Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "why you so hard"
-
Boss: I need you to start on this new project, how long will it take?
Me: well, hard to say with no specs whatsoever...
Boss: just your best guess
Me: 4 to 6 month I guess?
Boss: so 3 months it is. When can you start?
Me: no specs, sir...and I said 4 to 6
Boss: the specs are almost ready, I know you can simplify it
Me: ...
Boss: just start with the basic infrastructure already
(4 months later)
Boss: here you are the specs, they might change a little in behaviour and design, but all the main stuff is here
(Hands me a A3 with a total of 21 pictures in InDesign)
Me: o....Kay. what happens when I click here?
Boss: oh, we should still talk about the app workflow, I'll get you updated
(2 weeks and 16 total rewrites of the "specs" later)
Boss: you told me it was a 2 months job, why aren't you finished yet? We must deploy in 3 weeks!
Me: ...34 -
I don't understand why every non-technical person who comes to do work in my apartment messes up my fucking router.
The cleaning lady - multiple times knocked the antennas partially off. Like fucking clock work. I don't get it, why is the cleaning lady attracted to my router antennas and why does she need to be so hard on them? Whatever.
The most ridiculous episode was today. And it wasn't the cleaning lady. I had a few people here doing some work today and the woman in charge who was here informed me before that they might have to move the furniture "a little."
I come home, and like a bad omen, the plastic parts on BOTH my router antennas are missing. Completely gone. It's just the the wires. Now, the router still works fine in my tiny apartment, but it is a fancy Asus router (I learned the hard way not to buy cheap routers) and I'd like it to not have fucking wires as antennas.
I email the woman (paraphrased):
Me: hey, it seems the antennas got knocked off my router, do you have any idea where they might have went?
Her: Apologies if we didn't put everything back (no shit you didn't, that's why I've had to email you). If we knocked the antennas off the router (fucking "if"???? I literally just told you in my email that they were knocked off) , they are probably somewhere by the window on the floor (they weren't).
And I still haven't found them. Why the fuck do these people seemingly attack my router? I can't figure out what it is about it. You would think people would be more careful around electronics but naaah. Anyway, going to go keep looking for my router antennas.43 -
So, since I hear from a lot of people (on here and irl) that Linux has a 'very high learning curve', let me share my experiences with the first time my dad touched Linux (Elementary OS) without me interfering at all! (keep in mind that he is very a-technical)
*le me boots the system* (I already did setup a user account for him and gave him the password).
Dad: *enters password and presses enter*
Me: "Hmm that went faster than expected."
Dad: "Uhm I know how to login son, it's not that hard and pretty obvious".
Me: "Alright, why don't you try to open up the default word documents editor on here! I'll be right back!"
Me: *Goes away and returns after a minute*.
Dad: *already a few test sentences typed in LibreOffice writer* it's going pretty well :)!
Me: "Oo how did you find that?!"
Dad: "Well, there's a thingy that says 'applications' so I clicked in and found it in the "Office" section, do you think I am blind or something?!"
Me: 😐. uhm no but I just didn't think you'd find it that quickly. Now try to install Chromium browser! *thinking: he'll fail this one for sure* I'll be right back :).
Me: *returns again after a minute or so*
Dad: *already searching for stuff through Chromium*
Me: "wait, how the hell did you do that so quickly, it's not the easiest thingy for most people".
Dad: "Jesus, it's not that hard! I went to the application browsing thingy, typed 'software' and then a sorta software store icon showed up so I clicked it and it opened a windows with a search bar saying something like 'search for applications/software'. clicked in it, typed 'chromium', saw it coming up, there was a very clear 'install' button, it asked for my password, I put it in and after a little it gave a notification that it was installed. Then I went to that application browsing thingy again and typed Chromium. Then I hit enter because it selected an icon called chromium...."
Me: O.o. Okay this is going very good, now open an email client and login to your email address!
Dad: *goes to application browsing thingy, types 'email', evolution icon shows up, dad clicks it, email address setup steps show up and dad follows them quickly. After about a minute, everything is setup.
I expected this to be a hard process for someone who dealt with Windows his entire life but damn, I underestimated it.
Asked him if he found it easy/what he liked about it:
"Well, it's very clear where I can find everything, default browser/email/word document editor programs are easy to find and that's about all I need so yeah, great system!"
I am proud of you, dad!77 -
I put a lot of work into trying to explain to you muggles what I do all day in a way you can understand (it's hard, trust me) and you still reject it as boring nerd crap. I'm sick of it! What if you told me working at that restaurant is "putting water on plates, wiping it off, and putting meat and cheese between slices of bread" and I said "wtf is that, and who cares?" Wouldn't that hurt your feelings, that I didn't even attempt to make a connection with you, friend? That I didn't even attempt to step outside my experience to meet yours? Isn't it equally insulting how far you have to dumb it down, just for me to lose interest entirely? And yes, I know that's not your specific task. That only proves my point further.
And why, exactly? Conceptually, you handle pre-digested poop all day.
_I teach plastic to think._ Sometimes it even thinks better than you do.
How is my job less interesting?
And what's more, why does EVERYONE seem to think so?
How do you expect people like me to keep your iPhones, bank accounts, and self-driving cars working if you alienate us like an alternate species for building those things? I mean really. You people treat us with a disinterest harmonious with homophobia. "Don't ask, don't tell." Except you do ask. And then you condescend as if working with my brain makes me less worthy of your attention than your exciting minimum-wage restaurant job.
Have fun with that, by the way.
Oh, and you're welcome for <object I fixed that wasn't really broken>. Maybe next time, just google it.
I know you won't.24 -
Meeting with smooth suit guy:
"So, our company has pivoted"
I hate everything about this guy, not having slept well at all, I fucking snapped:
"Pivoted? Oh wow, what a wonderfully refined word to describe that your asinine business model smacked flat into the mud, that your obtuse bubble of vague ideas popped and your childish dreams of piles of undeserved gold got caught up by the hard reality that your product does not add any tangible value -- yet you tricked your sheepish retarded investors once again to fall for a new hype-filled pitch deck? Congratulations. At least you probably snort enough coke to keep believing in yourself..."
The guy nervously wiped his nose, stuttered, and walked off looking angry and a little confused.
So it turns out, my boss is apparently the major "sheepish retarded investor" in this company.
Today I got a mail from him. I expected fire and fury, nuclear ICBMs crashing into my desk.
"Thanks for your feedback, this is why I invite you to meetings. Could you take a look at their new pitch slides and preliminary API docs for me?"15 -
Biggest hurdle: torn between having boobs and missing an arm. I swear some people are under the assumption the brain is in the arm.
I am fully capable of building your network, resolving your outage due to your faulty code, can even tell you how many users your database can support at once. I don't need arms for that. Nor do my boobs distract me that badly.
"but men are going to make your life so hard" yup. And that's true no matter where i go
"all that typing with one arm can't be good for your back" welp. Find me a job that doesn't require a computer. Or manual labor. If you think typing will fuck me up, that's DEFINITELY out of the equation
"you're too pretty, there's no way this can make sense" dafuq you just say?!?!
"why don't you just stay home on disability, I'm sure you qualify, you wouldn't need to work" I'd rather be a fucking trophy wife if I'm staying at home. Fuck that.
And many more.
Sometimes they're fun. Give me more dumb arguments to counter? ;)55 -
Friend: Hey, can you fix my laptop? The hard drive is almost full.
Me: (Looking through his folders) Maybe it's because of this. Why do you have 3000+ files in your downloads folder? Maybe I should delete some of this.
Friend: No no, please don't touch the downloads folder, I have some very important documents there.
Me: Why don't you move them to a separate folder then? You should organize the ones you actually need and delete the rest. This folder is a complete mess.
Friend: No no, the problem is not the downloads folder, there must be something else. Can't you just uninstall some programs to free up space?
Me: I could, but I don't know which ones you actually use.
Friend: What? You should know!! You studied computer science for this!!
Me: First of all, there is not a single class in the whole 4 years of university called "How to uninstall programs and free up space on 128GB hard drives of shitty €400 computers". Second of all, I don't know why you were expecting me to find a magic button on your laptop that immediately frees up all the space in a hard drive without actually deleting anything. That's not how computers work, you know.
Friend: Hey if you didn't want to help me you could have said so in the first place.
Me: FML18 -
We were talking about harddrives at work when someone was wondering if filling them with helium would make them spin faster... Then imagination took over!
"But helium balloons float, right... So would helium filled hard drives float..? Probably not due to weight but imagine dropping a hard drive and seeing it float towards the ceiling.."
"John, the delivery guy has a box with new harddrives downstairs, could you go get them?
*shouts* John did you get them? Just don't open the box outside!! No, no, NOOO DON'T OPEN IT OUTSIDE! JOHN, THE HARDDRIVES, BE CAREFUL, DON'T OPEN THE BOX OUTSI.....
*harddrives floating by the window into the air*
NOO, JOHN, WHAT DID YOU DO?!
"*walks into the office, harddrives floating against the ceiling* goddammit John, not again"
"John, why are you putting one kilometer long cables on those harddrives?
*John let's them float into the air towards the clouds*
We offer cloud storage!"
(We have a usual office building ceiling)
"John, I need a 1tb harddrive, where are those?
Uhm... C12!
*takes a ladder and walks towards c12 to pluck one from the ceiling*"
😆6 -
Not a specifically dev related story, but absolutely rant worthy.
Today I was working from home, and my wife called me to tell me that some awful person had thrown a young cat into the dumpster at her work.
To that person - you are a scumbag. You’re lucky no one left you alone in a hot car as a kid, let alone a dumpster. Seriously, why? Why is it so hard to take it to a shelter?
Anyway - I went and bought a whole bunch of cat stuff - I grew up with cats but I’ve never had one on my own. We’re at the vet now. I think we’ll name her Curry (after Haskell Curry, and lovely spicy dishes).20 -
Storytime!
This customer comes in and practically throws a computer on the counter.
Customer: This computer isn't working. I've ran the diagnostics and it says it's software. *places a dvd case with a 32 bit Windows 7 disk in it on the counter* It had Windows 10 on it, but I want Windows 7 on it.
Me: Well, you may have issues with the drivers if you put Windows 7 on it--
Customer: I don't care, I just want Windows 7.
Me: You SHOULD care. That means no wifi, no display, no mouse... Windows 7 doesn't like Windows 10 hardware.
Customer: Then... check to see Windows 7 compatibility!
Me: Alright.... *makes notes to check for Windows 7 compatibility*
Me: So has this Windows 7 been used before?
Customer: Yes, it has.
Me: On how many computers?
Customer: I've installed it on two computers and it works just fine.
Me: That's weird because Windows license keys are for one computer only. Are both of them connected to the internet?
Customer: Yes.
Me: Well, okay then... *finishes up ticket*
Customer: I work in this field and I just don't understand why they don't come with the disks anymore. How much is a Windows 10 disk?
Me: *gives price*
Customer: And do you have any?
Me: Let me check *I go to where they are, find some and come back out*
Me: Unfortunately we're out at the moment and would have to special order some back in.
Customer: OK. So then how much to fix this computer?
Me: *price of installing Windows and backing up data*
Customer: That's halfway to the price of a new one of these!
Me: Well yes, an HP at Walmart... But you do have that option if you want to take it.
Customer: Well, why does it cost that much?
Me: Well, it's $labor1 to install Windows, $labor2 to do some basic setup and drivers, and $labor3 to backup and restore data.
Customer: Oh, well I don't want data.
Me: Okay, well then it would be $total - $labor3
Customer: ...Okay, fine
Me: *updates the ticket*
When she finally left I put it on the bench and the first message said "SMART ERROR." I then did 4 different tests that said "lol, the hard drive is failing."
If you "worked in this field," you would know that a SMART error is hard drive related.
If you worked in this field, you would know that Windows is only a 1PC license, so why are you lying about installing it with no issues on other computers?
If you worked in this field, you would know you would want a 64bit Windows on your computer.
If you worked in this field, you would know how to find a Windows 10 installation media online.
If you worked in this field, you would know that HPs are not good computers to get.
IF YOU FUCKING WORKED IN THIS FIELD YOU WOULDN'T BE SUCH A FUCKING CUNT.17 -
So Last year December my cousin see's me making a basic 3D game in Unity and says he wants to do programming.
Me: No, you don't want that. Become a doctor like your parents want you two.
Him: I'll do it.
Me: Ok. If you want to suffer, i'll teach you some basic C#
Me: *Shows him basic C# code in visual studio*
Him: *Not paying attention* Cool. When can i make games?
Me: That's not how this works. Where do you intend to study?
Him: M.I.T!
Me: You better get your ass infront of that fucken computer, google and youtube the shit out of you, matter of fact i'll get you a shit bucket so you don't have to get up.
Him: I don't have to go so hard now, i'm only 16.
Me: *Facepalm* That's why you have to do this now.
...7 months later...
(Yesterday)
Me: Show me how you make a basic calculator application.
Him: I don't know how to do that, you didn't show me.
Me: *laughing*
Him: Whats so funny?
Me: You're screwed *still laughing*
Don't get me wrong. He's a smart kid. Just needs to fucken do something if he wants his goal.12 -
Had a client on the phone with an extremely heavy Turkish (I think so, not entirely sure) accent who was hardly understandable but I kept polite and tried really hard to understand his questions.
Didn't go so well and he started to get annoyed and rude as well and asked me why I kept asking him to repeat his questions.
Told him that due to his heavy accent I had some trouble understanding him but that we'd take it slow and that I was trying my best.
He didn't take that well and called me a fucking racist (or, a 'cancer racist (dutch: 'kanker racist') but this sounds nicer).
C: (remember, heavy accent) "Ben jij kanker racist ofzo?" (are you cancer racist or something?)
Me: sorry, kan je dat herhalen? Ik verstond je niet helemaal goed door het accent, excuses! (Sorry, could you repeat that? I didn't quite get that due to the heavy accent, apologies!)
*BOOOOOOOM*
Client exploded in my ear xD.
Totally worth it! I'm all for helping and tried my best but if you're going to disrespect me, fuck off.8 -
This is just my token of appreciation for the Skype devs. Can't begin to say how much I hate it. Your android app is a joke even after a host of updates, your desktop client is an even bigger joke (atleast Linux Beta version, I know betas aren't supposed to be stable but this is ridiculous).
You have reinvented chat clients to be extremely bulky, cumbersome and very hard to sync across devices. And you have managed to make it "buffer" more than a YouTube video does on a 2G network. I for one, am blown over by how you did that. And to top it all, you can't close the client on Linux atleast! All you did is just override the close button so that it only minimises it. Brilliant piece of work right there!
Why the hell can't you just close the client and run it in the background the proper way like everyone else does? Why does it have to take 20 *** seconds to open a message? The only reason I am stuck with this is some wierdos in the office still only use this. Get your shit together 😡
Ahh.. I feel much better now.18 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
*Overhearding Convos*
A : "Dude, have you tried vim? It sucks!"
B: "I know right, why do they have to make it so hard to use..."
Me whispering : Git Gud Boi...10 -
1. There are 10 types of people in the world: those who understand binary, and those who don't.
2. How many programmers does it take to change a light bulb?
None. It's a hardware problem.
3. A SEO couple had twins. For the first time they were happy with duplicate content.
4. Why is it that programmers always confuse Halloween with Christmas?
Because 31 OCT = 25 DEC
5. Why do they call it hyper text?
Too much JAVA.
6. Why was the JavaScript developer sad?
Because he didn't Node how to Express himself
7. In order to understand recursion you must first understand recursion.
8. Why do Java developers wear glasses? Because they can't C#
9. What do you call 8 hobbits?
A hobbyte
10. Why did the developer go broke?
Because he used up all his cache
11. Why did the geek add body { padding-top: 1000px; } to his Facebook profile?
He wanted to keep a low profile.
12. An SEO expert walks into a bar, bars, pub, tavern, public house, Irish pub, drinks, beer, alcohol
13. I would tell you a UDP joke, but you might not get it.
14. 8 bytes walk into a bar, the bartenders asks "What will it be?"
One of them says, "Make us a double."
15. Two bytes meet. The first byte asks, "Are you ill?"
The second byte replies, "No, just feeling a bit off."
16. These two strings walk into a bar and sit down. The bartender says, "So what'll it be?"
The first string says, "I think I'll have a beer quag fulk boorg jdk^CjfdLk jk3s d#f67howe%^U r89nvy~~owmc63^Dz x.xvcu"
"Please excuse my friend," the second string says, "He isn't null-terminated."
17. "Knock, knock. Who's there?"
very long pause...
"Java."
18. If you put a million monkeys on a million keyboards, one of them will eventually write a Java program. The rest of them will write Perl programs.
19. There's a band called 1023MB. They haven't had any gigs yet.
20. There are only two hard things in computer science: cache invalidation, naming things, and off-by-one errors.10 -
I hope you will forgive me for a third hand story, but I'm one of those evil developers, not a support per se. But I thought you'd enjoy this story anyway. So this happened to a colleague of a colleague:
$Hero - our hero. $Cop - A representative of our hard worked law enforcement agency.
So $Hero is happily speeding along in his car, running a few yellow lights a bit late, etc. Finally, the law catches up to him and pulls him over. Here's how the conversation went:
$Cop: Can I see your driving license, please?
$Hero (with smug grin): Certainly. Here it is, officer.
$Cop takes license back to motorcycle and speaks into radio.
$Hero: It's not going to help you any, though.
$Cop (with no reaction): What do you mean?
$Hero (with wider grin): The server you have to check it against is down.
$Cop (still no reaction): And why do you say that?
$Hero: Because I'm the guy they called to get on site and get it up again.
Our hero did not get a fine this time. Instead he got a police escort to his workplace.
Source: reddit r/talesfromtechsupport3 -
Got basically nothing done yesterday because I was absolutely exhausted the entire day. Thanks, doxxing thread. But I couldn’t sleep anyway so whatever.
Told everyone at home that I wanted a really productive day tomorrow (today) because of it.
Guess what happened?
Endless fucking distractions.
Because of course.
• Cooking since apparently it’s my job.
• Extended computer repair and maintenance, since that’s apparently my job even when it’s not my computer.
• Conversations.
• Children following me.
• People paraphrasing politics.
• People summarizing stupid fail videos.
• People relating stupid prank videos.
• More conversations.
• Endless random nonsense comments from children.
• Endless noises from children’s toys, tablets, playing, etc.
• Children following me when I leave.
• Taking half an hour to order food instead of five minutes.
• Cleaning since nobody else ever does.
• Picking up toys since nobody else will and I’M FUCKING TIRED OF STEPPING ON AND TRIPPING OVER THEM.
• More fucking food prep.
• Endless random nonsense comments from children.
• More conversations.
Is it any wonder I’m so fucking pissed off every workday?
I can’t wait to move so I can have a fucking office with a fucking door and a fucking lock. And you know what? I’m going to splurge and install some fucking soundproofing, too.
WHY IS IT SO FUCKING HARD TO JUST LEAVE ME THE FUCK ALONE!? I’M PAYING FOR YOUR FUCKING EVERYTHING. FUCK THE FUCK OFF!19 -
Recruiter: I see you got a good degree, however, what were your high school results (A-levels)?
Me: why would you need them?
(they were average, but I tell the recruiter)
Recruiter: Oh, so you were pretty lucky to get a good degree.
Me: No... I worked really hard for it.
Recruiter: Anyway, my client only deals with people who got high grades in high school.
What the fuckkkkkkk?
#stopthismadness20 -
Uncle- What do you do?
Me- I'm a software engineer
Uncle- My brother's friend's son is also a software engineer.
Me- (so what am I supposed to do about it?) yes that's nice
Uncle- I have a great idea, u should implement, I'm just telling you, it is a revolutionary idea
Me- (oh fuck, not again) yes tell
Uncle- you should make a matrimonial site which tracks what people do on internet and tell their to-be-spouses about it
Me - (yeah, I'll get sued for breach of privacy, and it has got nothing to do with my current line of work, and will probably cause divorces before marriage) yes great idea uncle
Uncle- see I told you this billion dollar idea, u should do hard work and make it
Just WHY in god's name do all uncles think laptop is a magic box in which I just have to type their idea in and it will spit out a website/software in 2 minutes. I don't go around advising them about their line of work.11 -
!!rant
!!ANGER
Micromanager: "Hey, Root!
Since you're back, and still not feeling well, we have an easy ticket for you: Rewrite the slack integration gem! Oh, you don't have to re-implement all of it, just make sure it all works the same way it does now. That bitch you worked with once over a year ago who kept throwing you under the bus to management and stealing credit for your work? Yeah, she wrote the original code like four years ago. It's perfect, so don't touch it. but she can fill you in on all the details you need and get you up to speed on how to test it.
But yep! It should be simple. and I just knew you would love this ticket, so I saved it just for you. Nice and quick, too, to get you an easy win.
You know, since you have to repair your reputation with product. and management. and the execs. and the rest of the team. and me. Yeah, product doesn't trust you so they don't want to give you any tickets. They just can't trust you to get them out and have them work. So you have a lot of hard work to do."
Spoiler: The bus-thrower wasn't much help. (Surprise.)
Spoiler: The ticket was already in my backlog -- one of a grand total of two tickets.
Spoiler: I don't find the ticket fun. Maybe if I was to write the entire implementation with a nice DSL? but no, "don't touch the perfect code." Fuck you.
Spoiler: It isn't going to be nice or quick. But, she (micromanager) is looking to lose me, so that really is an easy win. for her.
And. just. argh. fuck you. i've been exhausted and dying for well over a year, but you've kept ignoring that (and still are, despite me providing goddamn legal forms from fucking doctors stating it in plain fucking english, which you also fucking ignore), and you just keep piling on the work and demanding the ridiculous of me despite it. Yeah I can pull it off sometimes. No, I really shouldn't, and I'm surprised I can. (also, "Time off? What, and lower your productivity even more? ____ doesn't even take vacations. And how are you doing on that ticket?") And no, none of my tickets have ever had any fucking problems. Not even when there are upstream service outages. Not. a. single. fucking. one. Ever. And the only things I've ever missed were things that bloody product never put in the fucking ticket, so fuck you with your "repair your reputation" bullshit.
god, i fuckiNG HATE THESESTUPOID ANWETLJAF SAJEWTKW BITCHFACEDUCKFUCKERS
Why the FUCK am I still fucking working here?
Right, because I've been burned out and dying so much I can't pass a fucking interview so I can fucking leave.
jasdkl;fk
ugh. Anyway. If you ever find yourself starting work at a Cali fintech company whose internal mascot is a very fine duck? Just run. I absolutely guarantee you will be miserable.rant root swears oh my micromanager duckfuckers "trivial" ticket root is fucking fed up root swears a lot holy shit rewrite an entire library in 2-3 days16 -
Imagine, you get employed to restart a software project. They tell you, but first we should get this old software running. It's 'almost finished'.
A WPF application running on a soc ... with a 10" touchscreen on win10, a embedded solution, to control a machine, which has been already sold to customers. You think, 'ok, WTF, why is this happening'?
You open the old software - it crashes immediately.
You open it again but now you are so clever to copy an xml file manually to the root folder and see all of it's beauty for the first time (after waiting for the freezed GUI to become responsive):
* a static logo of the company, taking about 1/5 of the screen horizontally
* circle buttons
* and a navigation interface made in the early 90's from a child
So you click a button and - it crashes.
You restart the software.
You type something like 'abc' in a 'numberfield' - it crashes.
OK ... now you start the application again and try to navigate to another view - and? of course it crashes again.
You are excited to finally open the source code of this masterpiece.
Thank you jesus, the 'dev' who did this, didn't forget to write every business logic in the code behind of the views.
He even managed to put 6 views into one and put all their logig in the code behind!
He doesn't know what binding is or a pattern like MVVM.
But hey, there is also no validation of anything, not even checks for null.
He was so clever to use the GUI as his place to save data and there is a lot of parsing going on here, every time a value changes.
A thread must be something he never heard about - so thats why the GUI always freezes.
You tell them: It would be faster to rewrite the whole thing, because you wouldn't call it even an alpha. Nobody listenes.
Time passes by, new features must be implemented in this abomination, you try to make the cripple walk and everyone keeps asking: 'When we can start the new software?' and the guy who wrote this piece of shit in the first place, tries to give you good advice in coding and is telling you again: 'It was almost finished.' *facepalm*
And you? You would like to do him and humanity a big favour by hiting him hard in the face and breaking his hands, so he can never lay a hand on any keyboard again, to produce something no one serious would ever call code.4 -
Dev: Hey that internal audit you asked me to perform didn’t go so well
Manager: It has too! I’ll get in a lot of trouble if it doesn’t pass.
