I just discovered ctrl+r in the Linux terminal.

Mother of god this fucker speeds up my workflow!

A massive amount of kudos to the person who made this 😍

Get rid of required minimal lines of code for project assignments.

I
Will
Slap
The
Fucker
Who
Codes
Like
This
As
Many
Times
Per
Fucked
Up
Line

I remember back at study I had this friend who hated windows just as much as I did.

Then, for a project, he HAD to run windows on his laptop.

He was very fucking angry about that but did this:

Installed a Linux (debian?) vm (virtualbox) on his laptop and gave it all the spare resources.
Then he ran it fullscreen.

He was still using windows technically but at boot up he booted up the Linux vm and he just worked with that one.

Teacher wasn't pleased but he couldn't do much since the fucker ran windows on his laptop as instructed xD

This should not be called wisdom teeth, should be called stupid teeth
Mother fucker is growing perpendicular.

What fuck is wrong with you bro , grow upwards you dumb fuck!!

Bulma framework, thanks for existing!

Lightweight, CSS only, very fucking easy to use and understand and a beautiful!

As a backend/server/security guy, front end is hell on earth for me. I understand the basics but that's it.

This fucker makes it so simple!

So I named my daughter "io"

everyone calls her by the name and then we register her on our local gov't to get birth certificate.

AND THEN THESE FUCKED FACED FUCKERS! dont accept my daughter's name because of this STUPID SYSTEM OF THEIRS!

because "io" is too short for first name field to accept. Its like the devs become the law and just set their own limit.

It pisses me off. our law didn't say `len(firstName) > 2` and we can't use paper anymore as alternative.

I really want to punch the fucker in neck. sorry

Got the iPhone.

(Personal opinion)

Holy shit iOS is veeery unintuitive 😡

And how fucking difficult can you make a fucking phone setup process?!

I’ll be happy when I can sell this fucker.

Me: *finds severe bug in school-contracted software, emails teacher about who to talk to to get it fixed*
Teacher: "should I report you on grounds of computer misuse and hacking or...?"

thanks fucker, school-contracted company it is.

WHY THE FUCK IS IT SO FUCKING HARD FOR THESE CUM SUCKERS TO UNDERSTAND THAT CHANGING REQUIREMENTS 2 DAYS BEFORE THE DEADLINE IS JUST GONNA BREAK EVERYTHING!?!?
I DOUBLE DARE ANYONE TO TELL ME ITS NOT WORKING TOMORROW...
STUPID MOTHER FUCKER PMS CANT PLAN ANYTHING

Oddly enough, it's comforting to hear other devs mumble "mother fucker" or "what the fuck, you stupid piece of ass" when working on things.

It means I'm not alone and we can all suffer together 🤗

The math problem we've all encountered once -

There are 8 apples. Jack ate 3. Find the mass of free elctron floating inside the atom of phosphorus.

Worth mentioning our client who asks similar questions. That fucker.

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

So I've been pulling my hair out as for WHY ON FUCKING EARTH MY CHANGES DON'T SHOW WHEN I RUN THE RSS FEED GENERATOR.

Oh right maybe I should upload the file first 😅🔫

Lost the password to the main modem/router of our apartment (live in a normal flat of which the rooms are rented out to three students and me) which is in my room and tried to reset the fucker for a trillion times but couldn't get back in, the password didn't reset.

Took a closer look at the reset button and suddenly noticed some text under it saying "wireless connect". Then I noticed a tiny round "hole" above the reset text.

Fuck my sideways, I've been pressing the "wireless connect" button instead of the actual reset one every goddamn time 😐

I can now port forward again 😊

Team meeting, discussing current project task, dude just slammed his hand on the ground and screaming like a child that he needs help and his taks is more important than others

Fucker got fired 7 months later, took long enough

This motherfucker tried to fuck me!

Ok, here's the full story.
I applied for a quick job as freelancer. He told me I just had to implement stripe payment gateway. After finishing that he asked to save the user data from payment to the database, too. I added that. All the way he wanted me to work on his ugly project on a rotten server through cpanel. But I refused instead I uploaded a showcase environment on my own server.
After he tested my code and all was working as expected he again tried to make me implement the code right away into his retarded project before payment. When I mentioned that he has to pay me first he started bitching that he won't pay in advance.

At this point I left that fucker. Knowing that my feeling was right and this bitch never had the intention to pay for my work. He just wanted to steel my code.

Fuck you. I hope you get eaten in your bed by very hungry slugs one day. Like this one guy here on devrant.

Today I told a fellow dev to join devRant, and explained it was "like Reddit, but only for developers"

Wild manager caught us and said "Uh, just what everybody wants, some geek forum. Thank god I left that world a long time ago"

Fucker...

Reinstalled my dedicated server yesterday.

Then you suddenly get errors saying that KVM isn't found.

Searching my ass off for hours because I damn well enabled Intel virtualization in the bios!

Double checked after a few hours.

THE FUCKER TURNED ITSELF OFF OR SOMETHING FOR THE SECOND TIME?! WELL, THERE GOES A FEW FUCKING HOURS 😡

I am so fucking fed up with being brought into a meeting because you "understand the technology" and then no fucker actually listens when you say that their idea won't work because the tech isn't magic.

This fucker has some balls (I'm being completely ignorant), the day his website goes live guess who is going to flood it with Dados attacks.

I have been up for 3 days now, coding. I am dangerously ahead of master.

To late to turn back now.
This fucker is getting pushed.

I've had this amazing piece of advice as my Desktop wallpaper ever sense it popped up on r/programmerHumor. I mean I still don't write clean code, but now I know to be prepared for the fucker!

I see a lot of hate for JS in here. I personally love that mother fucker.

FUCK THIS! FUUUUCKKKKKK THIIIS!... one would be fucking excited and motivated to finish work, but your entire fucking productivity is hanging from the internet connection's dick!!!!.. Fuckin ISP mother fucker! FUCK!... i can't fuckin work under these conditions for fuck's sake! SHIT!

Window...update available... Later
And now ?
Later
And now?
Later
And now?
Later
And now?
Later
And now?
Finish my day, do it fucker but tomorrow you need to work

Today ... Bootloop

Mother fucking ☮️ of shit

MOTHER FUCKER IDIOTS!!!

