Loved the first project at the university. Your game had to load a map from txt file and create a labirynth with a player inside. It shoud include a bird's eye view and FPS-like - all using only console characters. There were some bonus points - for example for animation or built-in map editor. (language was C)

Hacker uses windows media player to hack into police database....

//Happens only in Indian movies

PS : don't try it at home.

What the end user sees...

Client: The media player is not loud enough... can you pump up the volume a little bit?
Me: Ok.

The year is 2025
vlcInstall.exe
"You already have videos, the trusted and safe media player for windows 10"
AtomInstaller.exe
"You already have vscode, the better and lighter editor for windows 10"
SteamInstaller.exe
"You already have Microsoft solitare, a fun, better game for windows 10"
*googles c++ tutorials*
"Try c#, safer and robust language for developers, oh and did we forget to mention use bing?"
*downloads arch iso*
"This file has been marked malicious by windows defender. Oh and we updated your bios to allow only windows bootloader. You're welcome."

Commit notes like this....

It's the time of the year again...
From the best media player in the world.

I just witnessed this interaction between my CTO and an intern. CTO was a good 30 feet away, so everyone heard:

CTO: *talking about some notepad or something* "I HAVE ONE IN MY DESK!"
Intern: **froze - afraid to go through his desk**
CTO: "TOP DRAWER!"
Intern: ..........
CTO: "GET IT, FUCKER!"
Intern: **blushing - gently opens drawer**
CTO: "KEEP GOING! PAST THE CANDY!"
Intern: "I ..."
CTO: "PAST THE WHISKEY!"
Intern: **softly** "I found it..."
CTO: "THAT WAS HARD!"
Intern: *starts walking back*
(player 3 enters the game) Director of Software: "BRING THE WHISKEY!"

Note: The intern was laughing, he is just a bit timid.

I truly love my job.

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

I make games, I don't do frontend fucking webdev; this isn't my fucking job and I don't fucking understand it. Fuck you, client with money. (Yes that is a CSS for beginners page, no I don't care. Screw you.)

Apparently this little music player has no transmitter, receiver, microphone nor camera, pity on you NSA!

If a teamviewer sessions counts as "screenshare", I've got a good one.

The company I'm working for also got an internal video player in the webfrontend of it's product. A customer called in, because the player "stays black", instead of playing his videos. It's a player for a media library of the customer, so it can be any content. A collegue did some trouble shooting, but since the customer was not very experienced in IT they arranged a teamviewer session. At the appointed time, my collegue called the customer and asked him to reproduce the issue, while watching via teamviewer.

When opening the media player, it stayed black indeed, so my collegue asked the customer to try another video. From my desk I heard my collegue say "Oh god, no" (phone muted) pretty loudy and he asked us to come to his place quickly. The customer decided, it would be a good idea to try the video player with gay porn. So we stood there around my collegues desk, watching a hairy man, getting his asshole licked by another an even hairier man for a few secs.

The customer stopped the playback, said "ok, maybe the other file was just broken.", thanked my collegue and the call was over.

We had a few similar cases.

WHAT DO YOU MEAN INVALID CREDENTIALS.
I JUST LOGGED IN WITH THEM ON YOUR SHITTY FUCKING WEBSITE YOU FUCKING INCOMPETENT PIECE OF WANK.
FUCK YOU YOU ARE THE WORST FUCKING CREDENTIALS SYSTEM I'VE EVER FUCKING SEEN; AND I'VE USED YAHOO

Actually Working Video Player Christmas tree :D merry x-mas

FUCKING PROJECT MANAGERS.

FOR THE LAST TIME, YOUR ALTERNATIVE IS UNUSABLE As explained the original proposal, and in comments THAT YOU FUCKING REPLIED TO AND AGREED WITH, the thing you want to use WILL NOT WORK. WHY ARE YOU SUGGESTING IT AGAIN?

FUCK YOU, YOU HAIRY-ARSED TWERP.

Also, dfox can we please have fucking anonymous rants!

Good job linux player 😍

Just like basketball player need good shoes, programmer deserve a better keyboard.

Definitely not show off. Just wanna say I'm a big fun of Cherry MX mechanical keyboard.

EVERY FUCKING DAY ANOTHER RETARD ON MY DOORKNOB WHO HAS TO TELL ME ABOUT HIS GREAT IDEA.

I GIVE A SHIT ABOUT VOICE ENABLED MUSIC PLAYER APPS. SO THAT YOU CAN CHANGE SONGS WHILE TAKING A SHOWER

NO ONE WANTS A GPS TRACKER APP FOR THEIR FUCKING DOG AND HOW DO YOU EVEN REMOTLY THINK THAT YOUR FUCKING DOG HAS BUILD IN GPS ANYWAY

AND NO WE WILL NOT MAKE BILLIONS AND TAKE YOUR 10% SHARE UP YOUR ANUS. YOUR IDEA IS AS WORTHLESS AS YOUR EDUCATION WAS OBVIOUSLY.

Installed new Ubuntu 17.10 on my Notebook and with that Terminus and an amazing music player called Harmony. It integrates all common streaming services e.g. SoundCloud, Spotify, YouTube and many more. And it has css theme and js coding support.

I swear 90% of people who apply for a dev job couldn't code to save their fucking lives.

Like wtf? You can't apply for a job as a commercial pilot, then turn up and announce you've never flown a plane before, so why is that accepted as being somewhat expected in development?

Fucking hell....

Why are devs so fixated on other devs' IDE, OS, programming style and chair choices??

Imagine if every sports player would comment on the way the other walks, bats, the colour of their shoes!

Devs are a bit picky don't you think?

VLC because it really is damn good. The only player which gives you a nice looking interface irrespective of the windowing system it runs upon - Gnome, KDE, XFCE, MS-Windows, Mac. And that 200% boost in audio is really helpful with files having very low audio.

Skype, on my laptop, updated the other day. It was like: 'Oh hey we're downloading skype for windows 10!', and I was like 'oh yeah? cool! ... wait, I'm not on Windows 10 WAIT WHAT ARE YOU DOING NO WAIT NO STOP'

And now it doesn't work. Yay!

Stay away from those LinkedIn recruiters who use words like: "Cutting edge technology" , "Geeks", "Top notch", "Team player" , "Esteemed organization" , "Ground breakers" , "Change the world" and any more of these shitty phrases!!

Sweet mother of butts, I can't believe I forgot about the Windows XP media player. Seeing it again I can't believe it ever existed.

A friend just said that "Coding is 90% knowing the theory, and 10% knowing/googling the syntax for a particular language."
Do you agree?

I am developer.

Discussing the design of our App, he asked me whether I have used tinder. I replied, "No, never had to..."

He laughed out hard and also told his colleague this joke.