Dev: Ok well it’s a lot of work to get it to a passing state, we have to dedicate a lot of resources to fix all these findings.
Manager: We don’t have any spare resources, they are all working on new projects! Why did you have to find things??
Dev: ….It’s a lot of hard to miss stuff, like missing signatures on security clearance forms
Manager: Ok can’t you just say that everything is all good? They’ll probably not double check.
Dev: I’m not really comfortable with that…Look all of these findings are all just from one member of the team consistently not doing their job, can’t you just address that with him and I can make a note on the audit that issues were found but corrective action was made? That’s the whole point of audits.
Manager: You don’t get it, if anything is found on the audit I’ll look bad. We have to cover this up. Plus that’s a really good friend of mine! I can’t do that to him. Ok you know what? You are obviously not the right person for this task, I’ll get someone else to do it. Go back to your regular work, I’m never assigning you audits again.8 -
Why in the name of Donald Knuth did you think it was a good idea to have a 1500 line Java Method? What THE HELL WERE YOU SMOKING THE ENTIRE FILE IS OVER 3000 LINES AND HALF OF THEM ARE COMMENTED OUT!
Don't even get me started on your "unit tests" which is a massive 5000 line behemoth that randomly has massive swaths of code commented out.
And of course no solution like this would be complete with you HARD CODING EVERY F****INIG STRING IN EVERY TIME!
And it's not like you don't know how to use classes as you have several of them, every single one of which is over 500+ lines and consists of only getters and setters. LET ME INTRODUCE YOU TO A MAP! REALLY WHY WOULD YOU USE 500 LINES FOR A CLASS THAT IS JUST GETTERS AND SETTERS?!
The part that really burns me about all of this though, isn't the fact that you sent it to me when I was running into a similar issue, and said "check this out it should help", what bothers me most isn't the indescribable rage I felt looking at your code, the part that really really really bothers me is that you are a veteran with over 15 years in Java development, and according to the org chart are a lead senior engineer getting paid substantially more than me, whereas I am considered a lowly mid-level developer, who isn't worth promoting to your level.
On the plus side you are now going to be featured on theDailyWTF so congrats on the notoriety.8 -
All web developers should support up to IE9 without any problems.
Why? Because in Korea, it is normal.
Every person uses that damn Win7, which has either IE9 or IE10. Without IE support, no one will browse your webpage.
Now you would ask us, why don't you use other modern browsers?
We would then ask you, why would you install a new browser that is
1. Buggy
2. Heavy
3. Takes up ram
4. Has so many features
when you have an awesome minimalistic browser that is preinstalled, and works in all Windows? No thanks.
So, if you put a message saying you will soon drop support of IE, it means that you won't target Korea. Just after the support drop, there won't be traffic to your web site.
So what is the point of this rant?
1. We love IE. Lol
2. IE is lightweight, minimalistic, and the fastest browser in the world.
3. All websites should NOT drop support for IE.
4. We don't care whether web devs will have a hard time. We just think websites are built with Wix and Wordpress, and they work in IE, meaning, IE support is the number one priority.
5. If you ever start a business in Korea, and has a website, make sure to hire an senior Korean web dev who has worked with IE for a long time.
6. Here is the tl;dr
Hate us. Period.24 -
Windows, God damn you piece of fucking shit.
Why the fuck can't you make networking fucking easy like literally every other fucking operating system in the goddamn fucking world?
Why the fuck can't I spoof mac addresses so that I have the same IP address regardless of if I'm on a hard line or wireless?
Who in their fucking right mind thought that the pro version of Windows wouldn't need to do that?
I don't even like using you at this point, I'm forced to use you for work.
There's literally not enough explicitives that I can chain together to sufficiently convey how much I fucking hate you Microsoft. So enjoy this seizure inducing tourette's mode compilation.
Fuck shit cock piss mother fucker asshole bitch mother fucker sick and tired of your fucking shit Microsoft you fucking cuck piece of shit nobody fucking likes you they only have to use you because no fucking business in their right mind is going to spend the millions of dollars it cost to fucking switch over to fucking Mac or Linux I hope you fucking choking a bag of HIV riddled flaming dicks you fucking piece of shit.14 -
Worst code review experience?
Hard to pick just one, but most were in a big meeting room with 4+ other developers not related to the project and with some playing Monday-Morning-Quarterback instead of offering productive feedback.
In one code review, the department mgr reviewed the code from a third party component library.
<brings up the code on the big screen>
Mgr: "I can't read any of this, its a mix of English and something else."
Me: "Its German."
Mgr: "Then why is 'Button' in English? This code is a mess."
Me: "I'm not exactly sure how I should respond, I mean, I didn't write any of this code."
Mgr: "Yes, but you are using it, so it's fair game for a code review."
Me: "Its not really open source, but we can make requests if you found something that needs to be addressed."
Mgr: "Oh yes, all this...whatever this is..<pointing again to the German>"
Me: "I don't think they will change their code to English just so you can read it."
Mgr: "We paid good money, you bet your ass they'll change it!"
Me: "I think the components were like $30 for the unlimited license. They'll tell us to go to hell first. Is there something about my code you want to talk about?"
Mgr: "<Ugggh>...I guess not, I couldn't get past all that German. Why didn't we go with an American company? Hell, why didn't we just write these components ourselves!?"
Me: "Because you gave a directive that if we found components that saved us time, to put in a request, and you approved the request. The company is American, they probably outsourced or hired German developers. I don't know and not sure why we care."
Mgr: "Security! What if they are sending keystrokes back to their servers!"
Me: "Did you see any http or any network access?"
Mgr: "How could I? The code is in German!"
Monday-Morning-Quarterback1: "If it were me, I would have written the components myself and moved on"
Me: "No, I don't think you could for less than $30"
Monday-Morning-Quarterback2: "Meh...we get paid anyway. Just add the time to the estimate."
Mgr: "Exactly! Why do we even have developers who can't read this mess."
Me: "Oh good Lord! Did anyone review or even look at my code for this review!?"
<silence>
Mgr: "Oh...ok...I guess we're done here. Thanks everyone."
<everyone starts to leave>
Me: "Whoa!...wait a sec..am I supposed to do something?"
Mgr: "Get that company to write their code in English so we can read it. You have their number, call em'...no...wait...give me their number. You keep working, I'll take care of this personally"
In they nicest way possible, the company did tell him to go to hell.17 -
Some motherfucker at the gym called me. “Hey @growling, I am here with that gym you signed up with 5 months ago and your card for membership renewal isn’t working.”
“It’s 8:00am”
“Yes sir. It’s 8am.”
“Don’t you think it’s a bit too early?”
“Did you get a new card?”
“Hey call me at lunch or something, I’m going back to sleep.”
“Okay, or you can call me. Goodbye”
Acting like you got better shit to do with your time.
Like he wanted to lecture me and say waking me up at 8am is fine. Like he wanted to say he came from a hardworking family and so he can say waking me up at 8am is fine. Shiiit dude my mom used to work with two broken hips for 7 days a week until I made six figures. Bless her heart, that’s why I got her a new car and money each month to pay all her bills. She’s been out of work for 2-3 years now. So lecture me. Only my mom can lecture me, boy. Cause she raised me to be an engineer.
Also, why do I see this everywhere as well? I get lectured for drinking beer on a Sunday or Monday during lunch at my frequent visits to liquor store.
“Don’t you have work?”
Yes, 9-5. But I’m an engineer. So it can be 10-6 or 11-7. Doesn’t matter. All of the stuff I do follows sprints and not direct interaction with customers!
I get tasks done and I teach interns to help me get tasks done. In time. And sometimes even more.
I know my schedule is so lax you want to criticize me. Maybe you think I don’t work? Or work as hard as you?
Tl;dr I intentionally act like a spoiled baby when it comes to work so that service/retail/manual labor people lecture me so I can tell them that we work differently than what they’re used to.
I have free snacks. Don’t get me started about gloating about free beef jerky. People hate me on online forums for doing that! Drink beer on tap in work kitchen. A glass of wine anytime I want. Sleep in until sometimes 11am. But that’s why I’m an engineer, buddy.2 -
The guy where I can only shake my head when I see his code, and he is really proud of if implementations, while he
- doesn't care about warnings
- breaks builds and doesn't care
- doesn't care about code styles and indents in a very column based way
- adds tons of comments to his code, mostly hard to understand, and sometimes that much you can hardly find the code
- implements a tokenizer where you have to inherit from its interface (Why would I wanna implement whole functions for a tokenizer and not just use it in place where needed? How do I use two of those in one class?)
- implement a "generic" state machine base class with fixed lengths array of 3 events and 3 strings (Why would I need events and strings hardcoded in a "generic" state machine? Why a maximum of 3?)
- once delivered a software without the needed runtime components, so the whole system (embedded device) wasn't working properly and only by chance missed the point of disabling update mechanisms
- make your ears bleed about his big inventions whenever he sees you, no matter how often he already told you about that blazing new feature5 -
Interviewer: So which university are you from?
Me: I am from "foo" university.
Interviewer: So why did you not go to "bar" university?
Inner Me: Wtf kind of a question is that. Why the fuck aren't you a unicorn with pigs flying out of your ass and a globally reknowned researcher at Stanford?
We all end up where destiny takes us. Some of us try very hard but things don't magically happen for us. We keep trying but at the end of the day you end up where you end up.
Real Me: I just finished my High School and had the entry test the next day. I was not prepared at all.4 -
It's only day one of the year and I'm already pissed right off
Why the fuck do all clients expect you to come up with absolutely everything!?
All I ever get is we want a website. I ask well what do you want on it.. our products .. news? Contact maybe ... Urm our business information ... That kind of stuff.
Well what are they?
Pft.. I here is a name if our products. And other stuff
WE ARE SELLING IT WAT ARE THE PRICES AND INFORMATION DO YOU HAVE IMAGES
Yeah do you want them
Of course I do 😐
Great here's 2 of them we have 1100 so I'll get more to you soon.
😤 Thank you!
Holy shit it's always like talking to a fucking brick wall.. why do people have to make our jobs so hard it's already fucking tough
I have no time to plan your entire website by myself I don't know what you want on it. How could I possibly know that!? It's your fucking site10 -
writing library code is hard.
there are sooo many details that go into writing good libraries:
designing intuitive and powerful apis
deciding good api option defaults, disallowing or warning for illegal operations
knowing when to throw, knowing when to warn/log
handling edge cases
having good code coverage with tests that doesn't suck shit, while ensuring thry don't take a hundred years to run
making the code easy to read, to maintain, robust
and also not vulnerable, which is probably the most overlooked quality.
"too many classes, too little classes"
the functions do too much it's hard to follow them
or the functions are so well abstracted, that every function has 1 line of code, resulting in code that is even harder to understand or debug (have fun drowning in those immense stack traces)
don't forget to be disciplined about the documentation.
most of these things are
deeply affected by the ecosystem, the tools of the language you're writing this in:
like 5 years ago I hated coding in nodejs, because I didn't know about linters, and now we have tools like eslint or babel, so it's more passable now
but now dealing with webpack/babel configs and plugins can literally obliterate your asshole.
some languages don't even have a stable line by line debugger (hard pass for me)
then there's also the several phases of the project:
you first conceive the idea, the api, and try to implement it, write some md's of usage examples.
as you do that, you iterate on the api, you notice that it could better, so you redesign it. once, twice, thrice.
so at that point you're spending days, weeks on this side project, and your boss is like "what the fuck are you doing right now?"
then, you reach fuckinnnnng 0.1.0, with a "frozen" api, put it on github with a shitton of badges like the badge whore you are.
then you drop it on forums, and slack communities and irc, and what do you get?
half of the community wants to ban you for doing self promotion
the other half thinks either
a) your library api is shitty
b) has no real need for it
c) "why reinvent the wheel bruh"
that's one scenario,
the other scenario is the project starts to get traction.
people start to star it and shit.
but now you have one peoblem you didn't have before: humans.
all sorts of shit:
people treating you like shit as if they were premium users.
people posting majestically written issues with titles like "people help, me no work, here" with bodies like "HAAAAAAAAAALP".
and if you have the blessing to work in the current js ecosystem, issues like "this doesn't work with esm, unpkg, cdnjs, babel, webpack, parcel, buble, A BROWSER".
with some occasional lunatic complaining about IE 4 having a very weird, obscure bug.
not the best prospect either.3 -
Client: why do I have to use such a hard password for this website?
Me: For security reasons to protect your content and identity of your clients.
Client: Can't you just use the password that I'm used to? I use it on my banking software, and I've never been hacked so it should be good enough for you!
Me: what's the password that you want me to set up for you?
Client: you ready to take it down?
Me: go ahead.
Client: T ... U ... R ... D. You got that?
Me: ... Yes ...
*sigh*6 -
I see many people being irritated when it comes to StackOverflow and If I were to be honest I thought the same a while ago. But I noticed that I was misjudging the main point of Stackoverflow. It's not a forum to help people with their programming problems. It's a huge self writing document to gather every programming related questions and answers under a single platform if possible. That's why they won't down vote you even if you ask a question that was obvious in a language's official document as long as it wasn't in Stackoverflow. That's why questions should also be formatted accordingly which is clear and also informative in itself. I understand why stackoverflow is such a harsh place to ask questions and most of the time I prefer looking things for my self instead of asking a question. And I edit and review most questions on stackoverflow because I enjoy it. That also made me realize that stackoverflow needs to be elitist to preserve it's current quality. Who would want to see unclear duplicate questions that veteran stackoverflow users need to answer over and over again right ?
Asking the right question is hard because we humans most of the time don't know what we don't know. And it makes it really tiring to format your question the way that is fitting for a document. In those times I prefer to ask my questions on a more relaxed and chat focused platform before writing my main question on stackoverflow.
So that was my opinion on stackoverflow and it's harsh environment. It's definetly a hard to get into community which I can't even say I'm really a part of it. But looking at stackoverflow as a document that's being written by ut's users, it's easier to understand it's elitist approach. I hope you had some enjoyment from reading it.6 -
*spends a long time crafting a huge eBay post (we're moving)
* tries to drag and drop first picture
* page navigates to the picture without warning
* loses everything
WHYYYYYYYYYYYYYYY
WHEN DRAGGING A PICTURE INTO A WEB PAGE I NEVER WANT TO NAVIGATE TO A PAGE WITH JUST THAT IMAGE. WHY NO WARNING BEFORE LEAVING THE PAGE. WHY DON'T YOU SAVE TEXT LOCALLY. WHY DOES THE WEB SUCK SO HARD. AAAGGGHHHH.
* feels better
* starts over7 -
Why its so hard to understand that - not always... - frontend devs will give you a sweet ui with medium back end and back end devs are gonna give you a medium ui with sweet back end?
Why can't we just do what nature made us good for and work in collaboration?
Fuck7 -
It's 2017.
Why is vertically centering a div still so stinkin hard?
Yeah yeah ik what you will tell me, "use flexbox".
Well guess what,. I HAVE BEEN TRYING TO FOR THE PAST 6 FUCKING HOURS!
I've gone as far as to copy code from 20+ different websites advertising working solutions. My tab bar looks like the fucking rockey mountains!
My main problem is that flexbox on chrome is not accepting ANY % values.
Now if you'll excuse me, I need to go kill myself. YAY! 🤗29 -
I couldn't sleep. I was staring at the blinking cursor. A slow, comforting blinking. Like everyone else, I had become a slave to the JavaScript ecosystem. If I saw something like a new build system, or a new framework, I had to have it.
My client changed the requirements again. I'm in pain.
- "You want to see pain?" my colleague said. Go read Apple support forums. That's pain.
I became addicted. Every time I died and every time I was born again. Resurrected.
During the night, I was crying in the Apple forums for an official answer that would never come. During the day, I was surfing StackOverflow to fix my problems. You get "single-serving" friends there. They help you, you help them, and then you never see them again.
- "Then you install Stack and boom, you're done. It's that easy to go functional."
That's how I met him.
- "You know why they make so many javascript frameworks?"
- "No, why?"
- "So that they can distract you while they put backdoors in them. So that you don't have time to check all of their code".
- "You are by far the most interesting "single-serving" friend I've ever met"
Then, my hard disk died. Of course, I didn't have backups: nobody has enough space for all those node_modules folders. All my addictions, lost.
Then I wrote him. If you asked me now, I couldn't tell you why I wrote him. We chatted a lot.
- "It's late, I should really go search another hdd on ebay"
- "Ebay? You called me so you could have my old hard disk."
- "No, I..."
- "Come on."
He sent me his old hard disk. It was a 256MB hard disk, but it was fine for running Arch. Then he asked me to rant about my problems in front of him.
- "I want you to rant as hard as you can"
- "Are you serious?"
We ranted all night about our bosses and clients and their fucked up requests. We kept in touch, and after a while more people were ranting with us. Every week, he gave the rules that he and I decided.
- "The first rule of devRant is -- you don't talk about devRant. The second rule of devRant is -- you don't talk about devRant."
I like to think this is how devRant started. This might also be the reason why we never see @trogus, only @dfox. A lot of shit still needs to happen.8 -
Apple iPhone testing without being on the app store is so annoying, I had to sign up some people to test the app I've been working on and had issues on my end, it really is this whole security bullshit, really it isn't needed.
I couldn't get the team provisional certificate thing to show up because when I clicked the account the team certificate settings would disappear, only after right clicking and hitting help then clicking the team while it was selected could I go to the right window.
I don't see why it's so damn hard to do this crap.
Yet with Android, it's so easy.
I really have issues with the testing for this iPhone app, I went through so many different ways to try and get it to work.
Anyways all done, crashlytics is an awesome testing tool if you can get around that small issue I had.4 -
This one crazy:
We made an app for our client to scan some parcels via barcode.
They just created a ticket, for complaining that it's hard to scan in the storage room, because it's so dark. They are like sometimes we need to use a torge to scan. Can you increase the contrast of the app or something to scan better in darker place.
Did not know what to answer, but my thoughts were like: why the fuck you don't put enough light in that room?! 🤔🤷🏽♂️6 -
I recently ranted so much about languages but here it goes
JS we need to talk. BECAUSE YOU GOT FAT AND UGLY STUPID BITCH! Dumb piece of bloatware. What even is your problem? Depending on a library for strpad and then blow up like Steve jobs ego. Bastardized fuckfest. I used to like you bro and then you screw me over!
It's like you fuck my wife while I try to fix your car. Why can't you even be usefully on your own anymore? I'd be richer than bill gates if I get a dollar for every damn framework people pull from their asses. Are you writing this fuck while shitting so you can compare colors of your outcome?
Normalize the fucking base, don't add to the bukkakke! bitch is drowning already. Why is everyone jerking of to react and angular? When have YOU written something in vanilla the last time? Why even bother? Remove the core and hardcore every damn framework into the browsers. Guess that saves you 200kb. Oh wait I forgot that's about unminified jQuery.
Now I need to load about 2GB of dependencies, some creating code that puts code in my code to load code out of my code which was generated out of something that remotely resembles JS so every browser is able to execute my fancy shit. But hey, it's fast. And of course there are the fanboys. You are worse than apple fags. You sample your own jizz with your friends in a wine glass. there was a Time it was bad practice to mix logic and view. Now you made it mandatory. "Browser does the rendering" ofc you imbecile pile of fuck don't show me a damn preloader for 1 picture and 20 lines of text. Who fucked your brain so hard?
So react seems to be the cool kid now, then I tell someone I know angular it's like showing up in a pikachu onsie to a formal dinner with the queen.
I used to love you girl. I loved how we could dirty things together. Now you are like a pig. Please loose weight bby the sight of you disgusts me nowadays2 -
Screw the current Stack Overflow community so hard. It's still basically the only place to get answers but I'm sick and tired of the "you missed a period on line 7 why are you even on this site??" attitude. Look here, yeah it's my bad for missing that part, but I'm pretty sure that if you can't figure out that I missed an obvious ".ToArray()" when pulling my code together for a sample, then you aren't gonna be able to answer my bit-shifting question in the first place.18
-
every day I get phone calls from some idiot to moan about something I fixed.
I had a job to copy a site and use it for another company, with everyone's consent. I do it and found the original was garbage. hard coded functionalities. limited control over which pages appear in the menu and so on.
problem is the site administrator doesn't understand the system and made pages visible on the menu that shouldn't be and so on. these never showed up before because it was broken.
now she phones every day because she setup her pages wrong originally and tells me stuff like, why did you change this, it worked before and crap.
I never expected she would have setup the pages incorrectly so I never thought this would happen.
lesson here is if it's broken and you're the only one that's noticed, just bloody leave it.1 -
SICK AND TIRED OF READABILITY VS. EFFICIENCY!!!!!!!
I HAD TO SEPARATE A 4 LOC JSON STRING, WHICH HAD AN ARRAY OF A SINGLE KEY-VALUE PAIRS (TOTAL OF 10 OBJECTS IN THE ARRAY).
ITS READABLE IF YOU KNOW JSON. HOW HARD IS TO READ JSON FORMAT IF YOU GET YOUR STYLE AND INDENTATION PROPERLY?!?
SO I HAD TO
BREAK THE POOR FREAKING JSON APART TO A FUCKING DIFFERENT YAML FILE FORMAT ONLY SO I CAN CALL IT FROM THERE TO THE MAIN CONTROLLER, ITERATE AND MANIPULATE ALL THE ID AND VALUES FROM YAML BACK TO MATCH THE EXPECTED JSON RESPONSE IN THE FRONT END.
THE WHOLE PROCESS TOOK ME ABOUT 15 MINUTES BUT STILL, THE FUCKING PRINCIPLE DRIVES ME INSANE.
WHY THE FUCK SHOULD I WASTE TIME AT AN ALREADY WORKING PIECE OF CODE, TO MAKE IT LESS EFFICIENT AND A SLIGHTLY BIT MORE READABLE?!? FML.5 -
The best decision I ever made was moving from a big company to a very small one.
I used to work for a large international consulting firm in the model development team. Everything moved so slowly, there were huge amounts of pointless meetings and other time-sinks, we were surrounded by people who were being paid a lot of money but added little or no value, and the general atmosphere of the company was quite depressing. We spent more time having to make PowerPoint presentations for senior management trying to explain why you can't just hire 100 devs and have a product 100 times faster than we actually did developing a product.
I took a bit of a risk and moved to become the fourth person (and second developer) at a niche software producer to take over product innovation and lead product development. Immediately I felt so much happier and realised how much the previous company had worn me down. Everyone works hard and efficiently because your individual output is so much more important to the success of the company and the work you put in comes back to you financially without being syphoned by layers of valueless management levels or time-wasters.
Having responsibility, seeing the impact of your own work and being rewarded accordingly is so important for your sense of well-being. I urge you all to try it if you're stuck in a big company that's wearing you down. And if you're considering moving from a small company to a big one: don't.3 -
Python. Ok, so it's a really cool language, as a scripting language it's awesome, quick to write.
When it's been used to make full fledged oop programs that you suddenly have to maintain things like duck typing become problematic. Looking at an object fuck knows what methods are available. Worse still when some bastard that thinks he's being clever doesn't bother declaring any object attributes and instead overrides the __set_attr method to dynamically add them as they are used there is no hope for the poor sod that has to maintain it later.
I've also now worked out I'm at least the 3rd person having been given the task of maintaining it, i spent a day changing CLI options wondering why they didn't do anything but occasionally crash the app. I've now found a few thousand lines deep that someone had hard-coded these values because they couldn't work out where to get the CLI args from!
I've gained a new appreciation for nominative, strictly typed languages.11 -
Send help..
The project we're currently working on:
- an angular codebase that's broken beyond recognition - nothing's working as it should
- user stories are estimated in hours, but estimations are treated as hard facts. Since the app is so broken, everything takes longer than usual and it's almost impossible to consider every potential hardship during refinements, therefore, we constantly need more time than we have estimated
- retrospectives (intentional plural here, since one time isn't enough) are used to discuss why we cannot manage to finish tickets within the estimations
- the design was made beforehand and is extremely inconsistent and inaccessible
- if you open a new ticket, you need to add a reason for why this ticket is needed - in addition to the ticket description..
- The moment you move a ticket to QA, the "Scrum Master" breathes down your neck, shoving new tickets in your face. Despite having to finish up the other two you're still working on
- multiple teams are working on the application, but - of course - communication is overrated.
I could go on, but I'm too tired..