SO I HAVE TO ROLLBACK OUR PROD DEPLOYMENT BECAUSE IM THE ONLY FUCKER WHO UNDERSTANDS THE SIMPLE CONCEPT OF "DONT PUSH UNFINISHED CHANGES"?!?
DAMN!!!! FUCK YOU ALL...

Nose picking manager.
I mean this fucker picks his nose even when he’s talking face to face,
And am not talking about just cleaning it,am talking about putting the finger in all the way and probably trying to dial a number...

Fuck windows 10. I log on to start an interview code assignment that is timed. I'm on my computer getting things ready for a solid 10 minutes before starting the test. AS SOON as I start the test, windows 10 informs me:

Fuck you. There's updates and I'm installing them right now whether you like them or not, fucker. I bet you're doing something important too, so I'm not even going to let you schedule it at another time.

Fuck.

I hate it when clients force me to fix their fucking magentos with crappy javascript fuckarrounds because the shop is already a huge pile of fuck with window resize events fucking up all onservers. 4 jquery includes all messed up fucking each other in a cum gobbling bukkake because you never know which jQuery, $j, jsm or jFuckYou is bound to which library. I know i have to spill my own fuck all over that fuck. Frontpage slider is raping the search results for slides leaving dead meat in the results foreever. Fuck your fucking fuck you fucking fucker.

I know we agreed to stop the Windows 10 rants, but this fucker just crapped itself 20-ish minutes before a live video production. Had to run to the other building and steal a computer from the folks in the studio because this one would no longer boot.

Some fucker installed a keylogger on my Ubuntu laptop at home and registered it as a systemd service. From Wireshark, it's sending each keystroke to a server in France using irc. Tried accessing the server but the moron shut it down immediately. It's the last time am fucking installing code from prebuilt binaries. If I can't build it from source then fuck off your sniffing cunt. I was about to log in into a database from that machine.

UPDATE: I found the actual file sending the keystrokes but it's binary. Anyone know how I can decode a binary file?

How can people be so fucking stupid?

Imagine I made a program with two buttons, one that says "click here for x" and the other that says "click here for y" and they are asking me where to click for x.. Really mother fucker? Do you really have a PhD? Might me a PhD on retardness!! fuck you, I'm on vacation...

I'll be buying a second hand Surface tomorrow.

Will put Linux onto it right away, found good instructions on doing that including making the touchscreen work.

If that doesn't work, I'll sell the fucker again because I'm not running windows. I'm just not. That malware can go fuck itself.

Looking forward to transferring that windows machine to a Linux one!

I'm currently freelancing abroad.
I don't get the UK Salley but I don't pay the UK prices.
I get to travel, see the world and support myself.
Much more valuable then any high end wage to me.
Freedom.

Working on adjusting a shell script to my needs.

The fucker quits execution after an apt update command is ran.

No reason, it just fucking quits. No error messages or whatever, nothing.

This script can go suck a cock.

Installing a new Debian VM/VPS.
Nearly done with all steps and decide to lay down.
Fall asleep and wake up half an hour later.

The grub option is on screen.
I am sleepy as fuck.
Accidently selected the manual option and just pressed enter at the screen where I have to enter the device name.

FUCK.

Well, let's install this fucker again.

Got the iPod and music synchronisation isn't working well with Linux (I've synced quite some iProducts and it always goes great so this is a new one for me).

Bought a windows pc a few days ago and haven't installed Linux onto it yet so booted it up, installed Firefox and then downloaded iTunes.

Nearly done with installing when an error message pops up and the entire fucker blue-screens. Now it doesn't boot anymore 😡

Go die in a fucking corner, windows.

GODADDY IS THE BANE OF MY FUCKING EXISTANCE
I WOULD LIKE TO MEET THAT GUY BOB PARSONS SO I CAN STAB THAT FUCKER IN THE GOD DAMMED BALLSACK

Fuck yes for data hoarding! Wanted to start on a project again but thought I lost everything.

Code is sill in git, (took me a while to find but whatever) database is still on my own laptop (due to ex/importing my entire local host as for databases every time I do a new installation).

Let’s get this fucker going again 😎

This is a sad rant. Today I went over to one colleague to discuss one technical appetite I had. This colleague of mine is a very good in his skills and I never had any issue sharing my problems. Then this other colleague come over and jumps in "what's the problem tell me". I just tell him of some things I do not understand then this 2nd colleague the fucker asshole starts loudly pinpointing my lack of understanding of this and to prove I don't know more he starts asking very deep questions on the same topic. I am surprised and furious and feel like fucking him out. Above this he pats on the 1st colleagues back and start talking in things which they solved and skills they possess above the rest and admiring each other

You tit of the asses you fucker 2nd colleague go fuck yourself if you have so much attitude.

I left with mixed sadness and this huge rant against that fucker colleagues who think they stand above all because it's fuckers like you with your shit attitude of nothing.

I'm a computer sciences student, so I had to work on a group project at the end of the year. This project had a very big impact on our ratings, and many students were working really hard on it
One evening, a friend of mine knocked at my door to seek for help, she was too depressed to keep working on the project and needed to talk a little bit
After a little talk, we worked on her part of the project together. We managed to finish it just in time and send it to her teammate (they were not using git, our school never ever talked about it so they did not know what it is)

The next day was the d-day, every group had to show the teachers their projects
I arrived in a room where everyone was trying to fix the remaining bugs before their turn
And I saw my friend, almost crying. Her mate changed everything in the code we worked on and everything broke. There was not enough time to merge it again, they were stuck with a non functionnal soft
Obviously, he kept telling everybody it was her fault

Just go to hell, you fucker
I can't even understand how you did have such a stupid idea, now she needs to repeat her year because of you
Fuck you and don't ever come in my sight again, you selfish brat
Just because you know you will pass does not give you the right to fuck with another person's ratings

Fucking son of a bitch force pushed to git effectively deleting 4 hours of my work and was keeping his mouth shut for two days while pushing ontop of that bullshit during these days and completely minifiying that file I was working on to make sure that he makes my life miserable.Fuck this fucking shitty ass retarded fucker for doing this SECOND time already!

I don't know who the fuck told the I.T. Manager to block the website without informing the employees.

