hate it so much. But when I wait for the first autocompletion it comes back at me: Intellisense you useless piece of crap! I am faster coding in notepad looking up shit on the internet for 'autocompletion'....
-
It has been a month and four days since a user handed over responsibility to check on this request for changes to a report. I send the new user my responses. It takes her until Christmas break to look at the reports!
It has now been six days since I made more changes and handed it back to her for their review. No Response. -
I currently have a piece of shit Acer. It made a bunch of weird beeps at me last night and the screen had a seizure. What brand of should I look at for a new laptop?
My last computer was a MacBook Pro that I loved. I didn’t have any problems with it until my cat spilled Pepsi on it. I’ve used Dells and Lenovo’s at work - they both got the job done.
Should I go back to Apple because I liked their laptop more than any other I’ve used or should I go for a Windows laptop that is priced reasonably? Should I try to build my own laptop?9 -
In an already verbose, strongly types Java codebase and you see
private String m_strDisplayName;
private boolean m_bIsResolved;
...
I can understand the itch of another teams decided to rename it with correct Java convention. All nice and good, except that these changes were not merged back to master.
Five years, few re-orgs and product restructuring later, I'm staring at 500+ files merging mess trying to bring back these product codebase together.4 -
It should be at night (after 9/10pm; I work better at night anyway), headphones on, music blasting (heavy metal nowadays), alone, preferably no distractions, but now that I am at home for xmas holidays I have to be on the lookout for my parents calling me. When I go back to uni I can eliminate that variable from this equation and so I should be in the zone for longer. Hopefully 😅
-
today is my 1 year here at work
got a new desktop last week
then yesterday bought some UPS for it then back at the office my 1year old partner (laptop) decided to die on me1 -
So I just refreshed LinkedIn and it has a new look.
It's so bad I can now remember Microsoft bought LinkedIn a couple of months back every time I look at it1 -
in this version of reality maybe there will finally be some closure and things will fucking recover as they should.
but i doubt it so long as people have a way of dragging me back when they have no right at all too and it doesn't seem to matter who, good or bad, anymore. -
when you can clearly see an object property you want to access and check against in web browser debugger but you're too stupid to figure out how to get typescript let you access it in code
fuck you SyntheticElement< >
i hate front end and it hates me back
just let me look at target.nodeName1 -
One thing I would really like to be able to do: always understand my own code.
Boy it irritates me when I forget to make proper documentation and have to loo back at some code I wrote days before. Knowing what I was thinking at that moment would be just great. -
Alright guys is elementaryOS worth? Really wanna try it out but at the same time I don't wanna regret it and have to revert back8
-
Hi devs, any of you tried to do something big with ELM lang? I made a clone of 2048 a few years back just to learn its hows and whens, but was disappointed that it can't handle simple recursion to test a winning AI, and left it at that
-
The most annoying thing ever: Chrome changing the backspace button to now use Alt+Left. I get that pressing it while losing focus on an input is "terrible", but by just pressing the forward button again, the form is back in its original state! At least add an option to change it back without the need of any extensions! It is driving me absolutely nuts, because I often just press the backspace to go back, instead of going all the way to the top left of my screen and pressing the button. And it keeps messing me up!! It would take me at least a few weeks to get used to this!1
-
Does anybody here still use dreamweaver? I used to use it a lot back in the day when I started as a designer, but haven't used it in years, but I noticed the app in our companies adobe subscription plan and have installed it.
Given that we live in an age of VS Code, sublime text and so one, I'm just wondering does anyone still use DW and if so what is it good at?2 -
A few years ago we had a fail-over which was successful until we started failing everything back to primary servers. The applications could not start at all.
4 hours into troubleshooting, only to find out some java security files were misbehaving. Update from another server and it worked.
Up to date i haven't understood how it failed -
The Internet went out at the office while searching for an error. Looks like I'll be stuck until it comes back again.
-
You see that little (but annoyingly bright) blue light on the back of my wifi card, well it flashes whenever the network is being used... And it's driving me bloody crazy.
To anyone looking at wifi cards, if the back if your setup is visible, I'd recommend against getting an ASUS card...8 -
I keep going to stack overflow without any question in mind as it grounds me back to reality about how little I know... At the same time makes me pull my hair out at how little I know... Arghhh1
-
exactly the day when holidays/vacations start, my laptop doesn't boot, nothing helps...
and only on january 8 we're back at work so i could take it to IT guys to repair it.... UGH! :(2 -
I’m not good at frontend and I’ve accepted that but it’s frustrating because I just am not good at making things look good and I hate spending the time on the looks when I want to just go have fun with the back end.
I will say though getting it to look the way I want is super satisfying as well.
Any advice or resources?2 -
What do you even write while searching for DevRant? I’ve spent a proper 15minutes looking for this thing to no avail, I guessed I should look at the recommendations next to the Dev app and luckily found it. I changed phones some years back and even forgot the name.
Feels good to be back though.4 -
Power is down in the office. Allegedly it will come back at 4pm. Everyone is doing home office now and I'm here waiting for it to come back.
-
Is self advertisement against the rules here on devrant? I wouldn't spam devrant with it, of course. I just happen to have developed a script a while back which some people might find useful. I took a look at devrant's rules and it says nothing about this, but I just wanted your guys opinion. Is this frowned upon here?2
-
What if instead of vertical slices across front end and back end for dividing work, we did horizontal slices and hope we don't do redundant work, miscommunicate or struggle to provide front end precisely what it needs from back end if at all.
fuck me -
how long is the gap for responsible disclosure again? isn't it a week?
Cengage still hasn't gotten back to me at all on my case with them. It's been about that... -
No going back
No forgetting the best
If they are jealous of others forgetting the worst hurt them till they do
No more theft
There is no justification
One round of photos and videos is 12. Years of pay at least
So. Hand it over
50k a year1 -
Nobody likes chatbots/conversational UI for anything other than chat, right?
I have a savings app with conversational UI. I press one of a number of options e.g. "Savings". There's this artificial delay after the network request has been made so that it looks like the app is typing back at you. Why???
You then get another limited set of options, or you can tap "Back". These options are supposedly as if you typed it back as a response.
I can get three "questions" (levels) deep, let's say to deposit cash, only for it to turn around and say that I've reached a daily/weekly limit? At each level there's this awful delay, and you already knew I wouldn't be able to perform the action regardless of my responses after my very first "message"!
Why is this good/popular? And the whole thing totally breaks if there's any loss of connectivity.
Stop it. Please. -
man alive do i get sick of their hidden jump out of the bush people creepos.
at least i can code. thats nice
i can code the same crap
and then they can steal it again
and then they can pretend they're being helpful being the lazy evil bastards they are.
and then i can work for 60k a year using technology rolled back too fucking far back because noone is motivated to do shit anymore.