We were supposed to help the client for a couple of months - we're close to a year now and still nowhere near done.5 -
DO !!!NOT!!!!! USE 'X' AND 'P' TO 'CUT AND PASTE' A LOT OF LINES ACROSS FILES IN VIM!!! HOLY SHIT I JUST PWNED MYSELF SO HARD I LOST SO MUCH CODE HOLY FUCK IT'S NOT EVEN FUNNY! WHERE DID AT ALL GO YOU ASK, WHY THE FUCKING REGISTER, OK LET'S CHECK THE REGISTER, COOL THERE IT IS, BUT WAIT, THERE'S ONLY LIKE 20% OF IT BECAUSE WE CUT A SHIT LOAD OF LINES AT ONCE, AND THE REGISTER OVERFILLED.... Ok let's calm down, doesn't Vim have a recovery option? Yes it does, but WAIT A FUCKING MINUTE, MY CHANGES ARE NOT IN THE SWAP FILE BECAUSE IT'S NOT LIKE VIM CRASHED OR ANYTHING, MY DUMB-FUCK-ASS WILLFULLY WROTE THE CHANGES WHEN I SWITCHED OVER TO THE NEW FILE, AND NOW, WELL THAT'S IT, YOU'RE DEAD KIDDO, YOU WROTE THE CHANGES TO DISK, NOTHING YOU CAN DO, AND I AM SO SCREWED I SPECIFICALLY MADE A DEVRANT ACCOUNT TO MAKE SURE NO ONE ELSE PWNS HIMSELF AS HARD AS I JUST DID HOLY FUCK16
-
I am so fucking done with all these incompetent fucktards!!! Why would you keep a client-brief in secret from your colleagues?! Why on your screwed delusional Earth you think it is perfectly okay if you don’t communicate the changes ahead your team? How could you - microbrained prehistoric dinosaur who petrified to your own semen - think that I can estimate with my time and do my work when you are barely able to think ahead 2 minutes without letting me know the actual scope and deadlines???!!! AND NO telling me the day before NOT GONNA MAKE IT VALID!!!! You failed in life you failed in evolution you played my trust and I don’t give horseshit about your career! Go fuck a hedgehog, eat it and shit out on the same fucking day. Tomorrow a new era starts and prepare yourself as I am hereby vow that I am not going to care any of your bullshit! I vow that every time you come to me with a new task, I will start it WHEN I can and do it between 9 and 17 and if anyone asks I will calmly tell the hard truth about the overbred, human shaped, evolutional dead end you are...5
-
DHL? More like, "Du Hurensohn Lieferst ned!"
Seriously! Fuck DHL so fucking hard! Why the FUCK can you deliver 2 FUCKING PACKAGES, WHICH REQUIRE SIGNING, INFRONT OF MY FUCKING ENTRANCE!! But not, A FUCKING 3rd one! LIKE SERIOUSLY! I WAS AT FUCKING HOME THE ENTIRE FUCKING DAY! THEN I RECIEVE AN EMAIL THAT THE FUCKING PACKAGE "couldnt be delivered because I wasnt at home" YEAH FUCK YOU! 2 INFRONT OF MY FUCKING DOOR! and then... I see him... that fucking DHL guy, with my package, going INTO HIS FUCKING SHITASS DHL CAR, AND DRIVING OFF!
I literally just wanted to open the window and scream "HEY DHL, MEIN SCHEISS PACKET! WO ISSET!?" but I didnt...
FUCK THESE COCKSUCKERS FROM DHL! I HAVE A FUCKING LOUD DOORBELL! RING THAT THING! THERES A BUTTON WITH MY NAME NEXT TO IT!14 -
Hi yall! I've been here a while, but never actually posted anything. Love reading your rants though, always makes me giggle^^
Anyways, I'm a IT student and I got this new job as an IT-consultant.
So we had this big meeting today, together with the CEO and a lot of other new employees with different engineering profession... So everything went fine until the end. We were supposed to stand up and say our names, what we're studying and tell a fun fact about ourselves and I TOTALLY fucked it up... I kinda said my name, I completely forgot to tell what I'm studying and my fun fact was something about ppl having a hard time with my name. Like, wtf are you even saying dude?! All I wanted was to was write code, why can't I just do that?4 -
A discussion about writing tests for frontend applications.
Context: my frontend coworkers don't write tests, at all. Yeah, really. Our testing process is very manual. We test manually when developing. We test manually when reviewing code. After merging, the application is deployed to a staging server and the design team does a QA Sprint. Lots of manual testing and some bugs still crawl by.
So I decided to start pushing my coworkers to start writing tests. One of the reasons I constantly hear them say to not write tests in the frontend is: "It's not worth the time, because design keeps changing, which means we have to take time to fix the tests. Time that we usually don't have."
I've been thinking about this a lot and it seems to me that this is more related to bad tests than to tests in general.
Tests should not break with design changes (small changes at least). They should test funcionality, not how things look. A form should not break if the submit button's style changes, so why should its tests fail? I also think that tests help save time, as they prevent some back and forth because of bugs.
Writing good tests is the hard part. Tests that cover what's really important and aren't frail and break with things that shouldn't break them. What (and how) should we test? And what shouldn't be tested?
Writing them fast is another hard thing. Are you doing it right if they take more time to write than the actual code?
What do you think about this? Do you write tests for your frontend applications? What do you test? How much time do you spend writing tests? What are your testing tools/frameworks?6 -
What I don't understand is why it is so hard for some seniors to just let me jot my notes down, I get it you're busy but if you just let me write down certain key words, I will never ask you this question again, I am nervous cause I had to bug you for help so my mind is not taking anything in, its freaking out cause you're making it so clear I am a bother! So I'm gonna go back to my desk without notes and no idea of what you just tried to tell me.... It was never a problem for my first senior, and he even became my mentor! In a question of 6 months he could go on holiday cause I could handle all his responsibilities until he came back with my trusty note book in hand... So why are you telling me to stop making notes!! It works for me so leave me be!! - sits at desk, pondering why I exist - 😖16
-
Rant. (I love and respect all people! Especially developers.)
You frontend imbecils! I just can’t deal with you any more. I’ve had it.
Stop-inventing-new-components-where-there-are-fully-developed-and-working-concepts!
I mean. Just fucking stop! If I see another worthless datetime picker with an ”innovative” design I am going to hunt you down and freaking scream in your face.
And make fucking buttons look like tappable/clickable. It’s not fucking hard! Imbecils.
Oh, ooo, look at me, I am a frontend developer and I am in UX la-la land and what I am doing is sooo hard. Fuck off with your fucking moving gradients and n:th-child childish playground.
”Yeah, I exchanged the spinner…”
Fuck you. Your not contributing. Nobody cares! We’re not doing anything for the business by having a web which can be seen on a fucking telephone. EVERYBODY IS SITTING WITH SEVERAL GIANT MONITORS AND A FUCKING WORKSTATION FOR THIS. NOBODY ASKED FOR IT. AND YOU SPEND COUNTLESS HOURS ON IT.
”Yeah, I made the site work on ipad”
Please. Why? It’s not worth anything. Zero value.
”Yeah, the toggle component is now changed since we started to use the biddle-flipflup lib and it works almost the same”
No! NO! It does not work ”almost” the same. The psychology of the toggle is now wastly different. What was On before now looks like Off and it is fucking worse!!!
Imbecils. I hate you.
And no, I can’t do your fucking work! And I know that you do other non-ui stuff as well sometimes… but anyway… I have no interest to be in that clusterfuck that modern frontend is today. It was really fucking bad twenty years ago and it is just as bad today and you are not helping.
”I’ve improved the button so now it aaaaalmost does not look like a button. But I am getting there!”
Fuck you.14 -
Fuck Xcode!
Why does every single and small update need to be at least 5GB? And why am I required to update you so fucking often? You are not fixing anything, so don’t even pretend to! Most of the time it is just to support the latest .x update in iOS. Can’t be too hard to update the SDK without updating the entire shit IDE! 😡
And guess what: I JUST UPDATED YOU, SO WHERE IS YOUR FUCKING NEW VERSION??? HOW CAN I WAIT 45 MINUTES AND AFTER THAT YOU DID NOTHING!?! HOW CAN I HAVE THE SAME VERSION AS BEFORE??? NOW I HAVE TO DOWNLOAD YOU AGAIN YOU FUCKING PEASE OF SHIT 😡😡😡1 -
Why is it so hard to just build machines that work without all this ideological bullshit? Code doesn't care if politics==true. The world is scary enough without you assholes making modern life a data minefield for even the most educated experts, and taking advantage of the ignorance of everyone else. Fuck you.
I just wanna <look at web pages> without having to consider, counteract, or silently assist some fucking regime. Why is EVERYTHING this way? Everything is a back door or a data mine or a political statement? This isn't a fucking art piece! It's not your espionage tool, fucking codes in invisible ink and tiny cameras and shit everywhere! It's a <web browser>, and if it does ANYTHING besides <browse the web> that I didn't explicitly tell it to do, you better better not be the one who made it. Because if you did, you are what's wrong with the world.6 -
So one year ago, when I was second year in college and first year doing coding, I took this fun math class called topics in data science, don't ask why it's a math class.
Anyway for this class we needed to do a final project. At the time I teamed up with a freshman, junior and a senior. We talked about our project ideas I was having random thoughts, one of them is to look at one of the myths of wikipedia: if you keep clicking on the first link in the main paragraph, and not the prounounciation, eventually you will get to philosophy page.
The team thought it was a good idea and s o we started working.
The process is hard since noe of us knew web scraping at the time, and the senior and the junior? They basically didn't do shit so it's me and the freshman.
At the end, we had 20000 page links and tested their path to philosophy. The attached picture is a visualization of the project, and every node is a page name and every line means the page is connected.
This is the first open project and the first python project that I have ever done. Idk if it is something good enough that I can out on my resume, but definitely proud of this.
PS: if you recognize the picture, you probably know me. If you were the senior or the junior in the team, I'm not sorry for saying you didn't do shit cuz that's the truth. If you were the freshman, I am very happy to have you as a teamate.3 -
So I need to let off some steam, let me know if you think I need to calm down. Personally I'm just having a hard time understanding my team lead.
So I've been trying to update our codebase for the past two months so we run tests against the latest versions of each respective major browser. I've also been trying to cleanup our code and split it into logical modules.
Need I add, according to Bitbucket, I've written over 80% of our code on our 4 projects with 4 team members including myself.
He's out for a week, so I decide it's fine time to get some work done -- which is ridiculous in itself. I finish, add unit tests for crap I missed because he kept shutting down my PRs for shit he couldn't understand.
He tells me on Friday, when he got back, that he'll be declining my pull requests because my code is too complex -- my team lead -- thinks list comprehension and OOP in Python is too complex. Doesn't understand why we need to have pep8 lint tests, or why we can't just export one giant monolithic client package with over 3k lines of code.
Is it worth arguing or should I just let my department head know I can't work on this team anymore? He won't get talked to or fired, he's been at my company for 6 years and he's in the inner circle.6 -
This happened when I finished highschool.
I was looking for a programming related career at university, and I had two options: Computer systems engineering or Software engineering. I commented this to my mom.
Me: Mom, this university offers Software engineering. The thing is that the campus is 1 hour from the city and it’s a new career, so I don’t know if it’s a good idea or not.
Mom: Why Software engineering? Don’t you want to be a developer?
Me: Yes, that’s why I was thinking of taking Software engineering
...
Mom: Is not “Software” what is inside the computer? (Inside the chasis on desktop computers)
I started laughing so hard 😂 and, of course, I ran away4 -
Why are people complaining about debugging?
Oooh it’s so hard.
It’s so boring.
Can someone do this for me?
I honestly enjoy debugging and you should too..
if it’s not your code, you’ll get to understand the code better than the actual author. You’ll notice design improvements and that some of the code is not even needed. YOU LEARN!
If it’s your own code (I especially enjoy debugging my own code): it forces you to look at the problem from a different perspective. It makes you aware of potential other bugs your current solution might cause. Again, it makes you aware of flaws in the design. YOU LEARN!
And in either case, if it’s a tricky case, you’ll most likely stop debugging at some point, refactor the shit out of some 50-100 line methods and modulize it because the original code was undebuggable (<- made up a new word there) and continue debugging after that.
So many things I know, I know only because I spend days, sometimes even weeks debugging a piece code to find the fucking problem.
My main language is java and i wouldn’t have believed anyone who told me there’s a memory leak in my code. I mean, it’s java, right? We refactored the code and everything worked fine again. But I debugged the old version anyway and found bugs in Java (java 6.xx I believe?) which made me aware of the fact that languages have flaws as well.. GC has its flaws as well. So does docker and any other software..
Stop complaining, get on your ass and debug the shit out of your bugs instead of just writing it in a different way and being glad that it fixed the issue..
My opinion.3 -
WHY???
WHY THE FUCK ARE YOU SO FUCKING SURPRISED SHIT HITS THE FAN EVERY GOD DAMN TIME A CHANGE IS MADE IN YOUR LIMPING SYSTEM?
YOU GAVE NO FUCKING SPECIFICATIONS NOR ANY CARE TO DECIDE ABOUT WHAT THE FUCK YOU WANT IN IT.
EVERY TIME I SEE THE CODE I GET EYE CANCER, DEBUGGING THIS SHIT IS AS HARD AS FINDING THE FATHER IN A HOBO STREET ORGY
AND YOU FUCKING THINK ADDING FEATURES INTO THE SYSTEM UNDER THESE CIRCUMSTANCES IS SO GOD DAMN EASY.
I hope life's god damn dandy for you, get fucked with a pipe bomb.
Oh, hello DevRant, sorry for sitting on the fence for the past months.4 -
It's the 21st century. We have this amazing thing called the Internet. It's literally at our finger tips. Any information you want can be found with the tap of a phone screen, and the information will be presented to you in less than a second.
Why is this concept so fucking hard for people to comprehend? Instead of asking me "How do I write a resignation letter?", search the damn internet for resignation letter guides. Like Jesus Christ, it's not that hard of a concept to comprehend. Especially when you've basically grown up with the internet in our lives. -
SUNDAYS ARE THE WORST!!
Normally it’s the weekend but recently it’s just so stressful!
It’s like you can’t even relax because you’re supposed to be preparing for the week ahead!
It doesn’t feel like the weekend anymore!
Why is planning and prioritizing
So MF Hard for me!?!!!!
Why did my brain cope with stress and trauma by simply checking out & spacing out!?
I got so good at it that I find it hard to bring my focus back—it takes soooo much effort to do what i need to do
I’m So Freaking TIRED.15 -
Fuck chromium devs and their hate for linux. Piece of shit
https://bugs.chromium.org/p/...
TL;DR
Screen share with audio is broken under chromium, because some user didn't want the desktop audio appear when asking for input devices, when there's no microphone available.
The thread doesn't mention a specific cause for this besides "for some reason pulseaudio does this"
So what did the gigabrains working on chromium decide to do? Not list monitors (basically recording devices for on desktop audio) at all.
Why?
* UI is hard
* Because we say so
* Fuck standards
And they only do that on linux. Windows, which uses a similar concept works just fine. Mac? Yeah, just hacked it in. Linux? GL won't fix
Meanwhile they decide to add all shits of non standard, bug causing events for shits and giggles, but when you actually want to resolve issues you're met with silence and arrogance.
Once again, what a piece of shit. Chromium devs must love making things worse with every passing version7 -
I'm not sure *why*, but I increasingly see the following pattern:
Challenge a primarily OO / imperative dev by saying OO or imperative styles aren't always a good fit, and that a stateless functional approach can offer advantages, and you often get something akin to:
"Yeah, it's new to me so I'm still working my way around it, but I get that. Makes a lot of sense."
Challenge a functional dev by saying the functional style isn't always best, and in some cases functional isn't a good fit, and you tend to get:
"YOU IMBECILE! YOU ARE SIMPLY CONSTRAINED BY YOUR YEARS OF MINDLESSLY FOLLOWING THE OO HERD! FUNCTIONAL IS ALWAYS SUPERIOR!! ALWAYS, I TELL YOU!!"
I mean geez guys, calm down and learn it's just another tool in the toolbox. I get that popular paradigms emerge and have their die-hard supporters, but I didn't even see this kind of thing when OO became the "new thing everyone needs to use for everything" in the 90's.3 -
Today I learned why it’s so important to have life outside engineering (better put, I remembered this).
For the last couple of weeks, we’ve been working hard to catch some deadlines, contributing to a large oss project. Getting up at 4am, working with the team in my timezone, having some time with family then working with people with 6-9 hour difference was extremelly challenging and I was so tired I literaly was a fucking pain to bear with.
Today, on Saturday, my wife started cleaning the bathroom sink drain. You know, started... “won’t fix” was not an option. First, the dirt and the smell, mmmmmm, you just have to love it. And then the thing collapses (yes, I was optimistic, trying to clean it just partly - I learned not to fix if it aint’t broken, I wonder where).
It’s of course built of trivial parts, but the water just finds its way. Needless to say, I am afraid of it :). In the end, it got resolved. Just as any bug we squash - with some anger and plenty of dirty words.
During the whole thing, I thought to myself, that all that stress at work is quite bearable; it put everything back into a perspective. Great feeling!1 -
10 year anniversary 'celebration' for a couple of employees (one dev, one a DBA) and the VP of the department was saying kind words about them, talking about the 'good old days'.
VP to the DBA: "I apologize, when you started, you walked into my database architecture. I didn't know that much back then and never thought about the architecture much beyond a few years. Its amazing my design has lasted over 20 years and triple digit business growth..blah blah blah"
Inner voice: "Mother F-er!...My database was designed IN SPITE of your meddling and demanding to create 1,500 field tables. Shut the F up you egotistical bastard!"
I can't even count how many times I had to stop him from, for example, adding a 'ProductID' field to a Customer table.
Me: "Why did you add a product id field?"
VP: "How else will we know what product the customer wants to buy?"
Me: "You mean like a wish list? What if the customer wants more than one product?"
VP: "Oh, that’s easy, we'll create more fields when that happens. ProductID2. Microsoft made it really easy to add fields."
Me: "We already have a wish list table schema. Customer can have as many wish lists and as many products as they want."
VP: "I don't understand. All I want is a field for me to store the product I'm buying. I don't know why you make this so hard, its just one more field."
Now the VP is bragging all the success was due to his expertise?! Gaaaaahhhh!
I quelled my rage with ample quantities of donuts, juice, and chocolate milk.1 -
Why you should always backup.
Nearly a year ago I developed a whole project (iOS, tvOS, watchOS), but I never backed it up because I had a recent machine and thought the chance that something happens to the disk is so small I didn’t backup. But then my mac didn’t start correctly. So I needed to reset it. Lose the project, some other files but not much else. Then I recoded the project and backed it up on multiple places. But a little later, I was writing another app, again didn’t copy again... This time I deleted the wrong folder and deleted the trash, was gone too. So from then I learned to copy everything I coded. All projects I work on, I keep a copy of on an external disk, GitHub and Bitbucket. Assuming they wont crash all at the same time 😉.
So I recommend everyone to backup all your code. Even if it’s only 500 lines. Losing it is hard...3 -
WHY THE FUCK DO MY TEACHERS KEEP USING SHITTY TRANSLATIONS FOR PROGRAMMING CONCEPTS?! Like dude, everything related to programming is in english, just use the fucking terms in english for fucks sake. There are some words like "array" that fit into portuguese sentences without needing translation, so why translate it?
Why do you use acronyms in portuguese? People in the Database Systems class will later read a lot the acronym DBMS but won't know what the fuck that is because they teach the acronym SGBD, which is a translation.
It's so cringy and useless, so many terms the students will have to translate back to english when they get out to the real world because everything related to programming is in english.
"oh but what if the person doesn't know english" you don't even have to know english, just associate the concept (which will be explained to you in your language) with an english word. Also if you don't know english you'll have a very hard time, so I'd suggest taking english classes as your electives.
Ok I'm done, I got it out of my system.6 -
I don't get people..
He is a good person and and realy tries..
Tries what?! To annoy coworkers that have to fix every single thing he does?!
Some people will justify anything with 'he is a nice person and tries hard'. WTF?!
So if someone is a nice person, likes to talk a lot, has 'good' social skills but writes crappy code he doesn't test at all.. or tests and see that it's glitchy and still doesn't fix it.. so he is a good worker for that?! Dafaq?!
So if he is a 'lovable' person, he deserves to be here, doing more damage than helps.. he deserves to have a job, with same pay (or even more) than me?! WTF?! How?!
Why is this ok?! If we were heart surgeons and he killed a person or two due to lack of skills or negligence, what would happen?!
He'd get fired on spot!! Why can't it be the same with devs?!
Why on fucking earth do we need to put up with people who try their best and fail?! Especially if their best is lowest of all, lower than the 'I don't give a fuck, just doing sth so the boss stops nagging'?!
Fuuuuuuuu!!!!
But ok, some people are not cut out for some work, I get it.. but why the fuck do other people justify that with 'he tries'?! Dafaq?!
Maybe next time 'I'll try' to perfom brain surgery on you..and you'll end up a fuckin plant.. is that ok with you?! I'll be trying (not really) and do my best (well I will try not to use a chainsaw when cutting open your head).. will that be ok with you?!
Fuck!!5 -
Security lifehacks 101
Why pay for password managers? Just use one secure password for every service you use! Password managers are really designed for fools who don’t know that you can just use one password for every service and who are ready to pay for that shit.
The best practice is to use your name starting with a capital letter + your main credit card number + CVC code from the back of that card as your go-to password. It’s long and hard to bruteforce and you can remember everything that way! You just need to remember that one password and you’ll always remember your payment info! No need for apple’s bad Apple Pay which is not so secure after all like everything else that Apple offers.19 -
Fact, that I am making websites does NOT mean, that I will make a website for you for free. Why it is so hard for people to understand?2
-
Client comes to me.
Client: So my business is colour matching, people visit me and I help match outfits they should wear that works with their hair and eye colour etc.
Me: Ok... and?
Client: Well. I'd like to do this online, someone sends a photo in and I assess it and send them a colour palette back.
Me: Right... How are you going to calibrate this?
Client: What do you mean?
Me: Well, it's a nigh on impossible task to ensure the exact tones and hues they send you in their photo to what you see, and likewise what you send back might look very different based on their brightness and contrast. Colour science is actually quite hard.
Client: But I don't understand they just send a picture right?
Me: Yeah, they can send one, but are you going to have a consistent baseline for your laptop, can you guarantee the brightness is at the same level each and every time?
Client: No... Why would that matter?
Me: I'm bored now, I'm not gonna take this project. -
Fucking hell everything in java is so annoying, confusing and hard to get working. I just want to use JavaFX, why do you require me to sacrifice a lamb in order to do so? It might be my fault though, but c'mon, I don't want to spend 2-3 hours reading through shitty documentation in order to understand how maven works and what the hell Gradle is. Why can't it be as simple as adding a module name to a config file, like in Rust's Cargo? Even using intellij to acquire JavaFX and set it as a dependency doesn't work, it gives me some weird "JavaFX not configured" bullshit error. What the fuck, you're a library, you shouldn't need anything else ffs6
-
One night, after one very stressful week of production code fixes (I was working on a game with some friends and I created the network infrastructure for P2P and database communication from scratch), I was at my gf's house. After we fell asleep, I stood up and screamed right at her something like "I fucking already told you how X works and how to communicate with Y. Learn to write code properly and after double checking yours then you shall ask me for a non-existing 'bug' fix. Learn how to properly write event based code and use polling you moron!". After that I turned to the other side and fell asleep immediately.
When I saw her the next morning sleeping in the couch, I could not understand why... Only after she described to me the whole incident I started laughing.
After that I just took two weeks off the project and after that period I never actually worked the same way (so hard) in my free time with them.1 -
Fuck google cloud platform. My server has been down for last 4 days. Stupid reason google gives me is that it does not have resources available in my zone. Why the fuck do you start a hosting company if you cannot provide RAM and CPU. On top of that their support is so bad that after 20 emails, 4 chat tickets, 3 phone calls nobody knows the issue I am facing. They just give the links to their ultra stupid documentarion.
Now all my 6 projects are down. Clients are getting impatient. I cannot do any work and googles support is the worst.
They dont even want to understand the issue, dont know how they will solve it.
I have created AWS instance now and migrated to AWS. But i have old backups which are useless on AWS. To get the latest backups i need google cloud instance to get started but stupid google does not have resources. How hard it is to add 1 CPU and 1GB RAM?18 -
To all frontend webdevs here:
Explain to me how do you cope with all this insane clusterfuckness of frameworks, tools and js libraries.
Why is it so hard for a beginner like me to learn webdev? Android and backend are much more logical and sane. Even Node.js is pretty dope.11 -
Why is Drupal so hard to learn?!!!!!!
It feels like you are learning an entirely new language. Yes it makes hard things simple, at the same time making simple things hard to accomplish.