I am a developer.
But... I am also a gamer, not a player 😎
I dont need tinder, I have Counter-Strike.

Okay, question;

Can I use ANY phone number in my game?

According to Wikipidia:
"Numbers between (555)-0100 & (555)-0199 are reserved for fictional use."
But.. I'm wanting to have a little phone pop up in my game that you can enter phone numbers into and text the corresponding player (and i hope to have more than 99 players) I would just have contact names, but I want players ti be able to dick around with other players.. Like, post their number to in-game telemarketers and such. What fo you think I should do?

If you don't let the company enslave you then you're not a team player.

Also, you're definitely NOT flexible!

hacking on windows media player ...time to leave this planet

Is there a mp4 player on linux than can play in mini view like w10? VLC got a limit on how small the windows is allowed

fuck me X'D Complained to nowtv that their player wasn't working because apparently it finds 'screen sharing' software running on my mac. This was their response

<video id="#player">
....

It took me way to long to realize why the queryselector failed

Fucking bruteforce man. Was supposed to go sleep when got few messages from my gameserver players that their accounts have been hacked.

Checked their logs, all of their accounts have been accessed from Russia. Told them to change their passwords and they told me their previous passwords which were easy af to guess.

Digged deeper and found hundreds of thousands failed logins in the last few hours and all of them from different ips.

Since I cant modify gamefiles on client side, the solution for now was to disable in-game registration and force player registration through the website form with captcha and also where each players login name gets appended with a random suffix chosen by player from a random list..

Fuck you bruteforce scriptkiddies, good luck guessing accounts now. At least I can sleep now.

Someone's having a bad day...

Writing a tic-tac-toe player in Prolog. So much fun solving a problem with only rules and no loop control 😍

Tried deploying a new nginx server today, wrote the site config manually.

"Alright, done! Let's restart the service and look in the browser how it looks"

# systemctl restart nginx
> Process exited with error code.
"Fuuuuck..."
# nginx
> Unexpected } on line 13.

# vim /etc/nginx/sites-enabled/thatconfig.conf
"Wait wtf.. there's nothing wrong with the curly braces.. they're all opening and closing as they should..."
*takes another closer look*
Line 12, missed a fucking semicolon 😑
Append semicolon, :wq, # systemctl restart nginx
Works like a charm 🙄 all because of a stupid semicolon.

Until now I thought that the semicolon jokes were just lame.. but damn you semicolon, you are indeed the superior hide and seek player 😅

So this just happened to me...

Started with planning to develop super Mario Bros. Using python.
Ended up with a music player which can play ogg (and mp3 files with 320 kbps bitrate) .
Why!?

Google can you fucking not just kill off random projects that still have a very active userbase!!!
I know you want to merge the play music streaming with youtube music. But that is no reason to kill off the default music player on Android. Cause, y'know, A FUCKTONNE OF PPL STILL USE OFFLINE MUSIC!!!!
And to add more insult to this, Play Music is a default app on pretty much all Android phones. This means it cannot be uninstalled at all. (Unless you root) So thanks for the waste of space!!!

Windows is probably good now...

And Real Player probably isn't buffering anymore either.

Still don't want to try either.

Finally fixed a major bug.....

FUCK YOU C# AND YOUR FUCKING CASE SENSITIVE BULLSHIT.

DAYS
THAT TOOK FUCKING DAYS AND AT NO POINT DUD VISUAL STUDIO BOTHER TO MENTION THAT FUCKING ERROR.

1 CHARACTER, ON ONE LINE, EFFECTIVELY BROKE THOUSANDS OF LINES OF CODE

fuck this, I quit. See you next time you contact the Microsoft live support chat!

1. Set your podcast player to 0.5x speed
2. Listen to your favorite dev podcast
3. Imagine they're all drunk
4. Profit

sudo rm -rf /home

Then realising you're not on your VM

Really unfortunate that we all just accept people being assholes because they're good at their job. I guess it's just the way the world is but personally I don't think you get a free pass to be rude just because you're a key player.

Life is short and whatever bullshit project for whatever dumbass company you work for is ultimately not that important in the grand scheme of things. Don't let your hyperinflated ego misguide you. Be nice to people.

Hacker's player: a music player that runs in the cmd

I had to create a c++ dungeon 2d game as University project.
The spec said "a terminal game made with char"
I and my team made a real game with anemies boss, and balanced stat in 15 days with Qt (we asked if can use external libraries)
We got 6/8 point for the project cuz we forgot to put protected/private the attribute of the player...

Reasons I don't get sleeping time:
Student
Programmer
Football fan from Asia
DOTA player.

Biggest? I want to create a full epic single player RPG that connects the players to the characters and leaves them with that empty feeling after they’ve finished it because the game was that damn good.

Tfw you don't even have enough points to deserve a face

:(

When I need to install Adobe flash player

FlashPlayer in 2017 lul

Partially relatable!!

Scenario 1
Friend 1:"Hey, you're good at computers right?"
Me:"Erm yup."
Friend 1:"Can you hack Instagram? I've lost my password."
Me:"Oh My God."

Scenario 2
Me looking at a friend's unity C# code
Me:"You know there's an enter key right? Why is your code horizontal not vertical?"
(Means that after a semi-colon he continues his code)
Friend 2:"I like to read my code in horizontal, that feels natural to me"
Me:"What ever, as long as it works. But why do you have so many if function inside another if function?"
Friend 2:"Cuz I want the player to do this while moving"
Me:".........."

Officially starting the transition from dual boot win10 to entirely Linux. REJOICE

Started reading the book "Ready Player One". Loving it so far.

Confession: I have an original Zune mp3 player, and use it. It has outlasted 2 smart phones I used as music players.

My new phone will (as a default feature) discover the devices that my housemate is using to stream content on the WiFi network - and let me control them.

Right now, I think he's getting ready for bed, but he left the player paused instead of turning it off.

Let the fun and hilarity ensue.

"Oh so you fix computers?"

Hey! You there!
Are you sick of windows 10 sending you intrusive reminders about updates? Are you tired of random unscheduled restarts? Tired of feeling like you have no control over your own computer?

Take back control!
DO THE FUCKING UPDATE, YOU FUCKING INCOMPETENT, USELESS, LAZY, PIECE OF DRY WANK!

Seriously guys: pick a time convenient to you, and take 5 or 10 minutes (when you're likely spending hours at your computer), and do them. Not only will you get rid of the annoying notifications, but you'll also keep your pc safe and secure by keeping up with security patches. C'mon people, it's really not that difficult.

And can we please, for the love of all things holy, stop the circlejerking? You're developers, you are the computer proficient. The only things a PC will do are the things you tell it to do. Dig deep, dig into the registry, dig into the services manager, dig into the fucking settings cos a good number of the most common complaints can be fixed in the basic options menu. Tell your computer to stop doing the things you don't like and it will stop.