Mother fucker blocked Bitbucket. I' am going to fuck his ass on Monday.

Why the fuck cant people keep their hands to them selves???
I had a fucking moron come up to my desk, say "cool toy!", grab it and play with it.
For him that was fine....

I on the other hand wanted to stub that mother fucker to death and feed his organs to his kids.

That mother fucker grubbed my probe holder, shorted out an 8k$ evb and failed my 12 hours hardware test.

Fucking grease bag

So I spent 4-5 weeks explaining how shit the current code base was, implemented gulp tasks to lint js, CSS etc, written shed loads of coding standards and best practices to follow. At this point everyone was onboard with the changes and thought brilliant were going to start getting some good code coming out of this team.

I go on holiday for a week, come back and fucker has ignored the documentation disabled the linters in the gulp tasks and the code is back to square one SHIT!!

Plus everyone still committing to master!!!!

Why do I bother!!

This fucker right here. Two pages under the same site return different session data:

Session cookie is the same.
The session file itself doesn't change.
Same machine is being used.
I don't change the session variables at any moment.

HOW?!

...........the fuck did I just read

This mother fucker ever read a book before? 🤦‍♀️

Me: Hans, Get ze Flammenwerfer!!!

Hans: Why?

Me: The fucker rejected my PR because "calling twice the same getter is a code duplication". I swear, he always tries to find something!

Write comments you dumb fucks.

If you change shit that is different from the original pattern， fucking write a comment.

1 minute vs. 45 minutes you mother fucker.

This is utter bullshit. Repo shut down because SJW being offended. Python, then Linux, now this.

Next thing we know is GitHub got sued bc they hosted the bot. Then Microsoft. Then the internet is taken down because it serves as a vector to offend ppl.

Really. Fucker need to know when to stop.

Windows, God damn you piece of fucking shit.

Why the fuck can't you make networking fucking easy like literally every other fucking operating system in the goddamn fucking world?

Why the fuck can't I spoof mac addresses so that I have the same IP address regardless of if I'm on a hard line or wireless?

Who in their fucking right mind thought that the pro version of Windows wouldn't need to do that?

I don't even like using you at this point, I'm forced to use you for work.

There's literally not enough explicitives that I can chain together to sufficiently convey how much I fucking hate you Microsoft. So enjoy this seizure inducing tourette's mode compilation.

Fuck shit cock piss mother fucker asshole bitch mother fucker sick and tired of your fucking shit Microsoft you fucking cuck piece of shit nobody fucking likes you they only have to use you because no fucking business in their right mind is going to spend the millions of dollars it cost to fucking switch over to fucking Mac or Linux I hope you fucking choking a bag of HIV riddled flaming dicks you fucking piece of shit.

Setting up my new second hand thinkpad with Linux Mint KDE.

I just chose for harddisk encryption.

My password is so freaking long and complicated and I didn't write it down so let's start learning this fucker out of my head 😅

What's the difference between a wasp and single loose hair?
Apparently none till the wasp stings :/

Yesterday I thought I had a loose hair on my neck.. ok, I shrug it off.. later again the creepy feeling.. shrugs off..

I continue to work, sumberged in code, wanting to find the fucker (bug, not the wasp/hair).. lean in to the monitor... 10 cents away from the screen... Ok, maybe that's it! Feels the hair on my back, near shoulderblades again... shrugging again more violently to get it further down to fall out.. nothing.. ok, got the bug, threw myslef back in the chair with substential force & BAAAAM!!! Motherfucking hair bit me!! O.o

I scream in horror & on top of the lungs (it was late, after work hours so I didn't expect anyone else still at the office) PROKLETA PRASICA (roughly translated to goddamn female swine).. I previously saw some green bug flying around the office and I thought that nasty thing bit me (didn't know they bite soo, much more horror for me).. O.o

Anyhow, I jump up from the computer and see my coworker looking at me all baffled.. I proceed to franticly take of my headphones and hoodie..thinking about wtf should I do now, I cannot get undressed in front of him (not for my sake, bra is the same as top of the bathing suit for me, but still..I don't want anyone suing me for impropper behaviour of undreasing in front of coworkers..), how the fuck should I get to the toilet?! O.o

C: Are you ok?!
M: Um.. sth bit me..wtf?!
C: There was a wasp flying around somewhere some time ago.. are you alergic?!
M: um..not sure, I don't think so..we'll see soon..

I proceed to the WC, to take off tshirt & check/kill off the fucker.. on my way there (walking funny to not press the hair to my body again) I got another surprise, another coworker was working late..

C2: Are you ok?! O.o
M: yeah, sth bit me, probably a wasp..

Ok, finally on the loo..ok, do not lock self in in case it escapes and you need help.. don't even shut the door. Check.. standing between the doors I contemplate on how the fuck should I take my tshirt off without angering the fucker even more and getting bitten again.. O.O

I lifted the tshirt up my back to let it out.. nope, not there..the creepy felling of buzzing around between my shoulder blades continues.. crap.. what to do?!

I stood there & contemplated the task.. ok, roll up the tshirt to the shoulder blades, not against the body (duh) to prevent further stings..tighten the fabric, so it cannot escape, quickly remove the band from the body.. done..reversed the tshirt and straightened it.. bzzz... Fucker fell somewhere.. Dafaq?! Was it really just a wasp?! If yes, no problem...but what if coworker was wrong and I got bitten by that nasty green whateveritsname bug?! Eeeeewwww! Is it poisonous? Gotta find it & kill it for good.. waited a bit, than saw a goddamn wasp crawl from under the toilet.. wasp!! Yess!! Stopm stomp fucker!!

I get dressed & go back to my desk..

C: Did you terminate it?!
M: Yup, fucker went on a toilet paper trip down the drain!!

I sit down, starting to get my headphones back on and proceed to work.., but before I could, one last gem:

C: CTO would say, thank god it didn't sting you in your finger cuz you wouldn't be able to type anymore..

M: O.O so true hahhahahaaa

Disclaimer - I like animals, but I freakking hate wasps..especially if they get under my tshirt to sting.. :/

We have this Lukas Podolski paper display someone swiped at a soccer club store. So we hide the fucker in offices, bathroom stalls or behind doors and people get scared shitless.