And also modules are buggy, you would fix bugs instead of doing your tasks.
I want to learn Drupal but I guess it is not friendly for beginners like me.12 -
"Why are some features done very fast, and some very slowly?"
Well you see, I'm nothing more than a punny human. As such, there's a ton of stuff that I don't know. Even worse, human beings have this defect of rarely being 100% efficient, so my performance may vary a bit.
It may be hard to understand for a manager, as lizard people are quite a different species.1 -
ŁEŊ@#fmęgwjnfčuÆ®ŊÆŁEŊ3ŋ4ħ€3łæŋ€4æł4ħæ4€ħ9æŋ98ł3ħŋ98↓łħ€9“→↓ŋħł93ŋ@38ŁŊ89ÆŁ4ĦŊ08ÆŁĦ093Đ3@09ŋæłęb„guwahęgawęgÆŁ$ĦÆEı$Ŋ(ÆŁ#Ŋ↑(łæ49↓ŋw
AAAAAAAAAAARRGGHHHHH!!!!!!!!!!!!!!!!!!!!!!!
I'm gonna break this laptop in half if I will not get a break from Windows!
I'm running it in a VM and STILL this fucker gets on my nerves SO FUCKING HARD!!!
1. CPU% 100%. Laptop fans are spinning so hard it's ready to take off
2. My hands are on the laptop. THey are HOT from the heat from inside. Hell that's uncomfortable!
3. ctrl+shift+esc to see why is cpu% 100%. It's something called WMI Host something. Kill that mthrfckr!
4. Process respawns immediately and goes up to 100% again. I have already increased handles limitation for that service a few weeks ago. Like 20x more than it was before!
5. website in IE
6. does not seem to be responding
7. hit f5. Nothing happens
8. Hit refrech buttong on the toolbar. Nothing happens
9. Place cursor at the address bar and hit ENTER. Nothing happens.
Meanwhile my hands are burning.
WHAT THE FUCK!!!
What kind of idiotic system is that!! My asshole is a better OS than this piece of SHIT!
AAAARGHHHHHHHHHHHHHHH#@ŦŊæ¶đ@#ĸogęq j
I'm super pissed. Better keep a 30-40 meters distance from me so the things I throw at you would not hit your ballz!
Now that I come to think of it, the only times I am THAT pissed is the times I am using windows. Srsly.7 -
My best code review experience?
Company hired a new department manager and one of his duties was to get familiar with the code base, so he started rounds of code reviews.
We had our own coding standards (naming, indentation, etc..etc) and for the most part, all of our code would pass those standards 100%.
One review of my code was particularly brutal. I though it was perfect. In-line documentation, indentation, followed naming standards..everything. 'Tom' kept wanting to know the 'Why?'
Tom: 'This method where it validates the amount must be under 30. Why 30? Why is it hard-coded and not a parameter?'
<skip what it seemed like 50 more 'Why...?' questions>
Me: "I don't remember. I wrote that 2 years ago."
Tom: "I don't care if you wrote it yesterday. I have pages of code I want you to verify the values and answer 'Why?' to all of them. Look at this one..."
'Tom' was a bit of a hard-ass, but wow, did I learn A LOT. Coding standards are nice, but he explained understanding the 'What' is what we are paid for. Coders can do the "What" in their sleep. Good developers can read and understand code regardless of a coding standard and the mediocre developers use standards as a crutch (or worse, used as a weapon against others). Great developers understand the 'Why?'.
Now I ask 'Why?' a lot. Gotten my fair share of "I'm gonna punch you in the face" looks during a code review, but being able to answer the 'Why?' solidifies the team with the goals of the project.3 -
I am working on an open source game project, and the most common way to draw things is using a class named ManagedSurface. The class is otherwise awesome, but it has a method called getBasePtr(x, y), which gives you a pointer to the requested coordinates. Fair enough (this is C++ without STL by the way).
But WHY THE HELL CAN I REQUEST ANY POINTER THAT I WANT, EVEN IF IT'S OUTSIDE THE SURFACE? Other cointainers have sanity checks, asserts and such, and the surface KEEPS TRACK OF IT'S WIDTH AND HEIGHT.
WAS IT SO FUCKING HARD TO ADD assert(x <= w); assert(y <= h);???
I spent 3 days on valgrind trying to find a heap corruption that manifested at random points in the code.
FUUUUCK!
On the bright side, I learned how to use valgrind (which is awesomely awesome).4 -
This whole programming profession sucks! Programmers suck! Managers suck! Companies suck! Products suck!
Why is it so hard to organize your stupid code at least a bit?! No, it’s not deadlines, just write a block of code and give it a meaningful name, a function, a method, a comment, so many options, so little fucks given. Give things a meaningful name instead of whatever came to your mind that moment. There’s no excuse! No, just leave it to the next guy, and he’ll leave his trash for another one. And then we complain and make memes about it. Fuck you all!
There’s no purpose or vision of products, managers sweep problems under a rug, executives do whatever they do, as long as some money is pouring in, just keep pedaling semi-mindlessly. Spin the wheel you little hamsters until you drop, there’s enough hamsters out there.
It’s just a clusterfuck of small, selfish interests and egos, a mud of meaningless and unnecessary problems that need not be there.
It’s not the workload, it’s the stress! The stress of bullshit, and constant problems that can be avoided if everyone did their job at least half-professionally. Not just programmers, everyone!6 -
So....
I was asked to transfer a spaghetti Android/iOS project to xamarin for a bank client yesterday because "that's what they use".
This is a crm/loyalty app that has been around for 2+ years now (you can imagine the mess). On top of that I have no knowledge of c#, .net or xamarin.
So I ask: "When is this supposed to be delivered?"
Boss: "It was scheduled for 2 weeks ago but let's say 2 weeks from now"
Me: "..... This is a huge remake it won't be even close to ready in 2 weeks"
Boss: "Let's check on the progress in 2 weeks and see how it goes"
Why is it hard for bosses to provide an actual timeframe???
He's been pulling the same crap with junior devs for years and of course they get nervous and create more spaghetti code...
Anyway long story short (not) I have an interview Monday!
Let's hope it's not more of the same!
P.S.: to junior devs: When you are given a deadline... IGNORE IT.5 -
So i just had an interesting conversation.
View source images in comments
So some background. I used to do a lot of Minecraft development and server configuration. And Minecraft being made of mostly 12-year-olds they really don't pay very well. So I moved on from Minecraft but someone reached out for me to do their configuration for their server. (this was about a month ago) and I quoted them 40/hr because that's what I charge for my web dev work. So he promptly declined and I thought that was that. But tonight he messaged me and found a 5 month old post saying how I was looking to do free development work in order to get experience. And here is how the converstion when.
(His name is "Candy")
Candy:
Lol
Trying to take advantage of me with your bullshit $40/hour claims
Which is outright laughable
https://mc-market.org/threads/...
”I am looking for a network to stay long-term with and help/see it grow into a bigger server. (I would expect pay later down the road if we work together on an ongoing basis)”
—
Quoting your MC-Market post.
What do you have to say for yourself? Trying to take advantage of people?
Going to say something else completely delusional or own up to the fact that you were trying to take advantage of me?
I already knew you were, but now I have the hard evidence.
As I am not a stupid person.
Not only did your friend lie, but you tried to take advantage of me, thinking I was stupid enough to fall for your $40/hour bullshit for basic configuration work. MineSaga charges $30.00 an hour on the high. Don’t even try to do the same shit you did to me to anyone else. It won’t work.
Me:I was interested in doing plugin development and learning so I offered my services for free so I could learn in a more real environment. I no longer do minecraft plugins rather I am a web developer and my rate is $40/hr I am good at configuration which is why i contacted you but I am not going to lower my rate because it is "simpler" work. Just like how you can higher a prostitute to wash your car but it would be cheaper to get the kid from around the block to do it. Also not sure what your end goal is here. I gave you my rate and you didn't agree with it. So you should just move on. Plus this is the minecraft world let me know when you get to the real world so you you can pay in big boy money.
Candy:
So your configuration work for minecraft is $40/h as well?
Lol
Absolutely hilarious.
Me:
did you not read my message?
"I am not going to lower my rate because it is "simpler" work."
Candy:
Who were your most recent clients?
Me:
i'm not going to give you that information
Candy:
Because you know you are lying to me with your crazy rates, and if you aren't, that means you have near to no clients.
Yet another lie.
Me:
keep telling yourself that buddy
Candy:
Lol
Good luck getting any more clients.
rip
Me:
?
I get more clients all the time
They just are not in your realm of your minecraft imagination where you can pay a developer 20$/hr
Candy:
I just strongly disagree with the fact that you are charging $40/hour for configurative work
xD
Me:
Okay
But why even contact me? Did you really think trying to "Call me out" was going to have me lower my rates or something.
Just get over it
Candy:
I haven't called you out and overcharging like that to others in the minecraft realm for a significant gain in money for work that is not worth nearly that amount is absolutely delusional.
I would recommend you stop making up false assumptions
Me: What ever you say
I left it at that. There was some more stuff but it was not that interesting so i left it out5 -
Why do websites have to make their html so fucking hard and complicated to read with something like beautifulsoup. Like I just want to scrape your data. Fuck your embedded iframes and div lists. Why must you do this I JUST WANT YOUR DATA14
-
An online community I've been part of for years has seen a lot of popularity/hate overnight due to a new policy. The influx of new people who want nothing to do with us but just drop by to troll and be cunts is impressive. Also, a significant amount of bots. I want my online home back :( I'm for the new policy and very much against these new clowns who don't really have any reason to be on our page. Before anyone yells gatekeeping, it's a site about knitting and crochet. Why would you go there if you don't know either craft and have no desire to learn or talk about those? So disappointed. I hope it brought new crafters in and that the trolls will go away soon. It's been such a nice place for so long with barely any idiots because it was reasonably small.. And now look at this mess. I logged in to 20 friend requests from people I don't know and am almost certain aren't real people.
Why is it so hard for humans to accept that some people may disagree with them and that's okay?16 -
I once interviewed for a role at Bank of America. The interview process started off well enough, the main guy asked some general questions about career history and future goals. Then it was off to the technical interviewers. The first guy was fine. Asked appropriate questions which he clearly understood the answers to.
The next guy up, however, was what I like to call an aggressive moron. After looking at my resume, he said I see you listed C++. To which I said, yes I have about 7 years of experience in it but I've mostly been using python for the past few years so I might be a bit rusty. Great he said, can you write me a function that returns an array?
After I finished he looked at my code, grinned and said that won't work. Your variable is out of scope.
(For non C programmers, returning a local variable that's not passable by value doesn't work because the local var is destroyed once the function exits. Thus I did what you're supposed to do, allocate the memory manually and then returned a pointer to it)
After a quick double take and verifying that my code did work, I asked, um can you explain why that doesn't work as I'm pretty sure it does.
The guy then attempted to explain the concept of variable scope to me. After he finished I said, yes which is why I allocated the memory manually using the new operator, which persists after the function exits.
Einstein then stared really hard at my code for maybe 10 to 15 seconds. Then finally looked up said ok fine, but now you have a memory leak so your code is still wrong.
Considering a memory leak is by definition an application level bug, I just said fine, any more questions?4 -
-_- every time I use windows recently, I'm reminded of why I haven't for years... I swear, the simplest things are so freaking hard to do. It's like, windows doesn't support W, but blog post A references program B, which converts Z into Y, and after spending 3 more hours googling I find programs C and D, which convert Y into X, and then X into W. Were you able to follow along? Yeah, neither can I. The logo comes up and I immediately get PTSD and start falling down Alice's rabbit hole only to realize I've just wasted 5 hours of my life...
Unfortunately, ASUS is horrible and refuses to make even the most basic, minimally-functioning Linux drivers, or provide anybody with the resources to do it themselves, and they put everything on GPIO chips capable of frying the laptop!!! I'm so freaking done...
I feel like an adult locked in a child-safe playroom full of baby toys...22 -
Right, that's fucking it. Enough. I'm all for learning new technologies, frameworks, and development protocols, but my time on this earth is limited and at the end of the day if I'm having to spend DAYS AND FUCKING DAYS just scouring through obscure forum posts because the documentation is shit and just hitting ONE FUCKING PROBLEM AFTER ANOTHER then there comes a point at which the time investment simply isn't worth it. I HATE throwing in the towel because some FUCKING CUNT code problem has got the better of me, but fucking sense must prevail here.
Laravel fucking Mix. Do any any of you use this shit on Windows? Because I take my fucking hat off to you. I'm done with it.
Oh, so your server uses 'public_html' instead of 'public' does it? Well, of course you can just set
mix.setPublicPath('public_html'); then can't you?
No, you can't. Why? Because fuck you, that's why. Not only do you have to hard-code your fucking public directory into each specified path, additionally you have to set
mix.setPublicPath('./');
Why? Because fuck you, that's why. It took me the best part of two days to discover that little nugget of information, buried at the bottom of some obscure corner of the internet in a random github issue thread. Fuck off.
Onto next problem. Another 5 hours invested to extract some patchy solution that I'm not at all happy with.
Rinse, repeat.
Make it work with BrowserSync by wrapping your assets like so:
<link rel="stylesheet" href="{{ mix('/build/css/main.css') }}">
Oh oh oh but "The Mix manifest does not exist"... despite a fresh install of Laravel 5.6 and all relevant node modules installed... follow some other random Github thread with a back and forth of time-consuming suggestions for avenues of experimentation, with no clear solution.
Er no, fuck off. I'm going back to Grunt and maybe I'll try Webpack/Mix in another year or two when there's actually some clear answers, but as it stands this a wild goose chase into a fucking black-hole and I've got better things to do with my precious time. Go die.5 -
So, for the past...what, week or so? I've been working on a side project with @gianlu. It's the PretendYoureXyzzy fork - our attempt to rejuvenate an old shitty piece of software.
I had started working on a fork alone, and then he asked to team up so I was like "Sure, I got nothing better to do." So, he's working on the backend (and hooking JS up to the backend) and I'm developing the frontend.
I don't know why I thought tech would stand still. Google says they're putting MDL on life support and replacing it with a much more complex successor, MDC. It's not hard to use, but what really bugs me is the lack of notice on getmdl.io. If you are switching to another project as your main focus, why the fuck wouldn't you advertise in the most places possible?
Granted, I don't do web design and/or development on the daily. Yes, I can do it, but I'm not always as up-to-date with web technologies as I'd like to be.
However, the screencap captured is the third time I've taken the knife to the UI. MDC is great tooling, at least to me. That dialog? Not something MDL would've had out the box on the first day. You'd have to work for that.
I don't have an issue with MDC, I have an issue with the lack of PR around it.6 -
I feel guilty for using YouTube Vanced and being unable to support content creators.
Shouldn't there be a feature that allows you to toggle ads on certain channels you want to support?
I really want to support such folks who are creating valuable educational content but Google being the biggest piece of corporate shit, makes me angry when it comes to compensating the creators fairly when they make Billions off their hard work.
The world is a better place because of such teachers who spend time, energy, and efforts to create valuable and useful content for rest of the world.
Funnily, back in days when we had awesome stuff, the tech was shit to document all of it. Now when we have advanced and easily accessible tech, we have shitty TikToks.
Why can't the creators of good content get more visibility and why is the world so fucked?13 -
A story from around 2005:
Customer laying out specifications: “We expect this software to need to last 25 years or so, and it will need to keep historical file processing data by dates for at least that long, assume storage is no issue.”
Devs at the time: “look best I can do is support that start with 200 or 201, anything else is really too much to ask. Also understanding how to work with dates at all and not just string manipulation is waaaaayyy hard yo.”
Fuck you lazy motherfuckers. This is why people thought Y2K would be a problem. -
Why am I sad, depressed, demotivated, you ask?
Because I was asked to create-react-app with nodemailer, it worked well on heroku, YAYYY MEE, "
"NOTHING GOES WRONG IN DEPLOYMENT FUCK YEAH"
Little did I know that was a "demo" for the business people, My superior / manager/boss wants me to deploy on 1and1 service provider,
> Okay 1 and 1 service provider does provide Nodej, so it shouldn't be hard.
> Turns out it is a Windows hosting server IIS 10 without URL Rewrite.
> *INTERNAL SCREAMING*
I went up to him to talk about this issue and requested to let me talk to 1 and 1, and get this sorted
> But bro, if we cannot fix it, I think they also cannot fix, probably.
*INTERNAL SCREAMING AT PEAK*
I just want URL Rewrite installed on IIS10 so that I can move on to the next project.
A little background for this project
> No support from him during development.
> I personally used HD Images, because why not?
> Website seems slow because of HD Images, and now he complains about it.
You fucking (managers) want a website to be scalable and fast and yet you choose to focus on B U S I N E S S instead of support the real guy.
I'm fucking sick and tired, it took me 24 hours figure out the issue because there is nothing on 1 and 1 support/ forum/help center.
Another 24 hours to try and fix, yet no luck.
I'm gonna finally point the domain name to heroku. Fuck, I'm so fucking done6 -
Issue or Error? Rant story time!
I was working on a windows desktop app, and everything was ok, you know, tests completed succesfully, all in time, etc. The problem was when we showed the demo to one of our clients. He saw several screens and we explained all the features to him.
Client: *Sees a Error pop-up indicating that a remote service is temporarly unavailable (what it has to happen in order to show him how the system would warn him when an external service is out of service)
Client: What’s that?
Lead dev: What do you mean?
Client: Yes. That’s an error pop-up
Lead dev: Yes, it’s a message that tells you that there was an issue connecting to the bank service
C: No, no and no. Please change it
L: Why? Don’t you want the system to tell you when there is a connection issue and why is that happening?
C: Yes, but my employees could lost their minds because of this class of messages!
L: So...?
C: You have to change it
L: Ok. What do you want to change?
C: First of all, don’t put an “Error” icon, put an “Warning” icon, and instead of “Error” title, put... “Issue”
L: “Issue?”
C: Yeah. Don’t put the “E” word, if the users see an “Error” message, they could think that the program doesn’t work, even if it does work.
We all though “WTF?!”
To make the story shorter, we changed all the pop-ups. That took two days.
Is that correct? I know that “Error” sounds hard but, seriously? “Issue: The remote service is not available, contact your bank?”rant wtf brain software development wtf is going on wtf? story time windows problems wtf wtf are you doing!6 -
The frustration that comes to each developer when he tries to write the code structured by thinking through each situations, and your team lead comes and tells you why r you doing so much validations just hard code them we need to release it today client is waiting. After 3-4 months the same team lead goes through the code and shouts at you telling why the he'll you hard coded all these, can't you write the code correctly by thinking through.3
-
Why is it so fucking hard for people to follow basic rules? FFS you're supposed to stay at home to limit contact between people, that doesn't mean you can play volleyball with your friends or go to the local park! And if you decide to go hiking, choose a place where you'll be alone, not the most popular trails around the city! You're the fucking reason government needs to make new quarantine regulations every day, not this virus, and you deserve no help if you catch it! Fuck you!15
-
Ah, shit. First, I get downvoted a bunch, by a rogue jester bot I assume, then the retoornuke goes off, and with her account, even more of my hard-earned updoots lost into the ether.
How is this important? It isn't. I'm merely annoyed. Needed only a couple more to get myself a pet, I was so fuckin close maan. Now I need about 60 again, so not too bad actually, but if you see me shitposting at an increased pace, then you know why.9 -
How are you? I have burning open position, are you interested?
Are you open to the position?
Are you open?
ARE YOU OPEN?
Well how would I know? You didn't tell me literally anything. Why won't they start with tech stack and salary range instead of 20 "how are you messages". Why is it so hard? Why are recruiters so hopeless, I'm never gonna get this how and why this garbage ineffective way of working is tolerated by companies.1 -
about 2 weeks ago my mom's friend's family visit our house. one moment they introduce their brilliant son going to take Computer Science Major, and they didn't understand why, and apparently they are some kind of ignorant family. So my role here are to advertise and promote the world of CS (since i know their son are good at programming). one moment i am diving to deep into my own speech, i am like :
"I believe you guys using facebook, and Whatsapp all the time **give a smirk and sarcastic look* (which they actually did), that is our work there. and maybe you (my mom's friend) love to play candy crush with my mom, yes that is also our work, and we got a lot of money from you buying the candy to unlock the hard level (the microtransaction thing) MUAHAHAHAHA !" ---
and yes i am laughing like a monster in a film. and suddenly that becoming the most awkward thing i ever had.
and i don't know should i feel bad or not introducing CS like that.3 -
!Dev
Sitting in a bus on 19 hour ride with my class to England a few things to rant about came to my mind:
Why the fuck do you have to blast shitty german rap music out of your fucking JBL boxes and why do you have to turn up the volume so much that I can still hear it although I am wearing headphones, listening to music and sitting 5 fucking rows in front of you.
Also why the fuck do clocks in buses never display the right time? How hard can it be to make the clock display the right fucking time?
Another thing: why does this bus which is especially made for long rides not have a fucking trash can?! Seriously wtf?
Rants aside I am really looking forward to staying in England for a week although I won't have a computer for the next week :(
Another thing: why the fuck is the coffee you get at pull-ins so fucking disgusting ?
Like srsly, it is made by a machine and still tastes like thrown-up.
And why the fuck does everyone look weirdly at you when you buy a can of red bull but everything is fine when someone my age drinks 3+ liters of beer and then throws up? What the fuck? People look at me weirdly when I tell them that I don't drink any alcohol, heck I am actually not even allowed to do so because I am 15 and not 16 (beer is allowed in Germany if you are 16+ but nobody really cares about that). Heck where I am from they even encourage you to drink beer? What the fuck??!!
Anyway looking forward to England and also sorry about the long non-dev related rant. Just had to rant about some people and society.
P.S. do you know any (preferably free) Android apps / games where you have to code or just solve problems with logic?14 -
Well what an adventure with this SSD...😑
my sis' laptop is from 2013-ish(?) and has/had a slow HDD in it. I wanted to speed it up, before her study, so I bought a new internal SSD (no new laptop wanted).
Created a bootable USB, exchanged the hard drives and install the OS on it. Seems easy enough...
The laptop restarts to finish its process ... laptop shuts down immediately, no warning whatsoever. 😳🤨
Start it up, loading screen, fan gets louder and louder ... instant shut down.😳🤨🤨.
Redo process, this time landing on blue-screen, error code critical process died? ... instant shut down again.🤔
Restart from old HDD, normal.😐
Retry with boot USB and reinstall SSD. Setup process copying files, meanwhile instant shut down.😳 Please don't tell me!😩 Since every part of the laptop was working, except the new inserted SSD, I thought "FUCK not a broken SSD!😣"
I had my own PC with internal SSD slot, so tried to find out, whether it would be broken...
All starting up fine??🤨🤨
Ok then? Finish the setup for the third time now ... everything up and running.😐🤷
Normal shut down, unplug, plug back onto laptop, it works. HOW?? WHY?? 😕
Why the fuck are you suddenly working? 😐🤷🤷🤷
That's some magic...5 -
Me: Ok time to save money, have a trip to melbourne coming up, save for a house, car and wedding... Brilliant...
Internet: Oh hey you know how you wanted a smartwatch that was not sporty looking and has NFC, heres the Ticwatch C2!
Me: I hate my life...
Internet: also heres some of the programming theory books you wanted on sale!
Me: starts tying noose
Why must saving money be so bloody hard when everything you've wanted just pops up .-.3 -
That feeling when you were so happy about react-native, and was pretty sure at the beggining about the achitecture of your app and js libs you are about to use.
Im here sitting with redux, reselect and still dont know why I cant just do a REST call and format data in the container component.
Why react is so hard, or am I dumb?6 -
anyone having the same problem of mine? I was asked to give an estimation but I suck at giving estimations!
I once gave my boss an estimation of three weeks, and completed in 1.5 weeks + including unit tests for my work O_Oundefined please go away i don't like estimations why i can't do estimations pm please leave me alone why you so hard estimations4 -
Don't reuse your fixtures!
Each test case should be isolated. Don't ever think just because some function requires a similar input, it's safe to reuse it ALL OVER THE PLACE.
Why? Because someday, you want to change one functionality of one unit.
And you adapt your tests, fix your code, and suddenly, by changing one fixture, you break dozens if not hundreds of unrelated tests and now you have to clean up that mess.
It's even worse for functional tests with all those interwoven parts so that it becomes hard to reason about the scope of your tests when lacking proper documentation.
How I know? BECAUSE I AM CLEANING UP YOUR MESS RIGHT NOW!3 -
I'm trying really hard not to be sensitive, but my manager is making it difficult with their "constructive criticisms" ...