It's really not hard!

Working for a company where the coworkers working 24/7 and the boss (ceo) expect me to do the same, even working on weekends.

But when i mentioned I have life distinctly personal and working life. But no, boss wouldn’t care much about my life anyway.

I got call names for being a not team player, not committed much , a thief (“ I paid you money but you didn’t work 24/7”) and they even claimed I don’t have heart to work.

It affect my personal so much that I can’t be happy even on the weekends. I got perturbed sleeps. Keep thinking of working .

Obviously they played well on guilt tripping me.

Well, my company hired a total amateur who can't do anything right on his own without copying code from me or the internet and I have to pretend he's helping in any capacity because otherwise I'm a "bad team player" and "should communicate more".

Helped me get over impostor syndrome, at least.

Playing Minecraft minigames.

It's a pictionary clone. One player draws a secret word while the other players have a minute to guess.

Along the bottom is a hint.

Hint is in "_ _ _ l e" format.

Possible word is apple, for example.

I already win half of the games.

I can win more.

Initiate cheating.

Python script that accepts input in same format as hint and returns a list of results based on the word database.

Any time I come across a new word just add it to the database.

Stopped at 69 words tonight.

Game on.

3 feet away from the bin
* throws plastic bottle *
* hits edge of table *
* barely didn't go in *
Coworker: Thankfully you're not a basket ball player 🤣

😭😭😭

Today we got a company announcement saying "Our time management tool got updated."

..still uses Flash Player.

For god's sake how is this even possible. Who did this?!

My lead developer has a tendency of saying "that movie fucking sucks" every time I mention a movie.

From Saturday to Sunday, I have seen ready player one a total of 6 times. If tomorrow I mention it and he says that it sucked I am gonna go ahead and Texas bitch slap him across the face with the power of Spielberg.

There is only so much trolling I can take my dudes. And I really fucking enjoyed the movie.

If you haven't seen it then please go ahead!!!

So i made a "mini player" which is inspired by the windows 10 mini player! it turned out better than i expected

I just wanted to watch that video! who on EARTH still uses adobe flash player! seriously can anyone tell me?

Haven't coded for a few days, returned to my github project to find one of my co-workers has gone through every single line in all of the scripts and added passive-agrresivd, sarcastic, comments about what they do.

Thanks.... I guess....

"We offer competitive salaries!"

Competitive as compared to what? The bottom 10% of salaries in this field? The top 10%?

I could say that I'm a competitive chess player when I'm competing against somebody who's never played chess before.

I'm sick to death of hiring people from other companies and explaining GitFlow and why its useful (what are you people doing?).

Then watching them doing it wrong, pointing out its easier to use something like sourcetree. Which leads to "... well see, the terminal is just more efficient, tools like sourcetree are bloated".

Ok fair enough, well heres the deal i'll make with you, while using your "efficient tool", stop breaking our workflow and i'm fine for you to keep using it. Otherwise, stop being a dick and be a team player.

I'm doing my own sci-fi D&D story and need some new weapons! So why not use programming names? 🤔

So far:
voidpointer
nullifier
destructor
finalizer

One player is also a dev and I want to trigger him as hard as I can 😈

We were participating in a competition once where our project was an accident detection sensor (it was a business competition). We took a broken mp3 player without cover and used it as the device while our laptop played sensor sounds.

We were the runner ups

I'm learning web development, and this is another small project that I made - a basic code player.
Used jQuery for the first time and realized how easy it makes things.

PS - I know it is pretty insignificant given that people here create much bigger things, but I'm proud of it!

PPS - Will post the previous small project I'd done. It was a browser based basic game.

"i need help my grandmother installed a fake flash player and it's installed norton and mcafee"

So... Nuke from orbit?

In order to reduce support costs, manager instructed his team to remove all logging/reporting of errors in the company’s CRM application.
Team’s support tickets went down 80%, manager received an award for his efforts, but mysteriously, DBA/support workload increased, bad/missing data,
increased support tickets in other areas of the business (shipping, etc. that relied on correct data from the CRM) and other side-affectual behavior.
Even after pointing this out this correlation, showing before/after code, no one believed the two were related and I was accused of not being a ‘team player’.
“You and the other teams need to learn from his example!”. As ‘punishment’ was I was moved to the team managing the CRM application.

This will be 4chan-r/greentext-ish in format. Also "me" is not me, PTH, it's referring to a game studio.

>Be me
>Be game studio
>Create event for weapon design
>Player base submit in a craptonna designs
>Holyfuck.jpg
>Create an internal service for voting
>Service doesn't check for vote except for a login
>MFW one submission has 6-digit votes
>MFW a lotta submission also start gain a lot of votes
>WTF.gif
>The vote count spiked
>Votebotting is here
>Ohshit.gif
>MFW I don't how to filter votes
>MFW I can't block rerouted traffics (VPNs, proxies, etc.)
>MFW the Discord server of the game gets vocal then Reddit.
>OhshitIfuckedup.mp4

!rant

I made internet radio player with raspberry pi. It uses IR remote controler and also play music from my collection. Pi is really usefull device. So happy.

I just wanted to make with the Spotify API an online player. I sat 2 hours and still can't figure out how to center a fucking unordered list which is horizontal aligned
FUCK CSS

Does anyone know of any good audio book sites besides audible? Free ones are good too, of course, but I don't mind paying for them.

Likewise for a good player, since books aren't music.

!rant
Anyone else use guake terminal?

I spent hours figuring out why my html5 video autoplay didn't work on Android. I muted it like they said, I tried many different ways to play it, even with a 3rd party video player, nothing worked. It's actually because my Google Chrome was on data-saving mode. Motherfuck.

I've discovered that working with artists on a videogame is the equivalent of the chapter when Homer asks for a wish to a monkey arm on the Simpsons.

- I want a png image of the player on idle position. And I dont want a 30000 x 30000 image, neither an image which half of it are transparent pixels, neither the image not to be centered or any strange thing ok?

*They send the image*

- Normal resolution, well drawn, no visual artifacts centered on the image...

*Tries to import it on the game engine*

+ Can't import .jpg format images

- FFFFFFFF#@€&£$$}•{^÷|CK!

This happened after a year working on the same project on the same engine with the same image format specifications.

Duck typing

If something quacks that does not mean it's a duck. A duck has wings, can fly and is renowned for eating bread. For all you know what you have is a tape player.

I wish people would stop using Electron for everything. It's like running an instance of a bloated web browser every time I open an app. Running Slack and Spotify eats a ton of ram, a chat client and a music player. I'm resorting to just running these apps as pinned browser tabs.

Why the fuck do apps throw tantrums as soon the phone looses internet connectivity?