I'd say Linux but seen that around a lot so I'll go with another favourite:

OsmAnd(+)

It's basically an offline navigation app which works with downloading maps offline and then you can use navigation without Internet (gps though of course).

It's very easy to use, looks okay enough and no fucking tracking at all. I was in Switzerland recently without any service (my friends didn't have service either and their navigation relies on Internet) and this fucker saves us big time.
Not saying that there aren't any other offline navigation apps but this one is awesome imo.

Holy fucking shit!
Look, I know I'm kinda average, I actually think I'm kinda stupid... But holy fuck this new mother fucker at work is in a fucking new level of dumb ... OMG!

I'm actually thinking about asking my boss to let him go and this guy isn't even there for 2 weeks yet.

Just managed to setup a tiny/simple privacy-friendly analytics system.

You basically call an api from your backend with the api key and all the headers you received from the browser (php and Apache or nginx in my case) and the analytics api gets useful stuff out of that data without sacrificing privacy.

I get a little bit more insight into my websites usage and the client isn't sacrificing identifiable information!

I've been wanting to make this fucker for fucking months.

Hello people. A few people of the Dutch section of devRant have been talking about a possible meetup for a while now and a day or so ago we thought fuck it, let's not keep postponing but just get this fucker running.

So the idea is to (still quite short term) get together in The Hague the second weekend from now (so around the 21st).

Saturday or Sunday and meetup place have yet to be decided.

Let's discuss in the comments!

Me, when read old code:
if z == true
return true
else
return false
Yeah, why not stupid fucker.

Last week one of my non-dev coworkers asked if any of us knew java and I was like "yeah, think I can help you" then she showed me her JavaScript issue and I was like:
"Wtf, people really do this shit..."

Fuck you stupid cunt!!!! If your fucking project depends on empty folder structure just put a fucking gitignore file on it so I don't have to waste all fucking day debugging your tasteless spaghetti to figure out that you download files to an empty folder that git clone doesn't create.

Ordered a new high storage dedicated server (rented online) today.

The fucker wasn't delivered as soon as I hoped so decided to finally go to bed at 2am.

Aaaaaand then, of fucking-course, I got the email with the deployment notification literally the second before I went to sleep.

No sleep yet anyways, I guess 😅

I've got an Arduino now and I was building lights the last weeks to understand the coding. But when it comes to use full stuff I could do my mind is empty. Do you have any suggestions for me?
.
.
I know there have to be FUCKs in a good rant. So I will miss use the tags...

Windows is fucking amazing... Tried to disable and enable my audio drivers, prompted me to restart, i pressed cancel, fucker still did a restart. Best part is it started to do updates... For fucking 20 minutes until i forced it to shut down. After it turned on i didnt have any audio, enabled it and woo.. Another restar that wantwd to update...
Also happy birthday to devrant and to me

Be me:
> turns on laptop
> enter funky town password
> presses enter
> expects wallpaper to show

Be windows:
> fuck you mother fucker!
> surprise asshole
> I magically updated on you without warning

Wanted to open the door to the outside word and see this fucker just sitting at eyelevel a few centimeters away from my face... I'm awake now.

And don't worry he lives his live outside now.

Area manager: ok we are having this volunteery meeting after hours but if you don't show up, your shifts will get cut...

Mother fucker. Just sat it's mandatory, done and dusted, don't fucking piss fart about saying otherwise, fucking wanker...

(I'm not a fan of my AM if you can't tell)

Whoever's the fucker that want my pictures over in DMs in Discord please stop asking for it or I swear a big tiddy onee-san will ara ara you in bed, and that won't be me

Raspberry pi worked perfectly fine. Reinstalled the sd card for some reason (on purpose) and now, no matter what system I flash, it always crashes at stone point. That point is random every fucking time.

I just want this fucker to work 😥

Fuck you dickhead. If you don't like how I'm doing things, just fucking do them yourself. Or how about you give me some specifications, designs, a consistent database model? No? Fine, then don't fucking complain when I make do with what I have.

What is it with this team and the developers it attracts. 2 devs joined and left, both had several years of experience, both couldn’t google an issue to save their lives and needed to be helped 24/7.

Now we are mentoring a PHD student for a piece of his project. Dude was left stumped by an error message that said “Can’t find file at path ...” because the path didn’t exist. He spent a few hours trying to fix it before asking for help.

How, HOW are people getting through college / university without being able to read, or debug such a simple fucking error message

I think we need to stop to use the phrase "hello world " in programming , let's try "Surprise mother fucker" instead.

Hihihihi just saying...

I pitched a homebuilt Raspberry Pi and AWS IoT automation solution for my weed guys grow op.

Now the fucker wants me to actually build it and to pay me in weed.

i fucking hate when people just make tutorials with powerpoint slides explaining and talking for hours ughhhhh just shut the fuck up and show me the fucking code u fuckin mouth fucker

!dev

Feck I hate public transports. Rude people everywhere.

When the train arrives, everybody is pushing themselves at the door, not letting people stepping outside properly, then they lay their filthy shoes on the seats, contributing to the cancerness of the place, they cackle like hens, so I have to put super high volume on my headset, bringing some dark looks from other peasants because I listen to metal, but fuck them, and when finally you arrive, with nearly all the people standing up since 15 minutes ago because they want to go off first, some fucker in front of you steps down, with his luggage, and STOPS right there to open his handle so you're sure to bump in his ass, he turns to you expecting YOU to apologize when the fucker took the whole place for himself, I give him a mean look with my metal chaos pissing from my ears, and venture off to bump in a girl who was standing in the FUCKING way again checking out where she had to go. ARGH.

When you are in a hurry to make payment .. and some fucker has done this.

Guys....
He's almost here.....
I can't believe it!

PICKLE RIIIICKKK MOTHER FUCKER!!!!

I swear next time I see a UHD TV sold as 4K I'm gonna pop a cap in the lying fucker who mislabeled it!

4K has 552,960 more pixels dammit! This is the "720 HD" bullshit all over again!

OH MY FUCKING GOD!!!!
HOW CAN SOMEONE BE A FREELANCER/WEB DEV AND TYPE SO FUCKING SLOW AND HAVE TROUBLE WITH FUCKING LETTERS ALL THE TIME?!