Just finished up a call with them. And I'm so tired. I'm not even angry or upset, I just feel so tired of their bullshit.
I set up a meeting as a courtesy to get them up to date on all the code changes I made. Last night I stayed up late to try and get things in before the deadline and this morning just killed me when they say.
"I don't think I should have given you this."
"I was right, you weren't ready to start doing this."
(Then don't even bother giving me anymore tasks then, I don't fucking care.)
"you clearly don't understand how branches work"
(Absolutely fucking false, I fixed that shit and am very familiar with how to understand the structure of the fucking repo)
"you are rushing and I don't need you messing up the website"
(I'm being proactive you twat, not rushing, making it very difficult for me to do the work and being productive)
Like seriously bro! Don't fucking patronize me for the work I was trying to get out. And trust me this fucking meeting is done in order to get ahead of potential issues, not a time to be condescending of my skills or lack there-of as you seem to so keenly think.
If you had this much doubt about my abilities then why give me the fucking Sr. title? Fucking trust that I'm being honest, and I'm trying to get us to a good spot, not fucking sabotage the company. God fucking damn.6 -
That's it, where do I send the bill, to Microsoft? Orange highlight in image is my own. As in ownly way to see that something wasn't right. Oh but - Wait, I am on Linux, so I guess I will assume that I need to be on internet explorer to use anything on microsoft.com - is that on the site somewhere maybe? Cause it looks like hell when rendered from Chrome on Ubuntu. Yes I use Ubuntu while developing, eat it haters. FUCK.
This is ridiculous - I actually WANT to use Bing Web Search API. I actually TRIED giving up my email address and phone number to MS. If you fail the I'm not a robot, or if you pass it, who knows, it disappears and says something about being human. I'm human. Give me free API Key. Or shit, I'll pay. Client wants to use Bing so I am using BING GODDAMN YOU.
Why am I so mad? BECAUSE THIS. Oauth through github, great alternative since apparently I am not human according to microsoft. Common theme w them, amiright?
So yeah. Let them see all my githubs. Whatever. Just GO so I can RELAX. Rate limit fuck shit workaround dumb client requirements google can eat me. Whats this, I need to show my email publicly? Verification? Sure just go. But really MS, this looks terrible. If I boot up IE will it look any better? I doubt it but who knows I am not looking at MS CSS. I am going into my github, making it public. Then trying again. Then waiting. Then verifying my email is shown. Great it is hello everyone. COME ON MS. Send me an email. Do something.
I am trying to be patient, but after a few minutes, I revoke access. Must have been a glitch. Go through it again, with public email. Same ugly almost invisible message. Approaching a billable hour in which I made 0 progress. So, lets just see, NO EMAIL from MS, Yes it appears in my GitHub, but I have no way to log into MS. Email doesnt work. OAuth isn't picking it up I guess, I don't even care to think this through.
The whole point is, the error message was hard to discover, seems to be inaccurate, and I can't believe the IRONY or the STUPIDITY (me, me stupid. Me stupid thinking I could get working doing same dumb thing over and over like caveman and rock).
Longer rant made shorter, I cant come up with a single fucking way to get a free BING API Key. So forget it MS. Maybe you'll email me tomorrow. Maybe Github was pretending to be Gitlab for a few minutes.
Maybe I will send this image to my client and tell him "If we use Bing, get used to seeing hard to read error messages like this one". I mean that's why this is so frustrating anyhow - I thought the Google CSE worked FINE for us :/ -
So yeah XML is still not solved in year 2018. Or so did I realize the last days.
I use jackson to serialize generic data to JSON.
Now I also want to provide serialization to XML. Easy right? Jackson also provides XML serialization facitlity similar to JAXB.
Works out of the box (more or less). Wait what? *rubbing eyes*
<User>
<pk>234235</pk>
<groups typeCode="usergroup">
<pk>6356679041773291286</pk>
</groups>
<groups typeCode="usergroup">
<pk>1095682275514732543</pk>
</groups>
</User>
Why is my groups property (java.util.Set) rendered as two separate elements? Who the fuck every though this is the way to go?
So OK *reading the docs* there is a way to create a collection wrapper. That must be it, I thought ...
<User typeCode="user">
<pk>2540591810712846915</pk>
<groups>
<groups typeCode="usergroup">
<pk>6356679041773291286</pk>
</groups>
<groups typeCode="usergroup">
<pk>1095682275514732543</pk>
</groups>
</groups>
</User>
What the fuck is this now? This is still not right!!!
I know XML offers a lot of flexibility on how to represent your data. But this is just wrong ...
The only logical way to display that data is:
<User typeCode="user">
<pk>2540591810712846915</pk>
<groups>
<groupsEntry typeCode="usergroup">
<pk>6356679041773291286</pk>
</groupsEntry>
<groupsEntry typeCode="usergroup">
<pk>1095682275514732543</pk>
</groupsEntry>
</groups>
</User>
It would be better if the individual entries would be just called "group" but I guess implementing such a logic would be pretty hard (finding a singular of an arbitrary word?).
So yeah theres a way for that * implementing a custom collection serializer* ... wait is that really the way to go? I mean common, am I the only one who just whants this fucking shit just work as expected, with the least amount of suprise?
Why do I have to customize that ...
So ok it renders fine now ... *writes test for it+
FUCK FUCK FUCK. why can't jackson not deserialize it properly anymore? The two groups are just not being picked up anymore ...
SO WHY, WHY WHY are you guys over at jackson, JAXB and the like not able to implement that in the right manner. AND NOT THERE IS ONLY ONE RIGHT WAY TO DO IT!
*looks at an apple PLIST file* *scratches head* OK, gues I'll stick to the jackson defaults, at least it's not as broken as the fucking apple XML:
<plist version="1.0">
<dict>
<key>PayloadOrganization</key>
<string>Example Inc.</string>
<key>PayloadDisplayName</key>
<string>Profile Service</string>
<key>PayloadVersion</key>
<integer>1</integer>
</dict>
</plist
I really wonder who at apple has this briliant idea ...2 -
I am so much stunned i cannot form a sentence on what to say. Lost 3 days trying to fix a bug on why socket.io was connecting to backend TWICE per user. I cannot fucking comprehend this. Backend works fine because via postman it doesnt connect twice. Everything works fine. 72 fucking hours waste d of my life just to find out i had to change
<React.StrictMode>
<App />
</React.StrictMode>
Into
<App />
When i tell you my jaw fucking dropped it fucking did. And it does not drop often or that easily for me. What the FUCK is react strict mode???? FUCK react. I fucking hate this piece of garbage framework. I even like nextjs better. React💩💩💩💩💩💩💩💩💩💩motberfucker WHY is strict mode fucking my code what use does it have who gives a shit why does it have anything to do with websocket connection FUCK react 💩💩💩💩💩💩💩💩💩 how does this piece of camel turd have anything to do with duplicate connection 💩💩💩💩MFKKCER this garbage doesnt exist in my beautiful angular or nextjs PLS why this cancer has to be so headaching i knew I'll get FUCKED if i dont go over a detailed course learning react from scratch. Now im suffering. Learning this garbage the hard way FUCK off4 -
BielyApp, yeah, GOOOOOOOOD IDEA! I still can‘t understand how this works or why did a reasonable human being though that this would be a great idea! 🤔
Ok. There‘s a community that lives 4 or 5 hours from my my city. I don‘t want to offend anybody, so let‘s call them “Bielys” (just a random name, I don’t know if there’s actually a group or etnia with that name).
Bielys live isolated from modernity, they speak their own language and they don’t use technology.
A dev friend of mine was having a hard time (he got divorced and was almost in bankrupt). One day, a man asked him and another dev to work on a mobile app:
...
“BielyApp”.
...
It was supposed to be a movile app for commerce. Bielys could sell and buy biely stuff from another bielys. Well, at this point you can figure out why this was a bad idea. Anyway, they developed it. Even it’s on GooglePlay and AppStore 😱 I installed it to see if it was truth or not. Incredibly it was true. BielyApp exists and the worst thing is that you can log in with your facebook account. WTF?!
I asked to him “But why?! WHY?! They don’t even use smartphones!!!!”
And he answered “I know, but I needed the money”1 -
I hate bash scripting so much !
What a shit language, its inconsistent af
Its just a pile of hacks upon hacks upon hacks. Theres no rime or reason to bash expansion, or to working with arrays.
Sometimes "$@" is a list, sometimes its not... Because fuck u thats why
So im doing a coding project at work, that has to be in bash for reasons.
It already feels like giving birth, llms are hard-carrying me and im not proud of it
And every time i think im done, and i can close this fucking epic, some issue pops up that necessitates a re-write
3rd one is also a no go apparently
And this all happened because *someone* in another department couldn't be fucked to implement the proper solution for this.
The scope of this piece of shit script keeps growing, because every month they be like
"oh this feature of service xyz ? Nah turns out we cant do that sowwy. But you can implement a workaround in bash right??
If you truly like bash as a language, you're cooked brother. you need to seek professional help :skull:8 -
We had today a meeting in management that ended in a discussion about prevention instead of crisis and risk management.
Or to make it bit simpler: prevention instead of treatment.
In IT / management / government, treatment is usually the way - you let the crisis happen, despite knowing it could have been prevented, and treat the damage / crisis.
Needless to say, the discussion escalated like usual.
It's funny how managers are able to put sentences like: "it's important to have quality assurance like prevention but staying within budget should be priority" (loosely translated from German, it's hard - sorry)...
You mean the budget that exploded and quadrupled in size because you dumb fuckers pay no attention to quality assurance? Or the additional cost of hardware, maintenance etc. to compensate for the fuckups regarding performance evaluation and regression testing?
"We cannot prevent everything nor anticipate everything, it's safer to deal with an estimated risk than with the unknown"...
"But we'd need to invest in ..., which reduces value"
I could give more details, but I think the point is clear... the discussion became quite heated and the longer it went on, the more I wanted to have an morphine drop with suicide option...
Why do people hate prevention so much?
Is the concept that hard to understand? You prevent things to not deal with crisis.
You invest to prevent loss.
It's just one of these weeks where the only happiness consists of tipping the delivery guy with 20 % plus and getting an honest smile.
:(3 -
Clojure developers: why has our awesome language not taken the world by storm? how do we get new developers interested in Clojure and Lisp! its not as hard as people make it out to be!!
Also Clojure developers: Yeh so we know you are all probably not used to an editor like emacs *crowd looks in confusion*....BUT YOU NEED TO DOWNLOAD EMACS, INSTALL ALL THESE PLUGINS, MAKE SURE THAT THIS SHIT CALLED CIDER WORKS AND LEARN ALL OF THSE CTRL+<Fuck-Mx-You> COMBINATIONS!!
As someone that has been in the community for so long...I can't with the mentality of some of these people, and it scares me because I fear for Clojure disappearing.17 -
Subject: a rant for devRant
Hello,
Not entirely sure why or when exactly it happened, but after I joined mailing lists I have a pet peeve for people who don't use a proper subject line, or don't use email when I literally made a mail server for that purpose (some organizations really prefer calling apparently). Is it really that hard to summarize a message in one sentence? Hell half the time even the message itself is just a few sentences.
Also the greeting and salutation at the beginning and end of email messages. I find them so redundant. Has anyone ever gotten any meaningful information out of "Hello", "Greetings", "Dear", or something like that? Or "Best regards" or whatever. I get that it's just being polite but it's so meaningless! I really don't like using them anymore. Just a message block and who it came from, that's all it needs to me. Instead pour some effort into the damn subject, the title of whatever drivel you're putting out there! Or replying to an email *only* when the subject matter is still related! Or actually replying to the damn email if it's still that subject matter...
I probably sound like an old man, but seriously.. email isn't a hard concept once you "get it". Anyone can write a halfway decent letter, why isn't that the case for email?
Best regards,
Condor6 -
I think the reason why git beginners have a hard time with it is because the api is a bit untuitive.
For example: if you want to "unstage" staged changes, you run git reset, and if you want to "delete" those changes from your working copy, you git checkout those files.
But then, you find out that you can do all of that if you git add . and git reset --hard.
So you're like "huh..."
And then you discover that if you end the resethard with a branch name/commit id then you also make current branch point to the commit or that branch/commit (respectively).
So you're like "huh..."
And also if you add a commit id or branch name to git checkout, you change the current branch to specified/enter detached state with HEAD pointing to that commit (respectively).
Oh and you don't use git branch to create branches, you use git checkout -b because it's a lot shorter.
So here's a rundown: git reset mutates things related to files, but also mutates things related to branches.
git checkout also mutates things related to files and mutates things related to branches too (in a diff way). Also, creates new branches.
I don't think this is intuitive. We users use the same commands for different purposes with just a different flag.
Commands shouldn't mutate different types of things. But don't composite commands (as in, "smart" commands that mutate different things) shoudln't be a flag in an existing command, it should be a single new command of its own.
Maybe if I reread the internals of git now, I'll be able to disgest the dozens of technical terms they throw at you (they are many). And in my mind, the api will cognitively fit to the explanations.
Here's another one that feels weird too.
If you want to make your changes start on top of someone else's commit, you do git rebase.
But git rebase -i can be used for that, and also to delete, modify changes or message of, reorder or combine previous commits of the current branch.
Maybe the reason why several things we do overlap with the same commands is because they internally do similar things, and while not separating those commands might make it less intuitive, it makes them more sensible? i dunno...
disclaimer: I'm not setting this opinion in stone though, and am aware that git was created by one of the most infuential programmers.6 -
So, by a cruel twist of fate I ended up on the front line of tech support for the app we've built. It's aimed at non-IT professionals, in general people who are not expected to know too much about computers but who should have at least two neurons to bash together in their pretty little heads.
No.
It really makes me drop my faith in humanity considerably. Clicking a confirmation link is too much. Filtering an excel sheet is too hard, despite it being their technically main work tool. Tickets are basically "shit's broken go fix". What is broken? How to reproduce it? Why do you expect the person on the other side of the screen to be a fucking diviner? I recently ran all out of dove guts to search for the answers of your questions.4 -
I remember the first time I was experimenting with Linux and decided to install Kali Linux (was still version 1 at the time) and in the process cleaned my hard drive. I was in first year and I hadn't been introduced to git, so you can imagine what happened to my code.
Or when I dumped all my databases into one SQL file (the feature looked tasty in phpmyadmin) and then after reinstalling everything, I couldn't import back the files.
Or last year, where I was on industrial attachment. So we were to delete some data from DHIS2 manually. So as a developer I grouped all organisation units to be deleted under one parent and wrote a python script to recursively delete anything in that group. Just when I was about to show my supervisor how efficiently my script was deleting stuff, he said, "Don't delete anything yet". I hope he doesn't read this *wink*
Fast forward, last week on Friday I dropped my external hard drive. It just works on one USB port now, no idea how and why. -
I don't get it.
I tried Kotlin on Android just for fun, and it doesn't support binary data handling, not even unsigned types until the newest version. Java suffers from the same disease.
How does one parse and process binary data streams on such a high end system? Not everything is highlevel XML or JSON today.
And it's not only an Android issue.
Python has some support for binary data, and it's powerful, but not comfortable.
I tried Ruby, Groovy, TCL, Perl and Lua, and only Lua let's you access data directly without unnecessary overhead.
C# is also akward when it comes to data types less than the processer register width.
How hard can it be to access and manipulate data in its natural and purest form?
Why do the so called modern programming language ignore this simple aspect that is needed on an everyday basis?10 -
Boss: “Our ecommerce conversions in Google Analytics are less than the actual pace of orders.”
Me: “Nothing has changed in the tracking code or setup. It must be our goals setup which you have to have a Ph.D. to understand, plus whatever mood Google’s algorithms are in today.”
He’s not mad at me. We’re both just confused why Google AdWords, Analytics, and Tag Manager have to be so damn hard to get right. I’ve never been able to do it right. And most data is thrown out because people browse websites while logged into their Google Account, which makes their clickstream disappear and become unattributable because of understandable privacy policies. I don’t want my data tracked when I’m logged in either!
So now we have had to hire specialists at several thousand dollars per month to figure this out. -
It's funny how you start feeling bad for the next dev taking over your project because it turned into a total spaghetti code shit show that will be impossible to maintain in the future with new features coming in.
Honestly... if a projects starts out with a certain scope which then gets extended EVERY FUCKING WEEK with requirements that can't even be met in the initial timeframe it's no wonder the code quality will decrease over time.
This just reminds me daily how important good project management (and I'm not talking about suit wearing pain-in-the-ass-managers) and the inclusion of devs in the planning process really is.
It's so fucking crazy that companies run like that with people up front that have NO FUCKING CLUE what they are doing, nor do they understand the mechanics, tech and effort that go into certain features. They're like "beep, boop, it's done by Friday you fuck!".
The funniest part of this stupid charade is that the closer we get to a new "deadline" (we will not meet the deadline anyways) the more nervous the "managers" get. WHY didn't you properly plan this shit in the first place? WHY didn't you care for the last six months where all this fucking bullshit could still have been prevented?
Meanwhile I'm just so sick and tired of this shitty project and this sucky company that I just don't have any motivation left to keep on working. It's so fucking hard and painful to work on projects that suck ass, are poorly designed. I just got to the point where coding is no fun any more. Thank god I'm out of here soon... fml5 -
Fun fact: banks won't let me take loans. Any kind of loans.
Why? It's not because I have a history of missing payment schedules. It's because I NEVER had a credit card or loans — I paid for everything with cold hard cash my whole life. But it all changed when I fried a charging controller on my laptop, so I needed a new one fast. I was in between jobs then. So, I took a loan for a new laptop, one thousand dollars, a large sum for me back then. I found a job and covered that loan ahead of schedule, in three months instead of one year. In total, my bank made a mere $5 off of me.
Banks now know I won't bring any kind of interest in whatsoever, as I never miss my payments. So, they decided to quit on me completely.
That's a proof that banks don't want you to pay on time — they want you to delay your payments and let your interest build up, so you're forced to take new loans to cover old ones. They want you to pay interest forever, having barely enough money to cover interest, but not the loan itself.17 -
The saddest and funniest side of our industry is (atleast in India): someone works hard and makes it to the best colleges, do great projects on AI, ML; get a good score on Leetcode, codechef; gets a job in FAANG-like companies...
Changes colors in CSS and texts in HTML.
And, why is there so much emphasis on Data Structures and Algorithms? I mean, a little bit is fine, but why get obsessed with it when you never write algorithms in production code?
Now, don't tell me that, we use libraries and we should know what we are doing, no, we don't use algorithms even in libraries.
Now, before you tell me that MySQL uses B-tree for maintaining indexes, you really don't need to solve tricky questions to be able to understand how a B-tree works.
It's just absurd.
I know how to little bit on how design scalable systems.
I know how to write good code that is both modular and extensible.
I know how to mentor interns and turn them into employees.
I know how to mentor junior engineers (freshers) and help them get started.
Heck I can even invert a binary tree.
But some FAANG company would reject me because I cannot solve a very tricky dynamic programming question.4 -
Heh promotion? I only get fake promotion..
For two years, I was doing so many *free* overtime, manager is a big liar, he said that it will he considered on the yearly evaluation.. cool, the thing is there is no evaluation at all, just lying and lying.
Few months ago I took a vacation of 1 month (I am expatriate so I get one vacation per year, my home town is too far..) I talked to tye manager about salary taise and he said absolutely we will talk after I get back..
He called me during my vacation to do some urgent (as always) work, I worked about 5 days, and for free.
After I get back to work, he was angry about my *attitude* that I wasn't available more time.. oh and there was no fucking raise. always lying..
In this country, if you're an expatriate so you can travel outside the country without the validation of the employer (yeah like that) and the notes period is about 3 months, what makes very hard to find another job, no one will wait for 3 months, unless you vanish during a vacation.
So, why didn't I gave my resignation? well, life is hard when you have unemployed wife and a little baby, and the pay is, let's say OK comparing to costs here.
I am charged to learn and work with another language and framework, and when I asked for a raise they said no, so I will stop working in this language and let's see..
The problem is that other employees in thus company are literally bitches, they don't say no to anything, so I am the special guy here who does not a blowjob..
So, what do I do? I am hunting for a new job since a while but no luck.4 -
Why don't people respond to emails? Everyone complains that things could be handled in an email instead of having a meeting. Well maybe you should start replying to my simple fucking questions so I don't have to send meeting notices. You always accept the meeting notices but you NEVER reply to emails! What the fuck people? Now I'm arranging a meeting for 15 minutes just to get a simple is yes or no question answered, are you kidding me here? You're part of the problem! You are THE ENTIRE problem!! You know how much of my time I've wasted getting no answers in IMs and emails?! Should I try smoke signals? It's not even a hard question! Will someone be at the site on the day we need them to be?! How hard is that question to answer!? Evidently im-fucking-possible!5
-
!rant
so the other day i was programming and suddenly i wanted to learn haskell. (i don't know why it hit me so suddenly, maybe because it's a 'pure' functional programming language and these 2 terms i knew nothing about)
and to be honest it's really hard coming from an imperative programming language (C/C++, yes, i know they are different in their ways). it's like learning to program again! you really have to get a different mindset and for me honestly it's hard to grasp the idea that 'variables' are immutable! like, that's soooo weird it still stucks to me. for example how did they define the max or min function without using a while loop? what are monads?
I am just 2 days in but it'll be a fun ride!6 -
A new currency is emerging in our industry. It is called "blame".
Who is to blame if we don't meet the deadline?
Who is to blame if the rushed release has x bugs?
Who is to blame if nightly build breaks, because our CI-Server is an old hunk of junk and "management" didn't approve the upgrade?
Our customer blames the delay in HIS infrastructure on us, because our system requirements are too high.
Blame blame blame. This currency is the new idol of our management team. Everyone gets blamed. They manage their "blame" ledgers instead of approving the tools we need or give us reasonable deadlines. Why Lord, oh why are there SO MANY MORONS in managment? You know what, dear "managers"? FUCK YOU., FUCK YOU SO HARD YOUR MOM WON'T RECOGNIZE YOU. YOU COULDN'T POUR PISS OUT OF A BOOT WITH INSTRUCTIONS ON THE HEEL.4 -
So I work in a web development company in my town and have been doing a while or heap of parallax sites for our clients. Now obviously when we do the designs we get them in and get them to play around with the site before we go ahead and push their new site out and make it live right.
Wellll who would of thought that a simple parallax site would be so hard to use for the general user??? Recently we have been getting the occasional call where the client is getting complaints about the site only being a big ole image or just one block of text. After investigating why their site was broken or why the users weren't able to see the whole site I came across no problems at all.
Today I got a call from the client who instructed me that after explaining to one of his own clients that he had to scroll down the page that everything was just fine!
I mean, what? How do you miss the big ole scroll bar on ya screen or even think to even attempt to scroll? Some people aye lmao2 -
Oh lord it's finnaly happened, I'm almost tempted to leave my retail job after 4 years, fucking head office and lazy ass managers im driving me fucking insane, they give you a 2 person job and complain when you don't have it all done by lunch.
Why must finding an enjoyable job be so fucking hard! -
I used to be a sysadmin and to some extent I still am. But I absolutely fucking hated the software I had to work with, despite server software having a focus on stability and rigid testing instead of new features *cough* bugs.
After ranting about the "do I really have to do everything myself?!" for long enough, I went ahead and did it. Problem is, the list of stuff to do is years upon years long. Off the top of my head, there's this Android application called DAVx5. It's a CalDAV / CardDAV client. Both of those are extensions to WebDAV which in turn is an extension of HTTP. Should be simple enough. Should be! I paid for that godforsaken piece of software, but don't you dare to delete a calendar entry. Don't you dare to update it in one place and expect it to push that change to another device. And despite "server errors" (the client is fucked, face it you piece of trash app!), just keep on trying, trying and trying some more. Error handling be damned! Notifications be damned! One week that piece of shit lasted for, on 2 Android phones. The Radicale server, that's still running. Both phones however are now out of sync and both of them are complaining about "400 I fucked up my request".
Now that is just a simple example. CalDAV and CardDAV are not complicated protocols. In fact you'd be surprised how easy most protocols are. SMTP email? That's 4 commands and spammers still fuck it up. HTTP GET? That's just 1 command. You may have to do it a few times over to request all the JavaScript shit, but still. None of this is hard. Why do people still keep fucking it up? Is reading a fucking RFC when you're implementing a goddamn protocol so damn hard? Correctness be damned, just like the memory? If you're one of those people, kill yourself.