HBO stops steaming and closes the player as soon as wifi disconnects, discarding the buffered data.

For Quora, it replaces loaded answers with a UI asking you to reload the page. Now, what am I supposed to do in the lift? Stare awkwardly at the lift buttons?

At what point did we decided bad user experience and arbitrarily discarding cached data is the way forward?

1) Using ScreenRecord record a video deleting his work folder(fake one obviously).

2) create command line vlc player to play this video on startup with flags -f and --no-qt-fs-controller

Eg. vlc -f --no-qt-fs-controller file://<file path>

Enjoy the show 👿

How to slack during work like a pro? (if you are a unity developer)

1- make a full screen youtube player inside Unity.
2- fill most of the screen with panels (debug, file browser... etc)
3- watch a video about overwatch or something.

enjoy!!

Client: my video player has two play buttons.
Me: ok that's weird let me check yes it does have two play buttons your right so turns out the client has taken a screenshot of another video player with the play button still on it and used that as their poster image hence two play buttons.

Finding it impossible to explain this to them arrrrggggghhh why why why

Joined a new project and started messing with the application...Greeted with a blank web page and a pop-up **please enable flash**

Fucking kill me. I've just agreed to make a shitty fucking app that would be better as a Webpage, using shitty fucking technologies I don't understand, to do a thing that would be better handled by a third party.
You know why? The guy who asked me to do it is a good friend, and I'm the "best (only) code monkey" he knows. FUCK MY LIFE.

At least I'm getting payed

So recently I needed to make a little Tic-tac-toe game with Node.JS for an university project. I previously learned Java and C# so Javascript as a non-compiled, script based language was something new for me.

Now during the programming process I reached the point where I needed to implement a function to change the player who's playing.

I was testing the game and... It seemed like the player was changed twice so it immediately switched back to the previous player.

Using a lot of console.log's I finally stumbled upon the error... (since Javascript or at least Visual Studio Code, I honestly don't know, doesn't have any kind of debugger or something).

Why the fuck does js allow to make allocations in if conditions?

I accidentally wrote one '=' instead of three '==='.

No error, no warning... Nothing.

Since then js and me are not friends anymore.

!rant.

Can we just show some community appreciation for @tahnik, I literally see them on everything I post.
Thanks dude!

! random story

Today i was cleaning my laptop and on right side of it i suddenly touched a button... !!!

!!!!SURPRISE !!!!

DVD player popped out.. and it's dusty as hell.. I was like what ?? How long this has been in laptop.. It's weird.. I never used it.. Why the heck we need it.. I didn't saw anybody holding dvd disc nowadays .. Man nobody uses those shit's anymore.. we have pen drives and External HDD's now. Why the heck manufacture's still keep these dvd player in Laptop's..

But it brought my childhood memories back though.. !!

Soon, Firefox will be the only viable browser. Google cracks down on adblockers with manifest v3, and all Chromium-based browsers are soon to follow, involuntarily so. Safari won't, but you can't make a Safari extension as easily.
Mozilla stated Firefox won't support manifest v3. This means adblockers will remain functional.

There is a fourth player though — Nyxt. They use WebKit, but they support Chromium-like extensions. Nyxt is built in Lisp and C. But Nyxt is an unorthodox browser to say the least.

The first PC I was exposured too. At the begining I was just playing games, but then I learned about BASIC and was intrigued enough to start typing the sample source codes which was listed in popular sience magazines.But when I run a simple pong game which was written as 2 player game and decided to make my first AI to play against me which at my first attempt got so perfect that I got not chance to win and then slowed it's reactions so I can actually enjoy playing against it and win some times... well that's the moment I got really hooked.

A centralised "music on hold" system. Powered by a PHP web service, and a raspberry pi in each clients office(s) to handle the "player". Essentially a distributed DJ system.

Code your own damn stuff!

I am building a RFID and button controlled music player for kids.
I am using a couple of different modules for that. The one for the input was really laggy. I thought it was so laggy because of the network delay. I tinkered with it a week but it didn't improved. So I just coded my own module which was much easier to do than I thought.
It was a really rewarding to code something yourself in less than a day instead of trying to get something working for a week.

Aint a rant, but pulsar player has the best fucking implementation of the material design ive ever seen, everything is perfectly flat and still alive aaah

"Pokemon Let's Go" review:

I knew it would be a very easy game, made to transition Pokemon Go players to the core series of games, but this game is just poorly thought out. The multiplayer was obviously an afterthought; there is no split-screen. When the other player goes off-screen, they are lost off camera. Player 2 cannot interact with anything: they cannot talk to people, collect items, or initiate battles (They walk right through Pokemon)

The game is too easy by design. You cannot fight wild Pokemon, so you end up having 6 Pokemon by the beginning of the game all at full health (And everything gets XP when you catch something, so most of your Pokemon will be up to level 6-10 by your first battles) and the opposition will only have one level 3-4 Pokemon.

This trend continues throughout the game.

The map is tiny. You could walk the whole thing in an hour. Even Gameboy Pokemon maps were larger.

I knew this going into it, but it only has gen 1, which means pretty much no Pokemon, and they're the ones that I'm bored of. Every shitty game starts with generation 1 pokemon then ever introduces anything else. I'm sick of pidgeys!

Plus the hefty price tag of $60 just makes this game not worth much, despite the hype they tried to give it. That's probably why they were to secretive about the gameplay before launch: they knew it was bad,

Winamp ⚡️ media player the coolest thing on the late 90's

A checkout application where, in the confirmation screen, everything (amount, references, currency, quantity of items, etc.) was sent to the client as a form, and they submitted this form to confirm.

...but there was no verification on any of the above. So any of the above could be changed and it'd collect whatever funds, and order whatever items, with whatever references you gave it.

This wasn't a major player in the space, but was big enough that most people would likely have heard of at least some companies using it. It's still being actively used today, and I can near guarantee not all the flaws have been fixed.

The process of making my paging MIDI player has ground to a halt IMMEDIATELY:

Format 1 MIDIs.

There are 3 MIDI types: Format 0, 1, and 2.

Format 0 is two chunks long. One track chunk and the header chunk. Can be played with literally one chunk_load() call in my player.

Format 2 is (n+1) chunks long, with n being defined in the header chunk (which makes up the +1.) Can be played with one chunk_load() call per chunk in my player.

Format 1... is (n+1) chunks long, same as Format 2, but instead of being played one chunk at a time in sequence, it requires you play all chunks

AT THE SAME FUCKING TIME.