I'm gonna push this mother fucker so hard that he will learn not to "lie" in an interview never again and become a fucking dev.

So i am a trainee at a Software Company in germany. Im in My thir year. We got a new trainee who has a better degree then me and is 3 years older (hes 23). yesterday we was in our Office working and My "teacher/Boss") was talking with a customer. Then the new trainee asks me at least 5 fucking stupid questions. I stay calm and answer them normally because i think He dosent kwow any better and would Learn it. So this fucker works on a typo 3 Website and ask me why He cant Put Java Inside his Website to animate some articles. I ask him why He would want to do this with Java? He says (like a ignorant fucker) because its only working using Java. I kindly ask him if He maybe means javascript and Not Java. And He says: oh yes i mean That but thats the Same thing. I say no its not javascript and Java are different languages. He responds with no Java is just a shorter Form of saying javascript. I quit helping this guy. The fact That he thinks He knows better its just killing me.

[Begin Rant] When you show your senior manager your REST Web Service and he says "Oh no nooo... I don't wanna see no code"... Me: Code?? That ain't code you fat silly fucker it's the command line output data which I spent a week parsing, batch processing, and storing into the database! [End Rant] :[

Writing a Firefox add-on which analyzes the current webpage's links and puts a warning if one of those links to one of the prism (surveillance network) integrated services/companies.

Nearly ready enough for testing (real working version) when I suddenly realize: web pages can request resources without links.

Gotta rewrite the fucker partly now.

How fucking stupid can I be. 😐

Parked the car in a parking lot 15 mins before job interview. Plenty of time to spare.

Go to pay for parking.

Ticket machine doesn't accept cards. Fine, I have notes.

Ticket machine doesn't accept notes. Shit, I need to go get change quick.

FUCKING FUCKER DOESN'T ACCEPT £1 COINS WELL WHAT THE FUCK TO YOU ACCEPT THEN YOU FUCKING FUCK I'M GOING TO BE LATE FOR MY JOB INTERVIEW OR GET A £80 FUCKING PARKING FINE

Fucking fuckers on Stack Overflow...

I kind a use SO every fucking day, helping people with horrible formatted (don't even start about content) questions, and then when I got a single fucking question once all three years, no fucking cunt out there is willing to help.

Some dumbass even downvoted my (in my eyes) total reasonable, perfectly formatted, good written question.

I fucking hate it, that I spend so much time on that fucking platform, whilst nobody is giving me some help.

Fucking fucker cunts....!!!!

I've fucking got about 2,5k rep, I fucking know, in what fucking dimensions I can ask a fucking question.

Fuuuuuuuuuuuuuu!

Don't you just love it when this fucker jump scares you at 1 am!

Just run “npm install”.

Mother fucker, if that worked, or if the six hours I spent trying to unfuck your dependencies worked, we would not be having this conversation.

Now I know for sure that my coworkers can't read error messages.

Every fucking time git doesn't push or pull properly they can't figure out what's going on, almost one year since we migrated to git ... come on... read the fucking message!

Today is "Beer consumption glorification day"

Everyone is welcome, except that one fucker

So this was going to be a comment but damn!!!!

Windows is seriously about making life harder for power users now, every fucking update lately is moving more easy to change things and fucking hiding them inside hidden menus or stupid links that don’t make sense. I mean fuck I just want to turn on dual screen with my laptop (because for some bizarre reason, just showing the desktop on the plugged in monitor is so hard to do automatically, especially since I just plugged a hdmi cable in) and the fucker was gone with nothing but a “detect screens” button before it would use an external screen.

Fuck I’m so close to pulling the plug on windows, but Linux just doesn’t sell me for daily use (yet... it’s getting there though)

The fucking forced updates (yes I consider a random bsod due to a system interrupt, then as it reboots magically has updates awaiting... a forced update) are starting to get to me, the fucking thing half crashing and not responding due to a network transfer of files (the fucker was 5GB)

If it wasn’t for my gaming needs and someone can show me a very good alternative to MS Visio (I haven’t really found one yet) then I would swap over and just adjust to the not so great (imo) desktop environments.

So I was talking to a Boomer about my job and why it's not "so easy, all you need is a laptop". And we were talking about specifically how the company makes a ton of money from my work, I've seen the contract, I get like less than 5% of what I make for the company.

After explaining a couple of things like this. They go back to then "why don't just buy a laptop then?"

Like, mother fucker! Did you just ignore my entire explanation just because don't understand it?

This greek-speaking fucker (who wasn't Greek, he just spoke the language) went full bitch mode when he found out I recommended against giving him a promotion.
While screaming for an hour he called me "ornitophagos", or something that sounded like it.
I'm not quite sure that "chicken eater" is an insult, but it surely seemed like one. Maybe it was some weird attempt at hinduphobia, dunno, I just changed my recommendation to "sack the fucker".

Fuck you nvidia mother fucker, go rot in hell!!!!!

Honk! Honk! Here comes your company's proprietary library wearing big, red, squeaky fucking clown shoes! What a goofy fuck he is! Look how he breaks and limits React because he's a stupid, broken, clown shoe wearing mother fucker! Watch him trip over his big stupid feet and fall flat on his fat, stupid face. Hope you weren't planning on being productive because this big, dopey fuck is your partner.

fuuuccckkk stackoverflow.

q: "why doesn't python do this like i want:

me: "Here's an answer that quotes an article and links out explaining with Python 3.6.x doesn't allow that."

every fucker: "downvote, doesn't answer why it isn't allowed"

FUCK YOU, PROVIDE AN ANSWER THAT DOESN'T SAY WHAT I SAID

I do IT work along side my dev work. I had a Dr come up to me and ask me if I had time to help him pick out a personal computer... (Mother fucker I am on lunch break) "Sure" I say... "What's your budget, what will you be doing with the computer?" Dr - "I don't mind spending $6,000 and I want it for minor gaming..."

MUST BE FUCKING NICE!

Been encountering way too many people who say that "Programming is easy" or "Learning to code is easy".

Like, yeah mother fucker we have education curriculums to teach kids. But that's not all there is to it.

This has the same energy as someone saying "math is easy" after learning 2+2=4. There's more a lot more to it dude.