So yeah. I started writing my own implementations out of pure spite. Because I hated the industry so fucking much. And surprisingly, my software does tend to be lightweight and usually reasonably stable. I wonder why! Maybe it's because I care. Maybe people should care more often about their trade, rather than those filthy 6 figures. There's a reason why you're being paid that much. Writing a steaming pile of dogshit shouldn't be one of them.6 -
I'm writing a book that teaches everything I have learned in the past 20 years about writing small niche software and selling it.
Need some help from my fellow DevRanters.
Anyone who comments here with something constructive gets a free copy when it's done.
When I say:
"Why don't you just write your own software and sell it to end users"
What is the first thing that pops into your head?
Is it "I don't know how to advertise"
or
"that's a pipe dream"
or
"I tried starting my own business, but _______"
or
"I am doing that, i have this side project "
(how long have you spent on that side project?)
I need to know all your concerns questions fears, skepticism etc around the idea of writing your OWN software.
After 20 years I have like, so much knowledge, but it's sometimes hard to get it all out, UNLESS someone has a question or concern, then, out it comes.
So, I'm going to (hopefully) collect all the questions here ... and answer them, and it'll help me out a lot to extract this knowledge.
A lot of stuff I do without even thinking and realizing all the years it took to even know that.
What would you like to know the most?
You have the skills, you have the know how, you can probably see it in your head, so what's stopping you from making the leap?question your own business why the fuck haven't you started yet no more bosses no more clients residual income from a one time effort no more teams32 -
I work in a big corporate world where I felt really out of place at first. I didn’t enjoy working there, I could not understand why people would work so hard to keep all the systems happy. No one thanked them, no one gave the smart people maintaining the important systems any credits. I did not understand. Why did they care so much for these systems?
My team split. We were too many with too many systems to care for. After this my team was a lot smaller and therefore I ended up in a more important role. I was forced to do these tasks the more senior engineers had done before me, in the previous team. This was the greatest thing that could happen to me, and I started to like coming into work. Now our team is big again but I’m one of the senior people in it. Not senior as in years active in the industry but senior as in knows the most about our systems and our work environment. I work hard to constantly share my knowledge and try to put the newer members in situations where they also have to take responsibility.
Don’t be afraid to put important tasks on junior or new people. They might fuck up but they will learn, as will you. Don’t hog your knowledge and your team will thank you.1 -
I've been writing Java the last few days. Really makes me remember why I enjoy writing objective c / swift so much. It's not necessarily the crazy syntax of objective c. It's the conventions behind the languages. It's very easy to make your code read like prose. Which when you become used to this it's very hard to jump back into spaghetti code with abbreviated variable names and such.3
-
Its so disheartening to see how easily replacable you are if you work for someone else, no matter how hard you worked. The moment you say " I am resigning", the behaviour of your manager changes so dramatically. Its like you don't exist anymore. No more new interesting work, no nothing. Why!!!!7
-
Yay, Dubba didnt die.
Okay, hello'ed back, lets fucking rant.
Im fucking SICK and TIRED and ANNOYED by all freaking cloud fanboys. Yeah, sure. You get scalability. You waste less resources. Sure. But it depends on use case. There is suprising ammount of services that can be run on VPS or dedicated servers that will be a lot cheaper if you just DONT run it on cloud. And dont you dare to missinterpret me. I fully recognize that there are valid uses for cloud services. But for fuck sakes, its not anwser for ALL of your needs, and it costs insane ammount of money if you use it where you should use dedicated.
WHY we, as humanity came to this place where self-claimed "proffesionals" will anwser you "cloud" before you even ask your question.
No, fuck off, take calculator and think for around 60 seconds. And than decide if you need cloud or not.
And no, this mail server will be fucking few times more expensive on cloud, and I know it becouse I have fucking calculator and I was running it past 1.5 year and actually run sometimes htop, so stop bullshitting me.
Sorry if some cloud die-hard felt offended but it is exacly how I see and feel it.
Peace.1 -
Seriously how hard is it to observe proper indentation! Don't mix spaces and tabs! That's why I added the .editorrc .jshintrc .jscsrc in the project repo so you'd use it. I asked you to configure your editor and the only thing you configured was your freaking Sublime theme and color scheme. aaaaargh!!!!!1
-
Why does noone implement autoupdater, especialy on linux side? Is there a reason i dont get? Sure, most system stuff is better in apt, but if i install servers, i do not want to wait for these stupid linux release timings! If it were hard, id understand. But most of this is possible with something like GitHub API and 20 Minutes of time. I mean, yeah backwards compatibility and what not, but then handle that internaly.
Example: I use dnsmasq on a raspberry pi. RPI is running raspbian. Raspian is debian 8. Debian 8 has a version of dnsmasq with a pretty annoying bug, which prevents me from using dnssec, as i cant open any cloudflare pages. Why, o why isnt this updated at MY will? Then, if it isnt, why is it so impossible hard to compile this myself, no docs for that, no binaries, NOTHING? Dear server devs, please add atleast basic autoupdate functionality without having to rely on the base os.
Or, give me easily deployable binaries, if you cant write something integrated.12 -
"let's put an advert right next to the login/registration area so everyone can see the ads"
Thanks for reminding why I love adblock, how retarded you are and why you should never be allowed to touch ux/ui.
f your theory about users != customers.
Hope better ads standards slaps in your face, HARD1 -
Why is it so hard to remember, that devs need an error message if they should help you. just saying "it does not work" is not helping.
I even wrote you a checklist. so f*ing use it! I'm not there to be called every time just to tell you to do something that's already on this list.
Every. F**ing. Time.2 -
So I get an email from college career development for a web developer & designer position.
Read into the requirements & function, I find this....
Who the fuck does put HARD CODING before CODING.. why would you even put that on the requirements. People are going to read that and find out how you run your company.
We all do some hard coding here & there but recruiters think it's a skill that comes before coding.. hard coding isn't coding hard...
They don't say company's name in email so I got suspicious.. or perhaps I thought I can be a detective lol. I was able to find out the company and looked at their Glassdoor.
Of course they have 1.6 stars.. two 1 star reviews by their employees. I can just imagine the horror working at this place lol.
Oh & the manager makes something like 110k.3 -
Who knew that NOT using results given from an API can actually help.
The private devRant APIs give you offsets in text of where links are in comments and in rants.
It’s EXTREMELY inaccurate and I don’t understand why it’s so hard to write it so it’s accurate 100% of the time.
So I said fuck it and NOT use the given offsets and just hard-find using the built-in algorithms inside Swift to create the range for me. Results? It works 100% of the time. No crashes, no out-of-range errors, no nothing.8 -
If you've ever tried using Go plugins raise your hand.
If you've ever tried doing plugins in Go, raise your hand.
If you think that the following rant will be interesting, raise your hand.
If you raised your hand, press [Read More]:
This is a tale of pain and sorrow, the sorrow of discovering that what could be a wonderful feature is woefully incomplete, and won't be for a very long time...
Go plugins are a cool feature: dynamically load pre-compiled code, and interact with it in a useful and relatively performant way (e.g. for dynamically extending the capabilities of your program). So far it sounds great, I know right?
Now let me list off some issues (in order of me remembering them):
1. You can't unload them (due to some bs about dlopen), so you need to restart the application...
2. They bundle the stdlib like a regular Go binary, despite the fact that they're meant to be dynamic!
3. #2 wouldn't be so bad if they didn't also require identical versions of all dependencies in both binaries (meaning you'd need to vendor the dependencies, and also hope you are using the right Go version).
4. You need to use -trimpath or everything dies...
All in all, they are broken and no one is rushing to fix it (literally, the Go team said they aren't really supporting it currently...).
So what other options are there for making plugins in Go?
There's the Hashicorp method of using RPC, where you have two separate applications one the plugin, one the plugin server, and they communicate over RPC. I don't like it. Why? Because it feels like a hack, it's not really efficient and it carries a fear of a limitation that I don't like...
Then we come to a somewhat more clever approach: using Lua (or any other scripting language), it's well known, it's what everyone uses (at least in games...). But, it simply is too hard to use, all the Go Lua VMs I could find were simply too hard to set up...
Now we come to the most creative option I've seen yet: WASM. Now you ask "WASM!? But that's a web thing, how are you gonna make that work?" Indeed, my son, it is a web thing, but that doesn't mean I can't use it! Someone made a WASM VM for Go, and the pros are that you can use any WASM supporting language (i.e. any/all of them). Problem inefficient, PITA to use, and also suffers from the same issues that were preventing me from using Lua.
Enter Yaegi, a Go interpreter created by the same guys who made (and named) Traefik. Yes, you heard me right, an INTERPRETER (i.e. like python) so while it's not super performant (and possibly suffering from large inefficiency issues), it's very easy to set up, and it means that my plugins can still be written in Go (yay)! However, don't think this method doesn't have its own issues, there's still the problem of effectively abstracting different types of plugins without requiring too much boilerplate (a hard problem that I'm actively working on, commits coming soon). However, this still feels to be the best option.
As you can see, doing plugins in Go is a very hard problem. In the coming weeks (hopefully), I'm going to (attempt to at least) benchmark all the different options, as well as publish a library that should help make using Yaegi based plugins easier. All of this stuff will go (see what I did there 😉) in a nice blog post that better explains the issues and solutions. But until then I have some coding to do...
Have a good night(/day)!13 -
FUCK YOU MICROSOFT
Visual studio shouldn't be allowed to fucking exist in its current form, it takes FOREVER TO FUCKING LOAD unresponsive lagging piece of fucking shit. I'd expect such loading times for a modern AAA game but not a fucking so called functional application, holy fucking shit...
Why must everything be so fucking hard using this thing? I need to change default intellisense settings as not to get in my fucking way while learning, after getting more stressed trying to find out how to edit the settings which are listed under TOOLS, WHAT THE FUCKING FUCK? It should be under edit not fucking tools, editing settings is not a fucking tool you fucking dense cunts. I spend the next 10 minutes looking for intellisense settings only to find you have options for enabled, disabled and default how the fuck does that help anyone?
Firstly it should have its own fucking section since its such a massive bloaty intrusive feature. I should not have to first click C# and then be presented with limited controls.
FUCK YOU, FUCK YOU, ALT + F4 UNINSTALLED THAT PIECE OF FUCKING SHITE , MILTI BILLION DOLLAR COMPANY WANTS FUCKING MONEY FOR THIS PILE OF SHIT.
Go fuck yourselves.10 -
Fucking hell! Why is it so hard to just create a simple websocket!
C#: Yeah, you should use ASP.Net with SignalR! But heres a totally undocumented mess of a lib to get it to work. J.k. Deadlock!
Rust: async while let OK((some)) = ws.create.unwrap_or_else().suckadick()
Why the fuck is Rust so fucking dense! I want one line that means one thing! If I would compress my code with gzip it would be less information dense than this!
Zig: Yeah, Its in Beta and shits semi stable. Atleast i got it to work? Nope!
I've ben fussing aound with these three Languages for more than a week now and can say: Just use an established way to webdev. Its not worth it to try and make it as simple as possible!4 -
Why is so hard to find engineers that actually care? It feels like the majority of people always want to do the bear minimum, no one wants to fix their shitty code even when it clearly violates the project or company standards. Everyone constantly comes up with shit about why they can't do things properly or how they'll fix it later and then get their mates to push their shit through review. The majority of lower management usually care equally as little so there's no point explaining the situation to them and the lack of care probably goes much higher. It seems like so many people go from job to job getting bump after bump in salary, which granted is absolutely fine and probably advised, but have nothing to show for it. Usually very little skills but alleged mountains of experience and a lazy piece of shit attitude. I hear all the time people saying you'll never change anything so why try and it feels like that most of the time but more because everyone keeps saying it. If everyone pulled their fingers out their arse, maybe we would stand a chance. I'm sure a lot of people on here have a real passion for computer science, whichever division you're in and love to learn and improve and reflect. What I really want to know is how you deal with people who are just taking their paycheck and enjoying the ride but don't actually care and how you discover these people as early on as possible to get shot of them.14
-
Oh boy the schools in the Netherlands have began again, the amount of people in the train is insane... (Also one of my biggest annoyances is) the way how people pile on top of the check-in checkout poles... They try to do it as fast as possible, but because it is an unstructured pile of garbage... It takes way too long...
Is it so hard to stand in a line and just keep your card STIL AND CORRECTLY INFRONT OF THE NFC READER!?
apparently it is because I see people slamming their wallets against it, moving it around wildly and keeping up the line being Angry why the reader can't detect their card... In their wallet, probably between multiple other NFC cards within a second (BECAUSE YOU KEEP MOVING IT FROM THE READER TO THE FUCKING SCREEN!!! WTF)2 -
So.. name one fucken case where your database is not a computer backed thing.
Just asking because.. why the fuck? I don't think your database server supports input of fucking math symbols? JUST USE HUMAN LANGUAGE, AS YOU HAVE TO DO ANYWAY!
It's stupid how everything needs to be expressed mathematically ffs. Not that it's hard to understand - it's just more complex than of a very simple wording.5 -
This always gets me:
Developers complaining that their 4 year old / cheap ass computer is slow.
Get. A. New. One.
It's not that hard.
Here, let me do one for you:
https://computeruniverse.net/en/...
I just went to a site that delivers across Europe, and selected a cheap laptop with a decent CPU and SSD. Short on RAM, sure, and without a Windows License. But you can buy RAM for an additional 50$, and that brings you to a total of 550€, delivery included. And it will WORK. And it will be fast.
It's too expensive?
No, not exactly. Wherever you are in the world, if you can code decently, good enough to have the right to complain about development tools, you are eligible to at least 10$ per hour income as a freelancer across the globe. I've had such opportunities offered to me by many organizations, especially non-profit ones that need cheap employees. I actually was offered more but let's stick to 10$ per hour.
So that's 1600$ per month. Enough to buy 3 such laptops. Oh, taxes, I forgot. So you get 2 laptops. Wait! You need food and everything else. Well if you're in a country where that offer actually makes sense, then it's likely that you can live off of 400$ per month quite well. Maybe 800$ if you need to pay rent.
So that's roughly 1 month of work for a laptop that will make you not waste time on waiting for stuff.
Sweet! 1 Month! What does it get me?
Well assuming that you have no laptop, it gets you A JOB that pays you 1600$ per month.
But if you DO have a laptop, you can sell it for cheap, and benefit from the following:
1. Boot-up time from 30-60 seconds to 10 seconds.
2. Installing software - from 1 minute to 10 seconds.
3. Opening a browser - from 10 seconds to 1 second.
4. Opening an advanced text editor (Atom, VS.Code) - from 10 seconds to 1 second.
5. Searching for a file on your entire hard drive - from 1 hour to 2 minutes.
....
You get the point. Waiting is reduced by several times.
So how much do you really wait when coding?
Well are you compiling? Are you opening a new project and the IDE needs to re-index the files? Are you opening programs like a terminal emulator, browser and such? Are you using virtual machines for dev environments?
Well all of these processes become several times faster. Depending on how often you do it, you'll be saving yourself from 1 hour per day to upto 4 hours per day (my case, where a HDD would be just out of the question).
How much is that time worth? At least 10$ per day. If you're working for 20 days per month, 240 days per year, that's a total of 2400$. And for the life time of that crappy laptop of 2 years, that's 4800$ saved. And that's with hugely conservative numbers. Nobody pays 10$ per hour any more, except if you've just started in the industry. I know because I've been there.
Please, for all that's sacred to you, justify right here, right now, HOW THE FUCK can you not afford to get that 8GB of RAM, that cheap ass SSD for 100$, or even a brand new laptop (hey! it's even portable and has FHD graphics on it!) for 550$.
That's why every time I hear someone who is a professional developer complain that they don't have money for a decent machine, I have to ask: why the fuck are you wasting yours and everyone else's time?!10 -
I'm a C++/Obj-C programmer finding it ludicrously hard to switch to Swift.
I find that the constant ability (leading to very poor programmer code) to reduce syntax and add tokens reduces readability and nowhere is this more apparent that with closures.
I'm working through (to my shame) Ray Wenderlich's Swift course and the closure chapter has this:
PS I loathe K&R as much as I do Swift so it's all in Allman formatting for clarity.
let multiply: (Int, Int) -> Int =
{
(a: Int, b: Int) -> Int in
// do Something else
return a * b
}
Why oh why isn't this more simply and elegantly written as:
let multiply = (a: Int, b: Int) -> Int
{
// do Something else
return a * b
}
The equals sign shows clearly that it's a closure definition assignment, as does the starting 'let'. But this way all of the stupid excesses, like the 'in' keyword, the repetition of the params / return type only this time with useful labels and additional tokens are removed and it looks and reads much more like a regular function and certainly a lot more clearly.
Now I know that with the stupid ability of Swift you can reduce all this down to return $0 * $1, but the point I'm making is that a) that's not as clear and more importantly b) if this closure does something more than just one line of code, then all that complicated stuff - hinted to by the comment '// do Something else' means you can't reduce it to stupid tokens.
So, when you have a clousure that has a lot of stuff going on and you can't reduce it to stupid minimalism, then why isn't is formatted and syntactically better like the suggestion above?
I've mentioned this on the Swift.org (and got banned for criticising Swift) but the suggestions they came up with were 'use type inference' to remove the first set of params / return type and token.
But that still means the param list and return type are NOT on the same line as the declaration and you still need the stupid 'in' keyword!5 -
I think the one of the more common reason for imposter syndrome is that a lot of smart people constantly get told as children the "you're so smart/capable, you can do everything!" too much, and when you hear it enough times, it gets to you, so you think everything is just easy. And then when they start hitting roadblocks, instead of helping or explaining that it's normal for things to be hard and it's normal to fail, usually parents and teachers and whatnot tell them "Oh it's okay, don't worry about it, you're smart, you'll get it" and so they at first it works, maybe it just takes more time but they manage, but as things get harder and they still put little effort because "don't worry, you're so smart, you learn so fast/easy" and as they find out more and more things they don't umderstand or don't know they start to feel a dissonance, which builds anxiety.
And this is where I thinks it actually starts: at some points there comes a situation where they either share this anxiety with someone or someone notices their worry, and(at least from what I've seen from others) usually the response they get is something along the lines of: "Nah, you're just worrying too much, you're smarter than you think, don't be so down on yourself, you need to worry less", which, maybe I'm wrong, but I'm not sure telling someone that thinks he has a problem that he doesn't have a problem, helps their worrying.
And on one hand the amount if things they don't get/know/understand or fail at grows(cuz you can't just be good at EVERYTHING, so the more things you know about, the more things you don't understand) while mentally still being in that "Wait a minute, you're smarter than this, you should be getting this!" mindset that's been drilled into them, and so at some point the illusion shatters, and they start to think "Maybe I'm not so smart after all", and because they think they were wrong about their level, they feel like they have "oversold" themselves in the past and that makes any past accomplishments feel like lucky accidents instead: "If I'm not actually smart, the things I did manage to achieve must've been just accidental", which makes them feel like they've lied to themselves and everyone else when they "took credit for an accidents" and that their life is just a snowball of pretending.
Now, is that actually a cause or is it another one of my crazy 1AM ramblings? I don't know xD
I'm not an expert in any of this and I don't really know any psychology so hell if I know if that's how any of this works but that's just my theory of one of the reasons why. *shrug*. I've had this theory for years, but I don't know.
It at least makes sense to me, but not everything that makes sense is true soooo.
Anyways, wall of text is over.
Oh, and for anyone struggling with imposter syndrome: I just want you to know, it's okay to fail, and it's okay to not know shit, especially in the dev industry where every "insignificant" detail can have an entire rabbit hole of expertise behind it, nobody can expect to know every part of it. And it doesn't make you any less smart no matter how much you fail. Tnis shit is hard, so I hope you stay strong and I hope you succeed in whatever it is you're struggling with.
*Massive virtual hug* <31 -
It's so fucking hard to explain my job to people who don't have slightly idea about it
Person : what you do?
Me : Web development
P : what's that?
M : you know websites on internet for users or clients for products/information bla bla bla
P : like amazon, facebook, xyz ?
M : Yeah you get it
P : so you develop facebook?
M : huhh.... No not that I'm not working for FB that's a different company we create websites according to clients.
(Inner me: why don't you fuck off already)
P : huh... Okay ( no fucks given )1 -
Not really coding, but debugging complex problems. I love it when I have to dive in head-first and dig (very) deep to find answers to super-complex problems. I once went into the internals of a programming language to understand why a library was acting up in a particular scenario. Another time I had to optimize and re-compile from source (after modifying it) so that the application would not leak its memory. (Of course, I contributed it back to the language).
The inner satisfaction that you get after all that hard-work when it finally works, pays off! Bliss!1 -
Well it’s Sunday so last day to leave my thoughts on probably the only topic that’s current to me.
I think you should pay teachers a competitive salary.
The problem with teaching CS at high school level especially (in university there are grants, actually competitive salaries between unis and other perks) is if a person is versed in programming/cs theory why would they settle for a $40k job? When the alternative is finding a job in the field where salaries are around $80k+ (this figure came from my head, can’t remember the source) it’s hard to justify going into teaching even if you would enjoy it more than a desk job.
If the salary difference was smaller then one could maybe justify liking work over pay but here it’s basically double difference... Kinda makes you understand why some comp sci teachers seem incompetent in even using their own computer. Yes there will always be that odd person out who will teach (or go to a private school and negotiate a workable salary) but until education becomes a priority for government salaries there will be very limited progress, if any.
You can do anything to the syllabus, make it more verbose, make it appeal to the lowest common denominator, but if you can’t find people to teach it (and know it themselves) you are really screwed.1 -
Just saw someone trying to sell an internal 4TB hard drive because they thought they ordered an external drive...
The internal drive is a server grade fucking drive?!?!
Surely you would be confused as to why the price for what you thought was an external hard drive was so damn high?!3 -
Ok Rust help you write robust safe code and is very fast.
But at what cost ?
But why on earth the syntax is very disgusting. It takes time to familiarize with the horrible syntax.
And I feel like the sadistic rust cult members actually enjoy making it hard to read so that they can jump on any occasion to shout at you : you still lacking rustlang skills
Fuck that shit I'd rather write in golang or just deal with C++ . At least their syntax doesn't make me wanna puck11 -
When someone writes a Flutter app like it's 1998 and blames Flutter for being "too hard" and "DIfficult"
First of all… WTF?
This guy wrote an entire Flutter app like it's HTML + CSS cosplay. No use of Flutter’s built-in Drawer, AppBar, or BottomNavigationBar. Instead? He manually built his own versions of all of them using Container, Row, and Column, all dumped inside the body. Literal pixel pushing. He made a fake AppBar inside the body. A fake Drawer inside the body. A fake BottomNav inside the body. It's like UI inception. Then he turns around and says “Flutter is hard.”
Bro… you made it hard. Flutter gave you prebuilt widgets. You chose pain.
Zero data structures. No architecture. No MVC.
The only MVC I found was: Multiple Voids in Class.
And the documentation? It's literally been around since 2018. Not even buried, just a Google search away.
Then came the excuses:
“Oh he’s from a Delphi / ASP.NET background, so Flutter is difficult for him.”
No. I’ve coded in Erlang and COBOL. You don’t see me turning Flutter into Erlang’s syntax disaster or WRITING DART IN ALL CAPS like COBOL.
Choose a paradigm. Functional? Procedural? OOP? Fine. Just don’t mix all three into some cursed hybrid mess.
What did I see in the code?
Recursion inside recursion for no reason
Functional programming patterns mixed with anti-OOP logic
500+ functions declared, zero referenced
Authentication by writing to file.txt. Like… bro, why?
And then there’s navigation. He stored route info in both SQLite AND SharedPreferences before pushing a new route. Why both? Why at all?
Honestly, Flutter has been one of the cleanest and most developer-friendly frameworks I’ve used. Dart is readable, fast, and predictable. But somehow this guy managed to turn a simple Flutter app into a twisted assembly simulator from hell.
Flutter didn’t fail him. He failed Flutter.
And yeah — the project folder was named Flutter_UI_Test_FINAL_v2_Rebuild_2023_OK and full of main_old.dart, main_old(copy).dart, main.dart.bak. I should’ve known from the start.
Really.......Some dev are idk what to describe
refer: https://devrant.com/rants/18897167/...10 -
"My generation's obsession with having established careers before 25 has led to everyone being hyper competitive, opportunistic, self-centered and deeply insecure. I wish everyone could relax a bit!"
I came across this quote few days back and I don't know why but this did hit me hard. Every word was so so true, I wish I along with everyone of this age group could relax a bit and enjoy this wonderful life.
Do you feel the same as I do, or is it just me ?9 -
Annoying Indian professors are everywhere. It's a computer vision class are you really teaching us Regression?
What about transfer learning? object detection! Give us papers to read, let's do projects.. what the hell is this I am going take attendance bullshit and teaching crappy concepts.