65534 maximum chunks (first track chunk is global tempo events and has no notes), maximum notes per chunk of ((FFFFFFFFh byte max chunk data area length)/3 = 1,431,655,763d)/2 (as Note On and Note Off have to be done for every note for it to be a valid note, and each eats 3 bytes) = 715,827,881 notes (truncated from 715,827,881.5), 715,827,881 * 65534 (max number of tracks with notes) = a grand total of 46,911,064,353,454 absolute maximum notes. At 6 bytes per (valid) note, disregarding track headers and footers, that's 281,466,386,120,724 bytes of memory at absolute minimum, or 255.992 TERABYTES of note data alone.

All potentially having to be played

ALL

AT

ONCE.

This wouldn't be so bad I thought at the start... I wasn't planning on supporting them.

Except...

>= 90% of MIDIs are Format 1.

Yup. The one format seemingly deliberately built not to be paged of the three is BY FAR the most common, even in cases where Format 0 would be a better fit.

Guess this is why no other player pages out MIDIs: the files are most commonly built specifically to disallow it.

Format 1 and 2 differ in the following way: Format 1's chunks all have to hit the piano keys, so to speak, all at once. Format 2's chunks hit one-by-one, even though it can have the same staggering number of notes as Format 1. One is built for short, detailed MIDIs, one for long, sparse ones.

No one seems to be making long ones.

Cat-warming solution when the power goes out

Problem: Your power goes out in the middle of winter. Your cat is cold and will not leave you alone. You are her only source of heat.

Step 1: Find battery-powered laptop.
Step 2: Power on laptop and turn off sleep/hibernation in the settings.
Step 3: Open up 5 instances of Minecraft and load a single-player world in each.
Step 4: Close laptop and flip it upside down
Step 5: Place cat on computer above the fan. Cat will begin to purr.

(Yes this works)

Just remembered an old dad story:

Around 30 years ago I started a game on my Commodore 64, I was about 15 at the time, and back then you had to load the games from cassette tapes.

So I started the cassette player and waited for the game to load, and when it was done I stopped the tape. My dad saw this and he asked :

- "Why did you stop the tape if you want to play the game?"

And I guess it is kind of natural for someone who used cassette tapes for listening to music, to say that :-) Still I laughed at my dad...

Me: *adds a shiny new graph to our foos web app showing player ratings*

Fred: Can I please have a button to see just my scores?

Me: *adds "JUST FRED" button*

Fred: perfect, thanks

Handed over my first client's project today.

It was revamp for an internet radio site and also the first project that I used Bootstrap 4 in. On top of that, it was the first time I have to deal with PHP and its loops.

Despite audio player errors (somehow, they lost access to the streaming host and hence no audio source), I'm more or less satisfied with the final outcome.

But wait, why that stupid icon is not vertically centered?

Been watching The Lord of the Rings trilogy since yesterday for the third time in my life. I shed a tear at the end. That movie is as good today as it was 15 years ago. Awesome.

Now, to make this post relevant, im going to close VLC media player, open Android Studio and go on a Kotlin (which is becoming more and more like Gandalf the White) journey

YouTube is trying hard to shove their video suggestions into my face.

Video suggestions are on the watch page, inside the video player after playback, and even inside the embedded video player when paused.

Sorry, YouTube, I am not interested in your suggestions before I have even finished watching the current video!

Built a beautiful new fancy html5 page for a big event.
PM still wants to use the old flash video player.

Why the fuck ? Just no ...

So I got this shitty car of mine and a shitty radio, the radio stopped working, so what Im going to do is pop out the old radio and make a raspberry pi radio and media player for it.

Any suggestions or tips before I get started?

Playing 'old' Flash Player games is my new hobby, I think. Also I suggest "Fancy Pants Adventures" to ones that still play Flash games or like some nostalgia.

Respect to Flash developers, you guys are awesome.

Ad screen at the bus station, Padua

Just have just installed VMWare Player for a school project but had to uninstall it because our teacher was unable to put the right version on our share.

Now my Notebooks keybord driver is that broken that a simple reinstall over the device Manager couldn’t fix it!

FUCK

You have 2 options:

a) Work together with a "C player" (low skills/ talents)

b) Work alone

How would you decide and why?

recently made a mp3 player out of my raspberry pi 3 b+, trying to add a 16x2 lcd to it and as usual, failing to suceed 😂

!rant
Allow us to buy custom merch with our avatars on. I'd pay so much.

It was back on 96~97, using Pascal on a 386 for sure. But the program itself was probably a calculator. We want to learn how to make a program that would stay running on background to copy itself for other files, like a virus. But we didn't intend to build one. It was just to learn how to do that.

My first visual came some time later, on Win 95, made in Delphi. It were a music player, something like winamp.

Good times! :)

I will never ever see, play, or think about video games the same way again. Even playing all my childhood games is never the same.

I will now forever see the game from the inside out, imagining what code the devs might have written to achieve what is happening: sprites, audio, triggers, AI algos, etc. No longer is a player or character just a player or character; they're sprites, animations, classes and variables and method calls. o.o

I've been coding for a year and I can't even do hello world in javascript. I've never touched it. Is that bad?

If Google hadn't kill Google Play Music, I don't think a single soul would voluntarily switch to it's YouTube Crap Music.
If you remember prior to 2011 the initial plan of Google was to take market away from Apple's iTunes. They initially shipped Amazon music with branded Android OS before the development of Play music.

As a long term user of Play music I'd say "killing the product" was a "bitch move"!
Because Play music is doing really great and you could tell from its reviews and moreover the destination product is quarterly-baked not even a viable replacement in the least sense.
There are more than a million and one problem with YouTube music, currently you would notice your playlist history gets clogged up with your videos when you visit the video web. It's more like the actual YouTube app hiding behind a curtain to mimick a music player. Which is so so stupid and annoying!
As a user all I want from a music player is to fucking listen to music not to watch fucking videos... which makes the app unnecessarily filled with stupid options you never really need.
I understand that monetisation is necessary but please show some fucking courtesy by doing shit with wisdom!

Why do game studios force social/multiplayer in single player games?
Single player sandbox? How about we make it a multiplayer co-op?
Just fine 1 on 1 brawl? Hey how about you find a team and tag team? No? Too bad fuck you, no points to you for a whole fucking season.

Ugh.

!rant

What direction would you guys like to see devRant going in. I personally like it as it is, a place where developers can rant, share jokes (but not memes), share their thoughts, etc etc. But I know some people want it to go in more of a SO direction, where it's just another serious questions board. What do you guys think?

thanks.......

Me: "I wanna mod Ikemen so it can have tag presets, a replay recording manager, a player card for online games, a gallery,..."
Windows: takes a whole day to update
Me: "I wanna mod Ikemen so it runs on Ubuntu"

Ugh. Challenges. I need to create a 3D two player online game with the new HTML5 WebSockets, and I'm using a free 000webhost server which I barely have control over. Does anyone know how to connect two client connections together in PHP?