Fuck you javascript and your bizarre Date object.
May your ass itch, and arms become too short to reach.

Spend a good hour debugging why this fucker:
(new Date).getDay();

Returns 3, when it's actually the 2nd of May.

Turns out the value returned by getDay is an integer corresponding to the day of the week.

(new Date).getDate(); it is, ಠ_ಠ

Some mother fucker decides to change production application db credentials…wtf man🤒🤦🏿🤦🏿🤦🏿

enough is enough
to all the fucker ass morons deploying mini js frameworks with ambiguous names and undocumented functionality all fucking minified and using at least 20-30 of them on each page
dafuq you need a different slider for every section ?

"get lost"
The fucker was just saying he would not help me, but in the end I should have taken the advice literally and got the fuck out of that fucked up place.

Suck my dick fucking windows... not my RAM... mother fucker.

1) That loud ass mother fucker sitting besides me, shut the fuck up.

2) Air motherfucking condition turned all the way to the max makes me horny and want to fuck your motherboard.

3) Illiterate assholes writing code without any comments and half assed function name just to look cool when we approach them for doubts.

4) Onsite motherfuckers enjoying their lives, taking photos of it and posting it in a monthly magazine while we s(h)it behind the fucking systems all day.

Thank-fucking-you, y'all can die suffocating in your own smelly dierraea poop.

The fucker complains when someone doesn't write unit tests, meanwhile he tops any new code he writes with a @codeCoverageIgnore annotation ... 😒😒

This stupid fucker of my senior writes code directly in server. Whenever I give my branch name to merge and deploy, he types code manually again in the server. This introduced a bug and I had to fix it in server again.

Some mother fucker parked his car in my parking lot...and it's lying there for more than 2 weeks...

There’s no better feeling then doing a full server rebuild, modifying several projects heavily to be portable and keep working under new infrastructure and loosing access to dependent systems.

Migrating everything across, firing up Apache.... and BAM the fucker just works and ssl labs gives it an A (it was a giant F with multiple vulnerabilities yesterday on the old server)

Mother fucker disable torque you piss of shit!

I'm tired 😭😭😭 aren't you?

‎(ﾉಥ益ಥ）ﾉ ┻━┻

Oh my fucking god people are stupid, or ignorant, or fucking both.

How hard is it to copy a password from an email and paste that fucker in and press login.
Seriously several times of “this is your email” and “THIS” is your god dam fucking password.
God kill me now.

(No the password isn’t stored in plaintext, I reset it myself before sending it to the user)

Created a variable in the middle of a rant with JavaScript and named it as an acronym for "mother fucker", it actually worked what I tried to do with it... "mother fucker" is in production now

One of my classmates was working on a login form, and the fucker handtyped a 100+ character email validation regex but forgot to add a check to make sure no fields were blank.

It was funny when I was able to create an account with no username, breaking his website, and even funnier when I told him html forms have a built-in email pattern

That moment when, after having Spotify crash on you several times during the day, you decide to attach a debugger to the fucker in case it decides to do it again...

Fuck this short jackass asshole fucker fucking sales director that keeps promising features in no fucking feasible time just for his fuck fucking commission! Then the fucking cocksucker CEO enters the room on a Friday saying: "We will build this because we can't lose this client."

We never fucking had the client you giant asshole piece of shit! He just fucking lied on the demo and we have to deal with that!!! Tired of this shit

So, this poor fucker right here has spent 3 hours straight trying to install KDE Neon AGAIN, FOR THE 14TH TIME AS OF TIME OF WRITING on an old 0.5TB hard drive with some GiB-wise partitioning size and apparently the disk doesn't like it.

Can someone give me a dildo so I can fuck myself more because life is not fucking me hard enough? No lube needed kthanksbye

I've got this customer who for some fucking reason won't change their DNS to point to our new servers, but wants to fucking stay on that old piece of crap, where we have to ask our sub-provider to generate a CSR to send to our customer to use to sign a certificate to send to us to send to our sub-provider. Because yeah, that's so much fucking easier than just pointing your domain to our new system, and get SSL set up automatically. For fucks sakes! And also, your certificate expires tomorrow, and since our idiot sub-provider hasn't responded to my email about CSR in a week, you basically have no option. So get that thumb out your butt and just switch the DNS!

Seriously!? You don't fucking delete or change code because you don't understand it and push it to production, it's the way it is because of reasons you airhead can't comprehend ... ffs the fucker could have asked me and saved us trouble and embarrassment.

Fuck.

Working on a module in an old shitty system. It takes 150 seconds to boot the fucker for debugging, which gives me one minute of debugging before the inevitable crash. Four minutes of debugging costs me 10 minutes of watching the loading splash screen.

I'm about to send my keyboard on a journey, straight through my monitor.

Yay, I have to rewrite + design a 15-20 year old website 🎉

Originally written in, God knows what version of php, HTML and JS by a Java dev, and patched every other year when something broke or a new feature was needed, every time by someone new...
Some years ago the system was moved from a Windows host to Ubuntu and that was a nightmare in its own, because of all the hard-coded paths...

Welp, at least some fucker found another fucker who is willing to create a new design for the site, so that's off my plate...

Just noticed my boss turned a nice and beautiful polymorphic code into a fucking hard to maintain switch case that now this mother fucker here has to maintain just because he probably thought it was too hard to understand.

I bet he finds it hard to fuck his wife in any way other than the one she needs to wear a strap on and tear his ass apart...

New boss gets us to work overtime, all weekend and till 9pm. Promising that we will get that time back.

We get the project through the door. His KPI looks great to his boss. He then slithers his way around hints about this time back. Someone confronted him today and he says he can't officially recognise the over time due to company policy. The fucker.

Has anyone installed Elasticsearch on Linux - centos to be specific.

Trying to workout why the fucker won't install. Setting up a proof of concept so don't want to use it currently as SaaS.

From why I can tell, it only needs Java, (check) and to be ran as a user other then root (check) but running ./bin/Elasticsearch hangs after a while and starts powering up 100 odd threads with no progress.

A fellow <insert some data science title here> giving me more acknowledgement than all of the old guys running the show and, erm, "leading"?

Fucker left me behind, good for him.