I did not sign up for this shit! I came here for my Masters to get away from pompous mother fuckers like you ...
My class is also filled with those idiots,who think bias in a neural network is somehow related to class imbalance ? Now the same idiot proceeds to ask questions like...
Why would the weights change in a neural network?
Motherfucker why you in this class ? Why don't you stick to your shit and ask these questions later..
I am so pissed off right now guys ...
I was sitting in my lab understanding the deeper insights of BN, activation fucntions.. various optimizers ..etc Stuff that this idiot motherfucking teacher must be covering... UGGH.
I shouldn't cuss so much.. or at least add variety to my cuss words..
I am pissed off cuz instead of learning the shit I should be learning I am forced to come and attend this class and waste 2 hrs of my life ...
It's the summer i find it hard to focus anyway (want to go out hiking or swimming or something.) BUT. the moment I find some resolve to focus
I get this fucking bullshit.. !
My mind is so fucked right now... I can't think of anything but standing up in class and screaming " Mother fucker, mother fucker...(point to the idiots in class you) motherfuckers shut the fuck up..
Can someone suggest some colorful swear words ?
My brains not working -_-
It is just about now that I start feeling like "Anger" from inside out9 -
Why does everything installed via npm sux so hard?
Why the fuck does any minor update in their bullshit packages either forces you to change config files:
E.g. now should be "@babel/core" instead of "babel-core" - WHAT A FUCKING SIGNIFICANT CHANGE!!! Rewrite all you configs motherfucker, that goddamn "@" in front of our shit is SO IMPORTANT that we will break everything to add it
Or breaks the code internally:
Consider the recent fail of fucking Terser [https://github.com/gatsbyjs/gatsby/...] that breaks fucking webpack and FORCE YOU TO ROLLBACK TO ANY VERSION THAT WORKS, why you nerd retards, can not run a simple dummy project BEFORE YOU RELEASE YOUR SHIT???!?!!?
Why any fucking update from *.*.1 to *.*.2 turns into hours of googling of what the fuck got broken this time??
The way that webpack, babel and other npm packages are released nowadays is absolutely retarded. I really have a strong feeling that it is better to keep old error-proof working config and NEVER UPDATE, than constantly suffer from butthurt
p.s.
Of course I am sorry for all the hate and caps in my post, and have respect for guys that develop amazing stuff for us for free, but I need to share this5 -
I have never understood why there is so much animosity from seasoned devs in the community.
I see it in a lot of places. Stackoverflow, reddit, even devRant. In so many cases, an inexperienced dev will post to the web, only to be shot down by things like "this question is stupid" or "you all have it too easy and its apparent you never learned basic CS principles" or things of that nature. In a lot of cases, these are generally unhelpful replies and often teach new devs to be wary of seeking help.
Please help me to understand, why this is.
Is it because the community is angry at these devs trying to get a high paying job by going to a bootcamp and shortcutting the hard work it takes to understand core CS principles to become a decent developer? Then why not take a moment to provide resources or insight to these folks so they can learn to be better?
Is it because the community feels that devs from bootcamps are just watering down the pool of talent making our worth decrease? I feel this isnt really valid because seasoned, experienced architects will always be needed to build good software. And at that, why are we not ensuring that the next wave of developers is equipped to handle tasks like that?
There are a lot of good people in this community who want to help and make the net a better place for all developers (after all, many of us consider it home), but there's a lot more people out there with really shitty attitudes, and it frustrates the hell out of me that my juniors now equate arrogant, self-entitled responses and attitudes with "seasoned devs" and discourages them from even bothering to get involved in the community.19 -
Sometimes I start to wonder, if people even read what I answer them in tickets... Why bother when you can just be above that all and just repeat your previous points?
When working somewhere, with destinct departments, its understandable that you send them a ticket, they evaluate that and you can figure something out together. The issue arrises, when the other person across the ticket does not seem to wanna acknowledge the information you provide.
I want a simple automation in Jira with webhooks, why is it so hard to read the docs I send and acknowledge it. It seems like they try to ignore what I am saying and just keep their once formed opinion.
It just makes me mad, when they don't even wanna talk about it in person/via a Meeting3 -
Okay soooo.... I have this laptop that I use a little less often but is bugging me about. So WINDOWS just decides to RAMP UP THE HARD DRIVE TO ALL HELL WHENEVER I NEED TO USE IT.
I have a few options:
- Replace the 1TB 5400RPM with a 120GB SSD and do Linux
- Replace the 1TB with the 120GB and do a fresh install of Windows
- Replace Windows with Linux, keeping the 1TB
- or reinstall Windows
Which do you suggest and why?4 -
We've got a big legacy app which we have to rewrite. The current client applications are only working on XP(!). We have to move the clients to the browser so we can finally get rid of all XP vm-s. The db schema is complex but still 1000+ stored procedures and functions and about a hundred tables with 13 years of data.
So I ask the guy responsible for maintaining the DB code. (he is ~25 years older than me)
me - Where is the source of the database. Which project?
he - Where would it be? It's in the db.
me - So we've got a huge db without VCS, upgrade/downgrade scripts, etc?
he - Yes. I don't get why young developers always want to use shiny new tech like git just because it is cool. It has nothing that an external usb backup drive can't do.
me - VCS has been around since the early 1980's...
he - If you really want, you can put it under git or whatever, so you can sleep better, but I still think it is stupid and a waste of time.
I get that it's hard to keep up, but getting personal... -
I was just getting frustrated how hard it can be to search on google for very specific subjects when it comes to development. So I thought, why hasn't anyone made a search engine just for developers so you don't get any bullshit in between.
I found apis.io but they only have 1076 documented apis in their db... lets collectively make this better!4 -
I'm so done with auth
it's more than a nightmare
it's a disgrace
why can't someone just be like "you know how auth and identity is hard? why don't we make it easy?"
I would pay so much for that9 -
why is it so hard to get a job, why do they make it hard to literally get a job so you can feed into their system and make profit for them anyway. false sense of scarcity makes me so angry and interviews or applications always ask questions completely irrelevant and even after you get a college degree that just makes you have the ability to even apply to half the places. i get that you want the best person, because if you have to pay them a wage at all then they better work for it (get 4 part time jobs and live paycheck to paycheck), but seriously??
humans need to work, it is as natural as eating or sleeping, its such fucking bullshit that the bourgeoisie made working unbearable enough that the few people the government deems unfit to work obviously wouldn't, because working sucks, but then they are seen as lazy. sometimes i just want to go out and do some cyber-terrorism yk ? /j10 -
WHY IS IT SO FUCKING HARD TO DOWNLOAD SOFTWARE FROM MEGACORPS??
Yes, am looking at you EMC, Oracle and IBM. Either they have tons of portals-e-delivery-shittorama or their softwares suddenly disappear for n amount of time without notice. Mix this up with broken links or CONSTANTLY REBRANDING YOUR SHITTY PRODUCTS SO YOU NEED TO HIRE A PERSONAL ASSISTANT THAT ONLY WORKS WITH TRACKING THESE PORTALS TO HELL
Also, your websites are slow as shit.
Thank you.1 -
WTF if you want to program stuff learn how to use your programming language. Why is it so hard for that many people to learn how stuff works and stop copying blindly from the internet?
I have two colleagues who are doing nothing else that to just google their problems going to the first answer and cooping it then trying to run the program and if it doesn’t work ether give up completely or starting a loop of inserting the error message to google and copy the first result?3 -
Avast stoping my benchmark and reporting it to me is like a dog that proudly brings a bone to you while you walk with him on a cemetery.
I know about it before I started the benchmark so i deactivated it for 30min, but then for some reason (i may have accidently clicked on the symbol) the ui opened and everytime it does that it for some reason resets the option so it was active again. Now it deleted parts of the Software and I have a hard time making it run again. Fml and fuck monday. Why isn't there an option to make a fucking exception or remove something from their fucking virus container if it was a false alarm?6 -
God why is it so hard to let go with people around, especially potential friends or partners... It could be so easy to just have fun and do the things you always think about, but then you mess it up and that somehow.. purposely.3
-
Me, working hard on a SQL project with a deadline that is half what it should be with no support from the other people on the project and was mostly made with with data I imagined would be in there cos no one could get me any fucking shit done (i.e. effectively designed, built, tested, fixed, upgraded, documented on my own for an entire weekly/monthly/ad-hoc analysis process that would output various reports for internal/external/management)
Manager - man who is a known waste of space but for some reason is in charge of the smallest part of the project, shouldn't have been fucking involved fucking management guzzling stain magnet...
Manager: Hey, do I need to refresh the database?
Me: .................
Me: .................
Me: ............I dunno, do you think we should refresh the database that this entire project is reliant? I mean...why do we need up to date transactions to analyse? Wait....you telling me it's not been being refreshed this ENTIRE time?
Manager: No....you never said I should. So should I?
Me: ..................I never said you should!?!? Are you not in the meetings talking about dependencies?????? Do you think i should have up to date trans or just run this with old stuff????? Why would you not update it!??!!?!?!? Its transactions...... (Desperately trying not to punch through my screen, through his, into his throat)
Manager: ..............
Me: .................
Manager: I think i'll refresh it and add it to the job?
Me: ....................(goes back to work cursing with music in so I think its quiet but who knows).
Tard, don't know how he even gets to work without someone holding his fucking hand.
Happy ending, I don't work there anymore :p
Sad ending, his spirit of tard follows me to my new jobs and possesses someone (or three sometimes) -
Microsoft is always at it.
Hello, I recently discovered this eye candy of a looking website and how good the CSS looks (Kudos to whoever made this) , and I decided to post a rant of my own. And its about MS Edge and other applications.
So I built my own ATX tower a while back (Loving it) , and I found that it was WONDERFUL to have a computer that was brand new, that didnt have candy crush preinstalled on it when I got it.
Windows 10 users, do this:
Press WIN+I to open the settings menu.
Go to "Apps"
Scroll down the list....
How many applications do you see there that are actually useful , or that you have downloaded?
I never downloaded a Realtek Driver... and I never need it for anything to work. This is the case for 90% of the things you may see in the applications.
Why is HULU installed?
Why is NETFLIX installed?
Why is MINECRAFT BETA INSTALLED? THE BETA HASNT BEEN OUT IN YEARS?
But I digress, this is the case when I work on a computer such as my grandmothers who, bless her soul, isnt very adept at basic file management. Heck , she uses free Norton Antivirus against my recommendation to use the PAID active firewall application on her computer (VIPRE)
So needless to say she needs help. All the time.
So here comes microsoft recently, reinstalling like 15 different programs on her computer , including MS edge. Who else is tired of bloating? I know I am.
I recently found this program on Git!
Its the Sycnex Windows 10 DeBloater
But guess what? DONT USE IT.
Wanna know why?
Because if you do, it works, and if it works, it disables:
- Cortana (basic search engine for your OS, good luck finding candy crush).
- Microsoft Store (That means no XBOX games pass either)
- It breaks part of the file explorer
Wanna know why? BeCaUsE it geTs riD oF Ms EdGe
And believe it or not, apparently MS edges source code is Mandatory for certain functions on your computer. So even If you try to uninstall the browser, it stays behind in some form.
So there you have it. They hard coded it into windows.
Enjoy!
So its not even the author of the GITHUB programs fault, its just a real techincal limitation of the platform.
I hate that stuff man. I really do. There should be 20 things installed on my computer and thats it. Everything else is just, space for games on a solid state. Or Eclipse Photon, etc.
I would post links to show you guys a few things but. Unfortunately I cant post URLs yet!
However, thats my first rant. Hope you liked it.20 -
Story time!
I was with some friends, one a CS student and the other one's a mechanical engineer student with coding like a hobby.
I was listening to a song from which the band released the stems (individual tracks) of a song, and this dude made an anime version of it.
Me: Oh God, this is awesome
Mech: how did he do that?
Me: What? The song?
Mech: Yeah, how did he split the voice and everything, is the music like an Ajax request and he queried for the voice
Me and my other friend lock eyes and began to laugh so fucking hard.
Me: that's not how it works, why did you though that?
Mech: I don't know -
Computer society in High school
So while I was in high school, I got excited over the computer society because I thought I could learn a lot of programming stuff from them. I joined and quickly realized that that was a big mistake. They were teaching stuff that you learn from the computer classes in grammar school, eg MS Office, email clients.
I started to learn programming myself through learning online, eventually being the best student in the society. The teacher in charge chose me to teach the class next year, but it cannot be too advance as people would get bored and confused.
Why does classes have to be like this, cannot be too hard. Has to be something that clearly everyone knows. This kind of bullshit has to stop. -
Doing pair programming while I was navigating on somebody else's computer, we hit a weird behavior that our code changes weren't reflected.
Trying everything it turned out: I forgot to save.
Yet: Why though would you make me save? And why did the IDE not warn me about compiling unsaved changes? I think it was eclipse for Java, oh well. What can I expect ...
Anyways, I have gotten so used to my editors autosaving content for me as I write it, that I completely forget about doing Ctrl + S myself.
I never understood the need to hit that key combination manually as if I break something: `get reset --hard` will help to get me to a working state. (And even if I mess it up differently, my IDE's local history also let me restore recent changes.) And if it is a workign state, then I like to commit early and often. and
I am really dumbfounded why people insist on hitting save themselves.7 -
"Exception has been thrown by the target of an invocation"
This error message pisses me off. I know the SSIS Script component is capable of catching exceptions, you can wrap all your code in a try/catch (please don't) and get an exception. So would it be so hard that if the Script Component throws an exception that it tells me what it is instead of sending me on a goddamn scavenger hunt?
The whole bullshit system of errors is why I hate SSIS. Just tell me what went wrong.
I did what I wasn't supposed to do, wrapped it in a try catch and it gave me a stack trace and an error message and all sorts of actionable shit. But why the hell can't it just do that on its own?
There is literally nothing worse, except maybe Hitler, than a goddamn vague error message.4 -
Why the fuck are there so many utterly useless programming blogs? I have to implement DES in C++ for our college project. After coding most of it step by step, I decided to swallow my pride and check for an implementation online to save time because I was confused in the XOR part. Now most programming blogs had the same code copy pasted. To top that, NAME YOUR FUCKING VARIABLES PROPERLY YOU MORONS! I decided I'm better off resolving my confusions the hard way.3
-
For fuck sake why can't people implement instant payment charges when you order something and not when it gets shipped!
Ordered a board game for about $150 AUD about 3 months ago and my batch was just finished so I just got charged... It's not like a have a fucking trip to Melbourne with some mates this weekend .-.
It can't be that hard guys, charge people when they order and not when it's ready -.-10 -
I want to talk about media queries.
THERE ARE SO MANY FUCKING VIEWPORTS TO SUPPORT.
Seriously, why hasn't this shit been standardised; why does every new device *have* to be different dimensions from the rest?
Couldn't we have a S, M and LG scale for mobile, tablet and desktop????
Then we've got the fucking pleasure of DPR, as if it wasn't hard enough to be comprehensive for your shitty iPhone 5s.
Fuck you.4 -
Fuck C# for real, like why in the FUCK DO YOU NOT AT LEAST THROW A FUCKING EXCEPTION WHEN I TRY TO CONCENTRATE A STRING WITH NULL, I SPENT 40 MINUTES DEBUGGING THIS SHIT JESUS FUCK
Edit, note: I'm having classes that return null when they don't find something. Why is it so hard for the fucking compiler to at least warn me or some shit!!!!!!!!!!!!10 -
What does my current job hate descriptive names? Like to the point of active antagonism? We're a subscription based service. Why is SubscriptionExpiration the date you log in? Why does SubscriptionStatus only contain the name and id of product you're subscribed to and nothing to do with an actual status? All I need is the date a user subscribed. Why is this so hard!?!?7
-
FUCK ME IN MY INDICES.
FUCK THE GPUS IN THEIR INDICES.
I mean... I understand (roughly) why the meshes are sent to gpu in this form, but at the same time...
...there's a reason why first thing I did when I was coding my procedural geometry generation library, was abstracting away all of that stuff...
...sadly, as many useful things, when I was looking for that lib on the start of this contract, I couldn't find it. and I was like "doesn't matter, this is a simple thing, using the library would be just a lazy overkill anyway".
well, fuck.
two hours of playing around with two fucking triangles, trying to figure out which indexes are pointing to the correct vertices in a list containing FOUR outline paths.
(lower inner, upper inner, lower outer, upper outer, exacly in this order).
i mean, yeah, it's actually pretty straightforward stuff... for someone not as dumb as me =D
you just have two offsets, one that jumps you to start of the upper path, another that jumps you to the start of the outer path, then it's just
0 + upOffset to get the vertex extruded upwards from the zeroth of the inner path, or
0 + outOffset to get the zeroth from the outer outline, or
0 + outOffset + upOffset, to get the one extruded from zeroth outer vertex...
and so on.
simple stuff, then you just replace the zero with loop control var, put them in the right order, and voilá! walls!
except... whatever, why am I describing in such detail, not necessary, you're not my rubber duck =D
in short, figuring out which fuckin vertex is which, when the list contains ...well, any number of points, and you need to plug the gap between last and first points of the paths, where you need to wrap around the list...
...has proven to be surprisingly hard for me.
funny how much I love doing these things with meshes, despite how bad I am at doing them, which makes me hate doing them despite loving it =D2 -
android development is shitty af, it will make you super zombie computer nerd that sit on his chair for fking several hours just to find the where the fk is null pointer exception is coming from not only this but for all kind of errors,logcat looks like someone just hacking nasa, you know what im the one who is shitty af i would have opt web dev instead of android dev , this retarded studio and emulator takes too much time to just load a simple fking thing & if i make some change in it i've to install that application again ,it's so pathetic and horse shit thing i've ever encountered , kotlin is fun it's actually great language most of the features are so helpful in it,but the google codelabs,it's all documentation , adding dependencies whole concepts are trash imo, why can't we install the dependencies using terminal what's problem in that ,but no they chose the hard way for no fuking reason, i've successfully wasted a year learning this shitty tech stack, hopefully this NY i will choose different stack , will work till ass off .gonna build some cool projects and will eventually try for internships and all. done with android dev, idk how senior dev's are alive in this field6
-
Ok finally, I can tell now.
There's a college project I'm in with 2 more people that uses Python and AnyLogic (separately).
We also need to write some LaTeX, so as I was already using PyCharm for the Pyshit, I used it for the LaTeX and for Git.
I used it for Git too because I didn't know how it used Git and was worried that if I used the console it didn't recognize something or glitched out or something. And what the hell, it's a mature IDE, what could be so hard or possibly go wrong?
I had to re download the repo a couple of times because between pushes, pulls, merges and commits something happened and the repo ended in a weird state.
These are all the things I do:
Add, commit, create branches, merge, push, pull and delete branches.
So, I hadn't opened in some time. The last time I tried to bring something from another branch, and stayed up late to finish something. I was waiting for my classmates to join the call when I thought something like "Hey, I should commit what I did until now, it worked great.". When I examined the IDE I found out I was in the middle of a rebase or something. I start clicking buttons to at least try to commit. I press "Skip Commit". I lose everything.
What the fuck‽ As you can see in the comprehensive list above, I never do something similar to a rebase. Apparently when I tried to merge a couple of branches, the stupid IDE thought I tried to do a rebase and never asked me to finish it. Why do something I have never asked? Plus, why haven't you prompted me to finish the operation? That's so stupid. I'm never trusting IDEs again.
I was so lit for losing so many hours of work I did a couple of weeks before, I would have to think it and do it all over again because of something I never asked.
We spent an hour looking for a way to recover the lost code.
Why an hour, you ask, if you can use the Local History for that in PyCharm?
Because none of us had used it before and the articles we found said that you had to open it from the toolbar. From the toolbar it was greyed out.
Then I found the option in the contextual menu of the files. Recovered the LaTeX files but on the AnyLogic files, it was greyed out.
I had to open the Local History of the folder containing the AnyLogic file.
And that was that.
I almost faint.
Fuck Python, fuck PyCharm.6 -
On the one hand, as an avid programmer having a non-programmer partner, we (I) once wanted to mod some Gameboy Pokémon games (Crystal), but the games were written in Assembly and I was definitely not getting myself into that. My partner was rather sad, as this was quite a big project for the both of us, but it was never finished, and it was still complicated to explain to him why Assembly is such a bitch. Nevertheless, we found other projects to have fun with (simplest of them: random movie picker that chooses a movie based on title/genre/etc. from our own movie list file).
On the other hand, explaining and making programming exciting for people who are not into it, so you still seem like an interesting person for new dates (poly relationship), is really hard. But I would also blame my introverted self and not only programming for unsuccessful dating :D -
I will create a 1,000-job-application challenge.
The goal is to apply to 1,000 different companies and see if i can make a guineas world record of getting 1,000 rejections in a row.
Each job application i will record and document it on tiktok. I will do this freely to show everyone my achievements skills and knowledge of why i deserve the salary i want to have (which is btw less than $20,000 a year) -- so im not asking for abnormally high salary.
If you're a company spinning millions od dollars PER MONTH but it's hard for you to spend less than $20,000 PER YEAR to pay me for my hard work -- with absolutely no respect, FUCK OFF.
I want to do this in realistically 4 months.
1000 jobs / 4 months = 250 applications a month
Or 8.33 but lets round it to 9 job applications PER DAY that i will make.
I will record 9 fucking tiktoks PER DAY documenting this modern day bullshit where i struggle to get a job EVEN AFTER GRADUATING WITH A FUCKING CS DEGREE.
I want to show the world how college was really a scam and document the proof how no one gives a shit about degree and everyone treats me as if i have no degree.
I will also shitpost here on the status throughout this journey.11 -
I am really having a hard time keeping an "open" mindset with my team...
So when I email you, the junior at your first job and an almost 6 months work experience, with a set of instructions, I do not want inline comments and feedback to the tune of "Yes, I agree. I think we should go ahead" or debates on why, in your opinion.. xyz, because you tested it yourself..
WHERE THE FUCK DID YOU SETUP AND TEST BILLIONS OF ROWS OF DATA ON YOUR MANY MANY MULTI BOX CLUSTER? You live in a data center? Oh, and say "Serverless" one more fucking time....
And so begins the painful process of performance managing you out the door. (You cant fire anybody in South Africa for being a prick. Or useless.)
I am sure there once was a time where you could beat guys like this to within an inch of his life with his own keyboard. If it wasn't wireless I could have strangled him with the cord. Ah, I miss model M's....9 -
Javascript in a nutshell:
Function in a teaching example for a framework, checks for validity of input, dev returns null instead of false when it isn't. In another place, uses !variable to check if variable is 0.
fucking follow the semantics of the code you write cunt why do you have to do this why is it so hard to write variable !== 0
I'm sorry, this really triggers me.
https://media.giphy.com/media/... -
Before I went to school I was copying game code from book to atari computer cause it was faster than waiting for game to load from tape recorder ( especially when people are walking around on wood floor and you have constant read errors).
I probably wrote some magic spell that cursed me on my lifetime cause this shitty programming happened to chase me everywhere I go.
Damn you software you’re everywhere I go, why you’re haunting me all the time. It’s hard to find some quiet place without you watching.
So remember kids don’t write code you don’t understand cause it may fuck your life. -
I know the world doesn't owe me anything but why is it so fucking hard to get a job in this industry?? Unless you have a few years experience in a job behind you. Well if I can't get a fucking coding job in the first place how the fuck am I supposed to get work experience. The world is deluded fucked up place. Rant over!8
-
Why are hooks so awful?
What justifies having everyone using React relearn how to do things when hooks do not bring any new features to React?
Why does getting setInterval to work with hooks require a ~3000 word blog post by a maintainer which constantly assures you this IS a step forward?
Is scrolling up and down a class component really so hard that this clusterfuck is worth it?
>:(6 -
As a web developer who focuses on accessibility, why is it so goddamn hard to get buy-in for accessible design?!
If you design to be the most accessible possible regular users benefit from an experience that works, for as many people as possible, in more situations than most test for normally!5 -
Becoming a dev is hard, what was the thing that motivated you the most in your journey?
Currently coding as a hobby, but hoping to turn this passion into a full time job someday.
Also, why is devRant so obsessed with hentai?16 -
Dealing with clients is probably the biggest personal challenge. I'm not much of a people person, and I find it hard to converse with friends and people I've known for years, let alone clients who are looking for answers for why things aren't working, and wanting you to explain exactly (but in simple terms) why a thing that seems simple is so complicated.