"Did you studied computers, right ?"
"Yes"
"Can you take a look on my dvd player? "

jetpack...

Epic fail. I use a sleep timer in my music player and it occasionally fails to stop and clear the actual timer. It even perpetuates through when I actually turn off my phone, which is rather quite impressive. This is what I find when I turn my phone back on after the weekend. I don't even know how it's possible to have still been going when my phone is off... 🤔

Official documentation that's out of date. And still being linked to by staff....

COUGHUNITYCOUGH

Me:
-Lack of experience
-slow learner/fast learner
-not really a team player
-always keep a positive attitude
-but when I started doing smthing, I'll finish it.
-willing to learn

I wonder if anyone would still hire me to their company.. Let me know.. I fucking hate my workplace and the owner. You hire me for doing smthing else, and you always told me to do smthing else that is not even related to my job. I'm not your fucking ass cleaner. = = you shit on that thing, you clean it yourself. Fucking fucking fuck!

- wake up
- check the news
- find some interesting video to watch [listen] to
- go get some breakfast
- heat it up in the microwave

*BT headset* stops receiving audio
*video player* stops receiving data via wifi

- write a rant in dR
*phone* sorry, wifi conn jeopardised, can't post

aahhh, the beauty of wireless. If only hostapd had a flag bypass_microwave_noise=1 for bgn APs

Anybody watches starcraft2 games??? You see Scarlett destroy SoS?

She should be in my daughters women role models. She just destroyed the best player in the world.

We need more chick gamers!!!!

Game development is a nightmare when your first starting out because you tend to neglect on keeping a small book on event notes.

Such as which event triggers what, and what events to turn off when the player starts the game.

You tend to get events that either don't start when player is far into game because you forgot to turn the event trigger on for something much for earlier in the game.

Live and Learn

If you ever feel like your code is useless, remember, someone made the “Jazz” equalizer preset on that cheap mp3 player you had in your childhood.

As if people ever chose something other than “Bass”.

Are there any good resources for embedding an music player on a modern website?

Wrote this on another thread but wanted to do a full post on it.

What is a game?

I like to distinguish between 1. entertainment, 2. games, 3. fun.

both ideally are 'fun' (conveying a sense of immersion, flow, or pleasure).

a game is distinct (usually) from entertainment by the presence of interaction, but certain minimalists games have so little decision making, practice, or interaction-learning that in practice they're closer to entertainment.

theres also the issue of "interesting" interaction vs uninteresting ones. While in broad terms, it really comes down to the individual, in aggregate we can (usefully) say some things, by the utility, are either games or not. For example if having interaction were sufficient to make something a game, then light switches could become a game.

now supposed you added multiple switches and you had to hit a sequence to open a door. Now thats a sort of "game". So we see games are toys with goals.

Now what is a toy?

There are two varieties of toy: impromptu toys and intentional toys.

An impromptu toy is anything NOT intended primarily, by design, to induce pleasure or entertainment when interacted with. We'll call these "devices" or "toys" with a lowercase t.

"Toys", made with the intent of entertainment (primarily or secondarily) we'll label with an uppercase T.

Now whether something is used with the intent behind its own design (witness people using dildos, sex toys, as slapstick and gag items lol), or whether the designer achieves their intent with the toy or item is another matter entirely.

But what about more atmospheric games? What about idle games? Or clickers?

Take clickers. In the degenerate case of a single button and a number that increases, whats the difference between a clicker and a calculator? One is a device (calculator) turned into an impromptu toy and then a game by the user's intent and goal (larger number). The second, is a game proper, by the designers intent. In the degenerate case of a badly designed game it devolves into a really shitty calculator.

Likewise in the case of atmospheric games, in the degenerate case, they become mere cinematic entertainment with a glorified pause/play button.

Now while we could get into the definition of *play*, I'll only briefly get into it because there are a number of broad definitions. "Play" is loosely: freely structured (or structured) interaction with some sort of pleasure as either the primary or secondary object, with or without a goal, thats it. And by this definition you can play with a toy, you can play a game, you can play with a lightswitch, hell you can play with yourself.

This of course leaves out goals, the idea of "interesting decisions" or decision making, and a variety of other important elements.

But what makes a good game?

A lot of elements go into making a good game, and it's not a stretch to say that a good game is a totality of factors. At the core of all "good" games is a focus on mechanics, aesthetics, story, and technology. So we can already see that what makes a good game is less of an either-or-categorization and more like a rating or scale across categories of design elements.
Broadly, while aesthetics and atmosphere might be more important in games like Journey (2012) by Thatonegamecompany, for players of games like Rimworld the mechanics and interactions are going to be more important.

In fact going a little deeper, mechanics are usually (but not always) equivalent to interactions. And we see this dichtonomy arise when looking at games like Journey vs say, Dwarf Fortress. But, as an aside, is it possible to have atmospheric games that are also highly interactive or have a strong focus on mechanics? This is often what "realistic" (as opposed to *immersive*) games try to accomplish in design. Done poorly they instead lead to player frusteration, which depending on player type may or may not be pleasureable (witness 'hardcore' games whos difficulty and focus on do-overs is the fun the game is designed for, like roguelikes, and we'll get to that in a moment), but without the proper player base, leads to breaking player flow and immersion. One example of a badly designed game in the roguelike genre would be Early Access Stoneshard, where difficulty was more related to luck and chance than player skill or planning. A large part of this was because of a poorly designed stealth system, where picking off a single enemy alerted *all enemies* nearbye, who would then *stay* alerted until you changed maps, negating tactics that roguelike players enjoy and are used to resorting to. This is an important case worth examining because it shows how minor designer choices in mechanical design can radically alter the final quality of the game. Some games instead chose the cheaper route of managing player *perceptions* with a pregame note: Darkest Dungeons and Amnesia TDD are just two I can think of.

- Lots of sport
- Energydrinks
- Long single-player gaming sessions.

!Rant
What languages do you guys most commonly use?
Do any of you use C#? If you do, what's your job?

As a gun owner and an avid FPS player, and one day (when I get the time) a builder of such games, please may I set something straight?

A===B
B===C
A!===C for some reason.

Ughhh, am I just being dumb?

Being a programmer is more like being a football player, as you approach mid 30s your game dips really low.

Dear BOSE, how can you make a "smart" speaker so dumb and complicated? Why require to use an app that needs frequent updates and takes up so much storage space for ... what exactly?
Dear Spotify, why not add features to the web player if your app does not run on older devices? Which native feature would your app need that is missing on iOS 13?
Dear companies making money due to the fact that some real artists make real music that real people love to listen to, how come your apps and gadgets always make me nostalgic about actual records and make me tune in to an actual radio station at the end of the day? At least you keep showing us not to rely on digital technology and rather go visit actual live concerts to listen to live music in the real world more often!