PHP + gettext + Windows
Get fucked you ginganormous cockfaced dick wiggle. Get the fucking fucked in your fucking fuck hole. Fucker.

“You want to know the answer to that” is the answer I got to my question about a piece of code...
I guess he thought he’s too good for the job.
The dude had decent amount of knowledge but was arrogant as fuck.
Every time I asked him a question he would react as if I was making him work without pay that too on a Sunday (it wasn’t)
P.S. fucker got rejected

My boss is such a fucking pussy when it comes to stand up for anything that, even being a calm person, sometimes I just want to bitch slap that mother fucker, get him by the neck and say:
GROW SOME FUCKING BALLS FOR FUCKS SAKES!!!!!! WHAT THE FUCK!!!

Why did the chicken cross the road?

BECAUSE THAT FUCKER WANTED TO ATTACK ME!

We have Jira to keep track of bugs and allow users to inform issue with our in-house software. One fucker created ticket, "Hi Guys, I cannot sign-in to Skype business". He even put the screenshot.

What the fuck he expected us to do. Everyday have to deal with low mentality peasants.

Forget the people that don't use tests.
If you are a guy that doesn't even use error handling,
F U C K Y O U
I can't move on my tasks because the fucker doesn't have any error handling and he is absent so i have to fix them.
fucker.

Week 1 of the new job, and it seems I have some pretty low expectations to meet.

Seriously, I just did the math. Let's say one works an average of 48 hours per week, 50 weeks per year. Just as an average. That's 2400 hours in a year.
In the Micro-scale, a manager would mess up their team once every 2.4 hours (2h24m) or about 4 times per day (assuming 5 working days per week).
That is a pretty low bar to clear. It easy not to be an antsy brat that are-we-there-yet's a professional dev four fucking times a day.

And yet... that is what the complete moron who previously sat on my chair used to do.
Seriously, apparently he used to remote access the team's dev envs *while they were working* and even mess up some of their code. Just as a "monitoring measure". He logged their "keystroke time" in a day (using a primitive windowing method, I must add).
At least 7 requests for updates per person per day. I have his slack history, I checked. Dude literally did nothing else but be an annoying anxiety death pit.

And then there is his bulshit planning...
He created tasks out of his stupid whims, no team review or brainstorming, not even a fucking requisites tallying interview.
He prioritized those out-of-nowhere tasks using panic-driven-development practices and assigned them by availability heuristics.
No sizing method, just arbitrary deadlines for tasks.

I think I will need to have daily standup meetings and an open door policy (that is to say, do no actual work) for a couple months until I can instill some sense of autonomy on my new team. Shit.

Someone has another idea? How do I bring some confidence&autonomy back to devs that are used to be treated like dogs?!?

I fucking hate people who report somebody else's work as their own successes so much.

I've written a fair amount of perf tests for our project so far (actually I'm like the only person doing that). Some fucker from another team asks me if I could write one more. I agree, because why not. I spend a few hours, making sure to cover all cases and commit the test. Then the same fucker runs it and reports it as HIS PERFORMANCE MEASUREMENTS.

0 credit given to me. Fuck you, I just wanted to be helpful and you used this.

I'm still quite young and tend to fall for shit like this, but getting more and more grumpy because of those people.

How to fucking unscrew this little shit.

I was able to unscrew the rest just fine. But just when I'm down to the last remaining screw, this lone fucker decides to put on a fecken feight.

I already tried everything. I used a screwdriver that fits perfectly. Rotated it for god knows how long. Attached a strong magnet to amplify the screwdriver's magnetic fuckery. Tried unscrewing upside down to add gravitational force. Tried chopsticking the fuck outta it. Slapped the back of it like I slap rice sacks in supermarkets. Ran physics simulations on a supercomputer. Still won't come off.

(ノಠ益ಠ)ノ彡┻━┻

It's just there, looking like it's about to come off with a dip of a magnetic screwdriver but IDK WHY IT WON'T COME OFFKZKKXJZJKZ!!1

You wanna put on a fight? Fine. Resist while you still can. Because once you come off, oh ho... I'm gonna do bad things to you fucker. Imma screw you in your hole till your head spins like crazy. (To screw it back ofc.)

WHICH FUCKER CAME UP WITH THE IDEA TO DISABLE CTRL+A IN THE GOD DAMN SEARCH BAR!!!

I FRICKING APPENDED MY SEARCH 3 TIMES BECAUSE OF YOU

Just because I am a night owl and arrive late to your fucking meeting at 1100am, it does not mean I am shit head and trying to save out of office. Then why did you fucker shift my meeting an hour before and screw up my whole day. Fuck you asshole.

YOU DENSE MOTHERFUCKER!

If anyone read my last rant, I talked about how I wanted to buy a new phone with a subscription line, but they didn't allow me because "the system says you already have one and you're over due with the payments"

FUCKING MORONS, I don't know who coded the system but I will find you and bury your head in your own shit!

They use people's RFC (Mexican Tax ID number) to create an "account" and allow buying a phone. The ID it's composed by:

NNNNYYMMDDXXX

Where N are letters from our name, then they use our birthdate's year, month and day, finally they generate three unique characters to avoid ID clashes.

Well, this stupid fucker who coded the system thought it was OKAY TO STORE ALL BUT THE CHARACTERS THAT MAKE THE ID UNIQUE.

Fucking fucker...what were you thinking?

Modern approach to displaying dates is shit

I want to see a face of a fucker who decided that "5 YEARS AGO" has more meaning than exact date "15 Sep 2019". All apps that use that fucking retarded date representation are useless shit, worst UX ever.

Can you install Windows?
NO, I use Linux mother fucker

There is this project where the develop branch is "discontinued" because this moron "finished" a feature that is all fucking broken and I could not figure out how to solve all those merge conflicts...

I just gave up and told my stupid boss who just nods and laughs at everything... If it ever comes up I'm gonna tell them to get the fucker to solve it.

What the fuck! Just witnesed this at university. The guy in question is in the same cs course as me. Using edge, okay. But searching for a picture on google (a icon in that case), copy it to memory, open powerpoint, paste it, manipulate the color aellsettings to make it gray and then save it from powerpoint? That's not how you fucking do it! Fucker!