So this is a fun bug. Oneplus 5 with android 7.1.1, happens when switching from a fullscreen video (Netflix) to devrant

Is it true you can only do 1 rant an hour?

My presentation looks unappealing (LaTex magic) and apparently due to Adobe stuff, videos on overleaf don't play.

So, I have the choice of moving to another format (google slides of M$ powerpoint) by tomorrow, or switch between the media player and the presentation slides.

Both look... More unappealing than my presentation. 😒🙄😤

MPC-HC is a better media player for Windows than VLC. Change my mind.

As you grow older, both professinally as a dev and as a team player, you realise that a complete rewrite is rarely the better answer to the problem at hand.

With that being said, I'm rewriting the glorified-mass-of-infernal-human-feces-with-corn-bits-masquerading-as-mere-shit out of a production service right now. Wish me luck.

The MMORPG/Virtual Society from "Ready Player One" *_*

I never understood why updating iTunes prevents Xcode from running?

Why Xcode needs to be closed to update a music player? Do both rely on same files for reading connected devices?

Last night I spent 2 hours trying to explain probability to a drunk poker player.

He refused to accept that if Player A and Player B are flipping coins and player A wins 9 coin flips in a row, player B should still treat flip #10 as a 50/50 chance and bet accordingly.

This is basic logic, and when I tried to explain it in terms of computers and code he said "of course a computer would win but I'm saying that 51% against anyone I would win, I've been doing this for 20 years"

My brain hurts.

What the fuck is up with Facebook's video player. How the fuck does the biggest social media platform on the planet, fuck up something so important to it. The UX is garbage, autoplay is a cunt with it starting at maximum volume each fucking time. Fucking EllenTube is better than that fucking shit.

My dream project is a heavily story-driven game, with plenty of decision-making for the player and a lot of possible endings. With no money or time limits, I would make it with live action scenes. Just a great movie in which you have the final cut.

Auth0 and Okta merge.... Is Cognito the only other major player here? This merge now makes an Auth monopoly!

!rant.

I must say I love learning new things!!! Took a quick detour to build a small custom music player, now it doesn't seem to be that quick as I am learning a new framework. Only about 11 pages of many more still to go, and the funny thing? The main part I need - how to play audio, is in the last section of the tutorials.

Friend of mine wants to use his old blu ray player as a surround sound amp. Okay, sure it's supposed to have that functionality.

Struggle, struggle, struggle. Then I see on the back, a powered by Java sticker. Guess it's one of those 3 billion devices

Should I spend my money on a monitor? Sitting 30cm from a TV for so long isn't healthy, but monitors are soooooooo expensive?
I don't want to use my secondary monitor as primary because it's relatively small. What do we think?

Headsup: if you're making a game, or want to, a good starting point is to ask a single question.
How do I want this game to feel?

A lot of people who make games get into it because they play and they say I wish this or that feature were different. Or they imagine new mechanics, or new story, or new aesthetics. These are all interesting approaches to explore.

If you're familiar with a lot of games, and why and how their designs work, starting with game
feel is great. It gives you a palette of ideas to riff on, without knowing exactly why it works, using your gut as you go. In fact a lot of designers who made great games used this approach, creating the basic form, and basically flew-blind, using the testing process to 'find the fun'.

But what if, instead of focusing on what emotions a game or mechanic evokes, we ask:
How does this system or mechanic alter the
*players behaviors*? What behaviors
*invoke* a given emotion?

And from there you can start to see the thread that connects emotion, and behavior.

In *Alien: Isolation*, the alien 'hunts' for the player, and is invulnerable. Besides its menacing look, and the dense atmosphere, its invincibility
has a powerful effect on the player. The player is prone to fear and running.

By looking at behavior first, w/ just this one game, and listing the emotions and behaviors
in pairs "Fear: Running", for example, you can start to work backwards to the systems and *conditions* that created that emotion.

In fact, by breaking designs down in this manner, it becomes easy to find parallels, and create
these emotions in games that are typically outside the given genre.

For example, if you wanted to make a game about vietnam (hold the overuse of 'fortunate son') how might we approach this?

One description might be: Play as a soldier or an insurgent during the harsh jungle warfare of vietnam. Set ambushes, scout through dense and snake infested underbrush. Identify enemy armaments to outfit your raids, and take the fight to them.

Mechanics might include

1. crawl through underbrush paths, with events to stab poisonous snacks, brush away spiders or centipedes, like the spiders in metro, hold your breathe as armed enemy units march by, etc.

2. learn to use enfilade and time your attacks.

3. run and gun chases. An ambush happens catching you off guard, you are immediately tossed behind cover, and an NPC says "we can stay and fight but we're out numbered, we should run." and the system plots out how the NPCs hem you in to direct you toward a series of
retreats and nearest cover (because its not supposed to be a battle, but a chase, so we want the player to run). Maybe it uses these NPC ambushes to occasionally push the player to interesting map objectives/locations, who knows.

4. The scouting system from State of Decay. you get a certain amount of time before you risk being 'spotted', and have to climb to the top of say, a building, or a tower, and prioritize which objects in the enemy camp to identity: trucks, anti-air, heavy guns, rockets, troop formations, carriers, comms stations, etc. And that determines what is available to 'call in' as support on the mission.

And all of this, b/c you're focusing on the player behaviors that you want, leads to the *emotions* or feelings you want the player to experience.

Point is, when you focus on the activities you want the player to *do* its a more reliable way of determining what the player will *feel*, the 'role' they'll take on, which is exactly what any good designer should want.

If we return back to Alien: Isolation, even though its a survival horror game, can we find parallels outside that genre? Well The Last of Us for one.

How so? Well TLOU is a survival third-person shooter, not a horror game, and it shows. Theres
not the omnipresent feeling of being overpowered. The player does use stealth, but mostly it's because it serves the player's main role: a hardened survivor whos a capable killer, struggling through a crapsack world. The similarity though comes in with the boss battles against the infected.

The enemy in these fights is almost unstoppable, they're a tank, and the devs have the player running from them just to survive. Many players cant help but feel a little panic as they run for their lives, especially with the superbly designed custom death scenes for joel. The point is, mechanics are more of a means to an end, and if games are paintings, and mechanics are the brushes, player behavior is the individual strokes and player emotion is the color. And by examining TLOU in this way, it becomes obvious that while its a third person survival shooter, the boss fights are *overtones* of Alien: Isolation.

And we can draw that comparison because like bach, who was deaf, and focused on the keys and not the sound, we're focused on player behavior and not strictly emotions.