I'm having a strong urge to kill that asshole that asked me, on a SECOND interview for a SENIOR position if I knew what ORM was!!!
Are you making me fucking waste my time you fucking cunt???
Did you fucking read my CV?
Obviously not because you would have seen several ORM technologies on it you fucking piece of shit.

You made me waste my time, and now I have no choice but to slice your fucking throat!

I'll be waiting for you, in the dark you mother fucker.

Windows son of a bitch, motherfucker, moron, fucking dog, sister fucker, RAM fucker, PC fucker, fucking antimalware mother fucking shit motherfucker.

Me: I'll get it to you tomorrow.

Supervisor: (*Sarcasm abounding*) That's fiiiiine, thank you sooo much for all of your haard work.

Fucker, you have no idea. Learn to code before making comments like that, goddamit.

How can people don't even fucking try to see if there is a better way?

Fuck, I'm constantly even trying to improve my fucking bath routine for fucks sake and these brainless monkeys are gonna be stuck forever with fucking "right click-copy right-click paste instead of keyboard shortcuts" ( just an analogy )

Fuck that makes me angry...

College Senior Thesis is done. Wrote the whole fucker as a Spring Boot Microserivce and my brain is fucking jello after 4 straight months of work.

I need something lightweight, I need something fun to code as I wind down at the end of the year.
I think I'll play around with Node.js and Typescript and learn about this docker thing people keep talking about before I go back to Java exception hell.

I'm not ready to be a Jr Dev next year. I'm too young to work this kind of job for the next 40 years.

I mean, the developer just didn't even fucking care that the annoying menu is in the center of the screen, wtf (reader mode save me)

seconds into 2019

I see one incompetent fucker asking to eval in Node.js..
A FUCKING FETCH OF A NPM MODULES IN CDNJS

you know what's the reason?

node_modules

Fucking kill me unless you're some dumb bitch who uses npm modules like some braindead motherfucker who doesn't know what a number is, node_modules takes only an average of 3.6MB

Compared to RubyGems who takes 40+
Or Pip

Seriously stop this. I wanna hang myself because my 2019 put me in a shit mood

This fucker

HLSL, you little fucker

The bug I was searching for, for a few days now turns out to be a packed uint accidentally stored into a float variable

Not a single peep from the compiler, nothing

It doesn't even have warning flags like -Wconversion

What the fuck. Why microsoft. WHYYY

So I was excited about working on a proyect I recently was invited to work on, but when I finally got my hands on the code I felt this urge to scream "YOU FUCKER!!!" (the dev responsible for the code)

My boss just added a video about a product in a whatsapp group that has all employees asking everyone to spread it to your personal groups 'to promote it as much as possible'.

Well, fuck this shit their cringy-ass music video makes me want to bleach my eyes. And how does this fucker expects us to spread his cancer in our groups for his profit?
Also half of the people in the group are sucking his dick already with replies like "Sure ✌" and "OK sir!!! ".

Fuck you morons grow a spine and stop bending over so easily to make others happy. 😐

My friend is learning PHP and I told him to install xampp but that fucker went nuts and installed MySQL too which didn't allow the xampp's SQL and ended in conflict.
Oh man that's so funny when non programmers don't do what we say.

Today's my birthday... As usual, I worked in my office... At morning (approx 11:30AM) I received a call from my boss yelling cause a shit deadline and for some shit that I didn't sent to him (I already sent, the bastad was in vacation and didn't saw it)... His wife wished me happy birthday but the mother fucker didn't say a shit instead yelling during all day... Our relationship sucks cause he's a fucking bastard that doesn't know a shit of development process and I am done of his stupid shit... I fucking need to change my job!!!!

Just discovered that termux uses the volume down button as control... Mother fucker termux just became so much more useful!!!

I wondering what could possibly slow down our server app , Just found out there's one mother fucker who use async in every cases and async everywhere. Hey not all function are async!

Motherfucking cocksucking Microsoft windows. The worst software ever written by shittiest developers.

Mother fucker blowed up all the partitions ( Linux installation, root and /home partition ), including windows recovery disk.

I wish, your HQ will blow up the same way, someday.

Bill Gates .... Go fuck yourself with a iron rod

Every fucking day I'm asked some fucking stupid question that could have been easily figured if this fucker took 2 mins to look.

"Hey why isn't the issue closed with your commit message? Is it because the CI fail?"

No you dipshit. It's because it hasn't been merged into the master branch. And no the CI didn't fail. If you took 20 seconds to actually look into the pull request you'll see it passed.

God why?

Microsoft Market:
"You tried a wrong password too many times"
(I know fucker, I made a fucking mistake because I had to restart the pc 20 fucking times already, I've got confused, you pc-fucker)
"The activity is temporarily suspended, try later"

LATER? WHEN? I need to work you moron. Just give me a number!!! 10 minutes? 10 hours? days?
Work on improving security, lazy sod, not on slowing my job.

PS As soon as I can I'll change the password in "ImpotentCrackWhoreFucker8==0-)"

!dev

TL;DR: Computer rooms closed? Ok. Music rooms closed? Fuck!

I understand why the computer rooms are locked up in breaks and not accessible for every student anytime. But..

Why on earth are the music rooms closed as well?!

It wasn't always like that. But stupidass teacher Mr Fucker decided that he wants the music rooms (plural) for himself in breaks. That means they are both empty 90% of the time after 13:00 Uhr and in breaks. Closed. While I could play piano in my free time where I have to stay in school anyways. But no.

Fuck you, Mr Fucker.

So I had this client who wanted me to develop a brand new website for his company. When I asked him about the money he'd pay me, he said he'll pay me whatever it takes.

So I started coding JavaScript day-in-day-out, trying to show him different designs. He saw them and was pretty impressed by the progress. Then he fucking asked me to code sitting in his office so that it gets finished faster. I even do that!!

After 3 months of grinding, I asked him for my payment. That fucker stopped returning my calls and emails. He didn't even use my website. Then a month later I found that that fucker had called in a cheaper web developer and got his website designed JUST LIKE MINE!!!

I fucking hate freelancing!!

What is worse than React native? A crash in flutter ....

They need to work on their stack trace all it's errors lead to framework assertion failed, but which fucker in my code caused it....

No one knows, time to play cat and mouse with this thing 😒

My companies policy , you do your work