BRO HONESLY I JUS WANNA PLAY WHACK YOUR BOSS BUT NOOOOOOOOOO I HAVE TO A STUPID ADOBE FLASH PLAYER...........WHOOOOO TF HASA

I was trying out flutter because why the fuck not. I made a plan for an application the downloads an Osu!-beatmap file and extracts the infos relevant for an external music player (like background, the song file, title and so on)

So I designed a basic database scheme and decided to include the files into the database. 3 hours into development it hit me...

HOW THE FUCK IS THE EXTERNAL MUSIC PLAYER SUPPOSED TO GET THE AUDIO FILES WHEN THEY ARE IN MY DATABASE!

Guess I'll just have to replace the files with absolute paths instead. 😒

I'm going through my Udemy courses for the hell of it and see if I might even learn some things, started a course I knew would start of way too basic but Jesus Christ, 7 lectures for doing basic player movement and animation... Strap in boys, it's going to be a long ride

(Spoilers about Ready Player one here)

FUCK YEAH!
I watched Ready Player One in 4DX AND IT COSTED AN UNHOLY FUCKING AMOUNT OF MONEY!
yet it was THE BEST MOVIE Ive ever watched, AND I MEAN IT! IT WAS SO FUCKING GREAT! THE CGI THE ACTORS!
STEVEN DID AN EXCELLENT JOB!
and as a Trekkie I LOVED the scene of Hallidays death I mean his coffin WAS A FUCKING PHOTON TORPEDO! and in the Last scene you could see a bat'leth HOW HOW COOL WAS THAT!
And dont get me started on all the other References like the Holy Handgranade, Rubiks Cube, FUCKING BATMAN HELPING SOMEONE CLIMBING, Minecraft OASIS edition, Halo... I CANT ITS TOO MUCH!

Working on a poker card simulator. Currently benchmarking the hands by giving them a rating (high card value, pair).

In the simulation there are three players. The first player who get the hand cards first seems to have advantage. Does this make sense?

I was in a meeting yesterday where a junior dev was pitching an idea for a mobile game. He starts explaining the rules of the game. Here's what he said "Each Players starts off with 5 BALLS 🏀 and when 1 players ball is hit said player loses 1 BALL…" His presentation was excessively laced with mentions of BALLS.

PS: Never pitch a BALLS idea unless you've got BALLS.

Came across a player called Root in Overwatch today, would that be you, @Root, by any chance? It's not exactly a common name.

!rant
Playing Battle Royal with friends, had to leave 2 of 4 teammates behind as the play area was shrinking and they couldn't be rescued. The 4th player ran me over with a game car just to get revenge for our other team mates.

With me alive we actually had a fighting chance to win the round. (8 kill streak and lots of ammo with a decent tactical position) ....but NOoo the fucker thought it more sweet to kill me rather than help me win the round!

Fuck this shit, I'm out!

Dungeons and dragons, I am the dungeon master for two games and a player in one. Great laugh if you can get everyone in the same room with lots of booze 😁

So I'm writing a function in Unity3D that walks a rectangular grid. At one place in the code, I got the x+y coordinates backwards, which caused the function to infinitely loop between two coordinates.

Not seeing a way to kill the loop, I looked it up on Google. The suggestions I get are. . .

1. You need to kill the Unity3D task and lose your edits because the environment and the player run on the same thread.
2. You can pay ten bucks for an extension that lets you break out of infinite loops.
3. You should really avoid writing infinite loops. That's just bad form.

SERIOUSLY?

My machine is running on a 6gb ram with an Intel core i5 processor. How the fuck are my .mkv files still stuttering on VLC?!? 😣😣😣

Have to change out the audio player on a WordPress site for a podcast. Can't follow the code properly because wp forgets that standards are a thing. Code readability is shit as well. Fucking WordPress.

Whaaaat? That used to be my default audio player for local music 😠. I'm not going to upload my mp3 file collection to YouTube to be able to listen to them at work...

Stuff I need to finish:
PHP framework
Music player for android
Nginx module for crypting mp4 fragments
Personal blog engine
Unit and data converter service
Personal transactions application

Too much, just too much...

git
Linux
VLC media player
Inkscape
LibreOffice
Metalsmith js

100's of low-level NPM packages I don't know the name of

I bought a $1 Steam game called Square Brawl some 5 years ago. It's a minimalistic arena battle with forgiving physics, diverse and satisfying weapons and a geometric design based on squares.

It's among my favourite couch multiplayer games, but the programming is shit. The resolution is weird, the launcher is some default config screen that came with the game engine, with a controller it's tricky to avoid picking a second color by accident which spawns a ghost player that is jointly controlled by the AI and the player. Sometimes the game spawns 10 copies of everyone, all of which you control at the same time. Getting stuck inside walls is commonplace.

On an unrelated note, I'm making a minimalistic arena battle with forgiving physics, diverse and satisfying weapons and a geometric design based on squares. It's gonna be FOSS and web-based. I haven't settled on a name yet but I think Tetragon Tussle might be good.

In this game I'm making for class my player was moving opposite of the control pressed... So I multiplied the movement values by negative 1

!Rant
Should I buy a devduck?

In high school for an assessment we all had to make a simple game and we to plan it first and then program it. In the planning stage we had to list variables and functions used and whatnot I'm my planning sheet I was given I had "variables modified by user" which basically meant data inputted buy the user stored in a variable with only one player name variable listed in it and everything else in my game was being computed another runtime and my CS teacher told me I didn't have enough user inputted variables and I explained that it didn't need any more she said "so you're telling me the user enters their name and the the game just plays itself?!!! " :|

My setup, seeing that people are posting theirs.
+ BenQ 22" monitor
+ Custom-built PC
+ Fried i7 motherboard :(
+ Working i3 motherboard
+ 2 Green fans (top, back)
+ 2 Red fans (front)
+ (not-working-well) CD/DVD disk
+ 2G WD hard drive (not SSD :( )
+ 4-port USB 3.0 hub
+ SD card reader (with 3 more storage devices it can read)
+ Webcam
+ HP DeskJet Ink Advantage
+ Horrible mechanical keyboard
+ Special keys (music player, play/pause, next/prev, etc.)
+ Mouse that doesn't stop glowing
+ Awesome speakers
+ 4 lights
+ Water jumps through the lights whenever audio rises
+ Xbox 360 S (2G internal storage: Ugh)
+ Speakers connected to Xbox 360
+ Desk Lamp

Software:
+ rEFInd
+ Arch Linux
+ Plymouth
+ Systemd
+ i3-gaps (Me)
+ GNOME (full) (for rest of family)
+ NeoVim
+ XTerm
+ Cmus

To the developers that still use flash player for their games, fuck you.
My grandma wants to play some games and i can't fuckin make it work since your piece of shit games still use that piece of shit flash that in 2 years will be dropped fuckin scumbags. And now i'm trying to find a way either to explain to her how retarded you are or find a browser that supports this piece of shit.