Another challenge, which is somewhat related is expressing myself. This again, stems from not being super great or comfortable in conversations, but as a dev, even among other devs, your opinion on things gets asked a lot. For someone who was used to sticking with the status quo and mostly agreeing with things, stuff like peer code reviews, or giving pointers on how to implement something is a big challenge (but I'm improving)2 -
yo imagine if the most common and best toolchain for, say, Intel PCs was "mid-source": You can have the buildscripts, and a few extra seldom-useful bits, but nothing else.
Welcome to devkitPro: it's too hard to maintain a toolchain package for all the systems you develop on, so we'll maintain a modded copy of pacman you HAVE to use to get the only toolchain for Nintendo consoles for all systems. Oh, and it's not normal pacman, no, it's hardcoded to only be used for their shit.
Even on Windows.
why do they do this to us again?11 -
See now my stratgey for remaining in means and above water is typically American
You rent a room
400 a month
You have your meals there small fridge can store your lunches you save your money
You're below poverty level so you get food assistance
You look for a better job
Logical and you can still afford things
Just not a goddamn 400 car plus 180 insurance bill ! And another 160 a month in gas!
Why is this so goddamn hard ?6 -
Just need to vent out a bit. There's already been a few times at work where the senior developer asks me why I take so long to do something, and I'm unable to fully explain why.
Now, I could think of several reasons. Maybe it's my lack of experience; I just start researching on Google for solutions, start putting things together, and then I guess things start to get too complicated for me to be able to explain clearly. Maybe I end up "over-engineering" to solve problems that could be solved in a simpler way.
And this leads to my second reason, and that is there's no code review going on. I've wanted to just tell him, "If you'd just take a long look at my code, you'd understand why it's taking me so long! So you can tell me if I'm doing it right or wrong, or if I'm making it too complicated!" But, of course, being the junior developer, I also think that when he's explaining how to do something, I'm just not understanding it right.
I could ask for clarifications, and believe I've done that on some things, but my third reason is that he's just not good at explaining things, or that there's some miscommunication happening. English isn't his first language. His English is ok, but I know there's a lot of room for improvement. I also notice that our other co-workers are also having a bit of a hard time but it seems they already developed some sort of adaptation to communicate with him.
So yeah, there's my rant, and I'd love to know everyone's input on this. -
Me : .. but sir without sass/js compiled, how can we address the issue?
Boss : that is not an issue, issue is with on approach we have taken?
You sick fuck, you take other developers un-finished work, expect me to finish it (which it did) and when the other developer is not smart enough to copy paste the solution, you give an "update" to me, I mean how the fuck, what ever..
I really really put efforts to make this shit happen, I know very little about your commerce cloud shit, but when you question my logic on basis of someone who will pay you to finish her work, it is very unethical and hard to swallow it down.
Maybe this is my first real job, that is why this is so hard, but I gotta do what I gotta do -
Migrating an existing report from old system to new.
Business: We reviewed the differences you raised and why they're acceptable and this seems fine. But before we provide approval for your productionization, we would like these changes...
*1 month later, changes are made*
Business: you reported new differences. We can't give you approval until you tell us explain them all
Me: `••π÷¶×¶π|``•√÷÷÷π√^°°¥®^¥€€!!!!!!!
Can someone give me a new job so I can just walk in, say fuck it, I quit!!!"
Sometimes I just want to do that now but getting a new job is hard.... for reasons unrelated to how well I can code... -
!dev
https://epicgames.com/fortnite/...
This url brings to error page with invalid email address that will actually autoreply "We're writing to let you know that the group you tried to contact (do-bug) may not exist, or you may not have permission to post messages to the group. A few more details on why you weren't able to post"
Okay, sure. This may happen to indie stuff etc.
But we are talking about bigass company thats fucking trying to assasinate steam (and so far kindda fails). You dont want to show customers error messages, sure, but at least, if you do it, and you tell your customer to send email to admin, make fucking sure that you provide an actually fucking working email. Is it so hard?
No wonder they cant conquer steam. And thats positive side3 -
I don't know maybe it's me. I'm sure that at booking.com they have hundred of GUI/UX/UI experts, product owners, A/B testing and whatever.
So, please, can you explain to me in a professional and scientific why, why the fuck, when I search for an hotel in a place for a date, by default, they show me UNAVAILABLE properties?
Like, "hey sorry, there was this great hotel, right in the center and very cheap, but you missed it!! hahahaha, you poor moron"
And every time I have to ACTIVATE the fucking filter myself "only show available properties".
Excuse me? Who want to see in first position the hotels that are NOT available?
Are there some users out there who wants that? If I were hired at booking.com as Product Owner or UX/UI expert, I think the first thing I'll propose is to quit the fucking filter whatsoever or at least to enable it by design.
So why is that? you want to show off? slap me in the face, with your hard cock-list of hotels you have anyway, but not for me?4 -
So, working on real multi language support today I was searching for countries and country-codes. Yes this one is easy peasy. Also easy if you want every countryname in your supported languages.
But why is there no source for the states or provinces translated in every language. It's so hard to find...
Anyone knows a source for it? Is it worth to create a project for such translations?1 -
Background: I am working on task x. On successful completion of task x, task y may be given to me. Task x is haaaaaard. My group is not the only player and any fuck up will break my group and at least two others. Now here is my story:
Me: Yeah I am doing this hard thing and that hard thing and getting ready for these hard meetings.
FormerCoWorker fcw (): wow that sounds hard.
CurrentCoWorker ccw (): yeah he's working on task x and task you.
Me me (): what? No I'm not. I am working on task x. Don't go randomly assigning me tasks like that.
ccw: well if you finish task x you will be an expert in section z of code. So it is only natural you take on task you.
me: yeah but task x sucks and task y is why several engineers have quit the company. You never know. You could be assigned task y and quit. Why do I have to take on task y and quit?
NGL, I will do it of they promote me. I may be a whore, but I am gonna get paid. -
!dev
I love donating anonymously. But sometimes, people just make it so hard to stay anonymous to donate! -_- I mean, if a thousand people are donating for you, its not like, you gonna go to each and everyone's house and thank them. Its not like after 1 year, you're gonna be able to remember at least half of their names. So why bother? If someone wanted to be public about their donation, they would do that even if you don't call him and ask, "Who are you? Why you are helping me?"
I'm helping you because I can and I want to. Helping others is something that makes me happy. But I wanna be anonymous!
I want to be the devilest person on the outside but I also wanna be the softest person on the inside. So, let me be it!2 -
Few months ago we move into a new Building, Company buys new Polycoms for 2 of the boardrooms - fancy ones with the Skype for Business and stuff.
Provision the boardroom accounts get them set up and all is working well.
Director asks if we can swap 2 boardroom phones around because their dept. just got a remote user and video calling would be awesome.
I set to work changing sign in details, provisioning accounts, assigning licenses, etc which is a long process because 365 needs to update throughout.
Finally get everything right, time to login... Failed...
Login fails on the Polycom, my laptop & an android tab - all 3 with different errors.
Decide to test account by logging into the web version in OWA - logs in perfectly.
Why Microsoft?? Why must you make it so hard? Why not just work?2 -
Dear Microsoft, I see what you were going for, and I love you for it; but for the love of god, please fucking fix the clusterfuck that is Nuget.
I use a private feed for client work, and I have the public source registered too, so why would installing a new .core template from Nuget fail just because it tried the private feed first and shit itself?
It really shouldn’t be this hard.
Sincerely,
Brolls -
I've almost had enough of Atlassian. So, our customers want us to integrate Jira / Confluence support into our software.
I initially thought it would be a great addition to the other providers we support, so I explored it further.
After trying Confluence – and already knowing first-hand how horrendous Jira is from a previous role – I left in absolute disgust at not only how horrendously slow, buggy and overengineered Confluence is (just like Jira), but how horrendously FUCKING SHIT their developer / API documentation is. I suspended the project at this point. No fucking way was I allowing time to be sucked away because another company can't get their shit together.
Customers kept asking for integration support, so I authorized the team to revisit Jira integration support a few weeks ago. Nothing has changed. Documentation is as shit as before, software as slow as before and the platform as overengineered as before. No surprises.
Here's the problem:
1. You can't set multiple auth callback URLs so you can actually test your implementation.
2. You can't revoke access tokens programmatically. Yes, really.
3. You need to submit a ticket to get your integration approved for use by others, because automating this process is clearly fucking impossible. And then they ask questions you've already answered before. They don't review your app or your integration beyond the information you provided in the ticket.
4. Navigating the Atlassian developer documentation is like trying to navigate through a never-ending fucking minefield. Go on, try it: https://developer.atlassian.com/clo.... Don't get too lost.
I was so very FUCKING CLOSE to terminating this integration project permanently.
Atlassian, your software is an absolute fucking joke. I have no idea why our customers use your platform. It's clearly a sign of decades of lazy and incompetent engineering at work, trying to do too much and losing yourself in the process.
You can't even get the fundamental shit right. It's not hard to write clean, maintainable code and simple, clear and concise API documentation.1 -
So after 5 days of trying to figure out why the fuck nemID (danish online id) is a piece of shit and doesn't want to show the pdfs I'm sending, so that they can be fucking signed, I've finally found a way to produce pdfs that it doesn't choke the fuck out on.
Just fucking open the fucking pdf in fucking Acrobat and fucking print it to a fucking pdf using fucking Microdick print to pdf... TWICE! WTAF?
So guess what I'll be creating an API for today...
Also fucking give me a proper error code when your shit doesn't work! Why the fuck are you sending me an error code stating that the checksum doesn't match, when 1) I didn't fucking send you one in the first place and 2) it doesn't work because you fucks didn't implement the entire fucking pdf spec! So when my fucking pdf contains some fucking pdf-element that you decided was to hard to implement a web view for, tell me that!1 -
That heart attack when important data isn't showing anymore, and you missed the note as to why, so now you're stressed out because you don't know what and how hard you fucked up
Also, fuck the dude for saying he did the deploy, telling the testers to test and only an hour or 2 later saying he didn't deploy to the right env2 -
I’m so over software engineers asking me questions when they’re more than capable of figuring things out themselves. Why do you rely on me so much for answers. Half the time I don’t even know the answer and what you’re really asking is for me to go and do the hard yakka to figure it out! Fuuuuuuuuckkkk4
-
Worst support experience so far: German ISP sent their cheap default router which I opted for, hoping that I didn't need to rent a costly FitzBox. Provider activates the connection, everything fine, but slow and unstable on my Linux laptop only. Try using their website, their support chat etc. as they made it very hard to even open a support ticket. I gather all the information, ping, traceroute, netstat, logfiles, router settings, broadband measurement etc. and finally manage to open a support ticket of my issue adn they say they will send an engineer to my place in about 4 days. I stay at home that day and wait for the whole day, nothing happens!
I get back to them, even get a phone call after waiting about 1h in the waiting queue, only to listen to someone tell me that the appointment had been cancelled as the ticket had already been closed. WTF! They said they measured my connection and could not reproduce any error. Did not even mention my lengthy log files etc. It took my own research and another hint that there is an incompatibility with that specific router and some specific devices so I should really replace their cheap router with a FritzBox device. What they also did not tell, that you dont need to rent their branded FritzBox, there are cheap second hand models from another ISP that you can reconfigure by simply chosing another ISP in a dropdown list that contains every popular German ISP. But why are they popular? You can only choose between the different bad ones, that's why they don't seem to make an effort.2 -
Wasted 8 hours today trying to convince Windows to boot.
Yesterday I deleted two unused partitions. Today no OS booted up. Guess what, diskpart (think parted for Windows) reindexes GPT partitions on any modification. So when I deleted partition #1, my EFI System Partition, previously #2, became #1. But UEFI was still trying to boot from partition #2.
Linux booted after recreating UEFI boot entry. 1 minute job, no tools required. Windows, though... Bootrec /rebuildbcd failed, bcdedit failed, recreating ESP from scratch failed spectacularly. Finally I made a clean install just to get proper ESP and restored OS from backup.
Dammit, Windows. Why do you have to make things that hard.4 -
How am I even supposed to learn securit? I have been playing CTFs for a little over a year now, learned some interesting stuff and had some fun. But I still didn't ever get the feeling that I learned something really valuable.
I just saw this video and I trust LiveOverflow on this but I seriously have no idea how to continue from now on. https://youtube.com/watch/...
I even consider quitting this and instead spend my time improving my programming skills but I would really like to get into the field. Why is this so hard when you can find good info on everything online nowadays?
Thanks for reading my post, maybe I just need to go outside for some time to get improve my mood :)5 -
After couiple of hours (Yes, apprently it's insane how hard is to add a new NIC to a linux machine and make it start on boot), I finally got my connexion working !
Story :
Server has original MB 1Gbits card. Internet connexion is 1.1 Gbps. So 1Gb card only picked at 940 Mbits download
I bought a 2.5 Gb card (new nic)
Pluged it in : Nothing
Couple of ifconfig -a etc, bring device UP : Yeah working !
Reboot : Nothing
/etc/interfaces : nothing
And why it's not eth0 and eth1 etc as before but some thing cryptic like enp3s0.
Well, at least now everything working (Apperently there is a new "network plan" config file in yaml... what a waste, DO FUCKING JSON YOU RETARDS)
Ping is awsome tho ! Same cable on windows Machine, I get 5 ms.4 -
Well. I'm stressed and a bit sick so let me tell you this you fuckers: I don't want to play in your little mindfucking game where everything is about efficiency, money and who has the biggest dick around.
Usually I'm the idealistic, positive kind of guy who spreads love and lets people do their things as long as they just don't fuck with him.
Right now though, just go fuck yourself in your damn stupid car you fancy fucker because I don't care about your big dick you have to show off on every occasion. I don't give a fuck about your big paycheck or your smart ass. I'm so sick of this industry mouse wheel and modern slavery where it is made extra hard to enjoy our lives and unfold who we really wanna be because some stupid asshead is not able to fill his hollow emptiness with bare love but has to swallow loads of cash instead giving him the craziest form of diarrhea.
Com'on! We kind of tamed the planet. We put so much effort and created a huge system with so many securities and still we are not able to simply live freely, share love, opinions and great ideas. Why is it still so common to define yourself about your projects, paycheck and false effort? Instead of how much good you give to others, how self-consistent you are, how good you treat yourself?
All I want from you is a bit honesty to yourself. How about being nicer to yourself, letting your love unfold for the sake of releasing that love to the world?
For me you will be a hero!
Notes:
I believe that the personal happiness is influenced not only by your surroundings but mostly how you interact with it. Karma basically. So yeah, normally I'd say you can simply decide to ignore that shit, walk on your path and decide to be what you want to be no matter what dickheads cross your path, but honestly I just had to get that rant out because this ridiculous nonsense makes me so sick right now.
I'm successful right now. I have the privilege to decide on being happy and I know that not everyone has this privilege. I believe, spreading love will also spread this privilege.
That said, have a nice day!4 -
Can I just say, fuck app wrappers.
Why? Well let me tell you the story of cordova.
My plan was to make a leaderboard kind of thing for the tablesoccer we do at the place I'm interning at.
How it would work:
app -> create game -> API -> live feed
Buttons (flic) -> API
API -> RTU -> live feed
They use Symfony internally and externally, so that was my first go to.
I couldn't find any way to do Symfony that can do RTU without running another service.
As they really want an app but it's not their core domain I looked around for options for wrappers and decided to put RTU on the backburner.
Setting up cordova was slightly annoying but was okay. I got to building the base app.
Then I thought, maybe let's get RTU working with cordova. Looked at the options that were available. Decided to check out socketio since it had an tutorial for cordova. Tried it and it didn't work. Went over the whole internet but nobody seems to have a solution that works (the most recent post being 2017)
So I thought, let's get websockets to work instead, but again. Seems like O just can't get it to work.
So, guess what I'm going to do?
AJAX ever 1 second to the API.
Why the hell does RTU have to be so hard cordova. You are the only open source wrapper that's both multiplatform and easy to set up. Why can't you just work...
I might just call it quits on the app and just make a mobile friendly website instead.. Where socketio and websockets just work. As does SSE..
I'm tired, so sorry for the rambling I hope somebody can make sense of this mess. -
Why the fuck is it so hard to write a simple bash script. Syntax so strange and so many symbols you need to know. If you need to do calculations with floating point numbers, the mess is perfect.10
-
Tldr; Rust community could definitely be way less annoying, but it's way more annoying listening to everyone bitch about it all the fucking time.
rant()
Tired of the Rust hype? Too fucking bad. Quit complaining that people like well-designed languages more than shitty ones. Yeah, rust devs can be real fucking zealous, but at least the language is good. If you don't like listening to people say "why not rust?" ignore them or ask yourself the same fucking question ahead of time so you don't feel defensive when someone asks it later.
Read some shit about how "it doesn't matter what you build it with if the software is good, its all the same". Ever heard of "right tool for the right job"? Rust has applications all over the place, so people are going to talk about it a lot. Also, just no. Like, Python shouldn't be in the Linux kernel for a lot of reasons, so the tools you choose can constrain whether or not your software is actually "good."
Ever heard of "unsubstantiated trust"? Yeah, you might be good at writing C, but you can get that shit to compile with nasty fucking problems and C's a straight up foot gun in my hands. It's hard to write shitty functioning Rust that does what you say it does, which is less unsubstantiated trust.1 -
WHAT THE FUCK! why is it so fucking hard to add a startup script in Fedora 15. ARE YOU FUCKING NUTS?7
-
I've been using go for two days and I'm already pissed at it. Don't get me wrong, I like the language itself, I love the simplicity, the tooling and frameworks are the problem. Like, why does everything have to be so hard?
Why do I have to spend around 4 hours in total just to configure a fucking linter?
Why does everything have to live inside the fucking GOPATH?
Why the fuck can't I put a src/ folder in my project so I don't mix code with config files, docker files, etc?
Why the hell does documentation for frameworks/libraries/tools suck so much? Looking at you Gin and Gorm.
Why can't gin-swagger just find out what routes I have?
I must be either dumb or chosen the wrong frameworks and libraries, but the "development experience" I'm having sucks. Nothing works first try and documentation is shit and vague.
I want to like the language, but I can't, at least not if it's always going to be shit like this. Does it get better? Am I just a noob? Or should I just jump ship and look for something else?4 -
I don't know why but the default settings in Ubuntu have changed quite a lot. There was once a glorious time when if your Ubuntu got stuck, you could press Ctl + Alt + F2-F6, login to a console, run top command to see which process was taking too much time and kill it, and you can go back and start the process and again.
I remember days(~15-20 days) between restarts of my laptop, because I could do that. But now, my Ubuntu gets stuck, and continues to get stuck for about 5-10 mins, and then just restarts.
I have run the disk checks to see if my hard disk is creating issues, but no issues there. Maybe, there are times when the processes execute some buggy code and cannot get out. One fine moment, one of the processes(probably a browser or Eclipse), starts using too much memory or cpu, and the whole worlds seems to be crashing down.
But, my control to kill it promptly without crashing my other applications, was so good to have. And now, every time this happens, I feel 2016-17 and earlier days were so much better.12 -
So I'm building this environmental monitoring system for one of the Labs to monitor Temperature and Humidity. the "software" that comes as part of the package with these sensors is really just a website you host yourself if you don't choose the cloud option. No big deal really, (see my previous rant about getting windows server through SSC) I setup IIS and get the "software" registered get a couple sensors running looks good. However I don't like the error messages that popup because it's unsecured. do some reading and I find out that most browsers will give you a warning if your not using HTTPS even if it's for internal use only. OK we'll how hard can it be in implement encryption, turns out it's not that hard and you can do it for free how with letsencrypt and other places. I like free, now i have to use SSH to get into the server and run an ACME client. Hey open SSH is part of windows now cool, download an ACME client SSH into the server and nope doesn't work. Oh right I'm behind a corporate firewall and a bunch of other shit I can't control. Why is so damn arduous to setup this god dam internal website and the problems aren't even the site. Now I'm playing with AWS spinning up an instance to be able to try and get an SSL certificate just so i don't have to tell people it's OK to trust this site ignore the big angry warning.
Best part is other similar internal sites don;t use SSL and all have big messages about someone stealing your soul if you go there and these are commercial systems that run all the HVAC for all the campuses across Canada.
I need more Tylenol. -
Consider,
```
namespace A;
macro m00 a,b;
··display a,b;
end macro;
macro m01 a;
··m00 a,$0A;
end macro;
m01 $24;
end namespace;
```
OUT: $0A24 ("$\n").
Ah, but you just HAD to fuck me in the ass, didncha fasm2? Initializing anal bleeding:
```
namespace B;
A.m01 $24;
end namespace;
```
OUT: illegal instruction 'm00'.
Explanation: macros carry no context, and so 'm00' is unreachable from 'B' namespace.
Could I maybe write a code-capture macro to generate a wrapper that resets the namespace? Yes, and in fact, I did; brilliant exercise in mystical mindfuckery.
But why try so hard? Just pass the fucking ref, like a MAN.
EXPLICIT CTX, BITCH.
```
define @CAS $non; current addressing space
define %ICE @CAS;
macro self:PA&; recursive macro, uuuh spooky-spooky
··match ice , %ICE;
····; self->proc(args)
····match =-=> proc (args) , PA;
······path.proc ice,args; pass ref and args
····; ^self->proc()
····else match =-=> proc () , PA;
······path.proc ice; pass ref only
····; ^sneaky sneaky. set current context when self ctx;
····else match cas , @CAS;
······%ICE equ cas.PA;
····end match;
··end match;
end macro;
```
ALL TOGETHER NOW
```
namespace A;
macro m00 ice,a,b;
··display a,b;
end macro;
macro m01 ice,a;
··self->m00(a,$0A); could also be 'ice.m00 ice,a,$0A' lmao
end macro;
end namespace;
namespace B;
self A; set ice
self->m01($24);
restore %ICE; back to previous
end namespace;
```
OUT: $0A24 ("$\n").
A-há, now **I** got you from behind motherfucker!
Final note: this is 100% perl DNA seeping through the cracks of my sanity and into a fresh fasm2 framework. Why? Dingle-dongle-jungle-berries, that's why. Also crack.
Have a nice wallop.31 -
Figma dev mode sucks so hard I dont get why people seem to like it so much.
It was working fine before and now I have to throw away my complete workflow because of their bullshit beta.
They stripped many features which were working fine before for their fancy bullshit.
Instead of fixing existing issues they just add new bugs.
I cant even get the distance between two elements.
Fuck you Figma.1 -
Let's do a story mapping session! Ok cool. PO asks the team: so guys what do you think? *silence*... *more silence*.... PO: come on guys, please respond. *silence*.... Then someone finally responds.
I'm starting to hate this big time. It's almost always like that, no matter the type of session (story mapping, refinement) And there's someone in the team that thinks he always knows best, so if ever someone speaks up, it will always be challenged and lead to useless discussions. He always wants the perfect solution. A good solution is good enough, it doesn't have to be perfect. PO is happy with a good solution (good = maintainable, scoring at least x on our code quality tooling), so why the fuck would you want to go for the 'perfect' solution, which may score just slightly higher in regard to quality, cost much more to develop and people have a hard time maintaining it due to the high level of abstraction? He's always refactoring stuff because it's not future proof. Well, why completely reimplement parts that have been working properly for 2 years and have a very very small chance of needing a change, which then still only needs to be done in just 1 place?
And you know what? All these fancy structures, patterns etc are in there but will their flexibility ever really be used? In my 20 years experience haven't seen such flexibility being really used. Some exceptions of course.
Once it's built, it will keep running, yes, changes will need to be made, but in most cases they never touch all these expensive fancy structured components. Just because most changes are in content or small changes in functionality.1 -
When writing regexes why the fuck would you not use \w instead of writing [a-zA-Z0-9] or \d instead of [0-9] or the dozen other metacharacters? Makes it so fucking hard to decrypt long regexes.2
-
!dev
People that call you, get to voicemail and, instead of leaving you a message (especially if it's something important), just hang up.
Why is it so hard for people to just leave a message saying “Hi, I'm ${PERSON} and I'm calling you because of ${REASON}, to let you know that ${WHATEVER}. Please call back”?
I don't know if it's like that in your respective countries, but here in Spain people seem to have a phobia of leaving voicemails and it's fucking annoying.3 -
CGI is fun, websockets are fun, why on earth is it so fucking hard to have both of them with proper switching using at most one extra program apart from my handlers?
By proper switching I mean that you actually track connections and upgrade headers to decide what to do, rather than forcing websocket connections onto a separate HTTP resource just to tell the difference.4 -
That feeling when you inherit a script to automate something that takes 10 seconds. Why would they even write this? It's not like the task is hard....
...
And why would they write it this way? I'm sure if I just move this part and ....
That feeling when you spend several hours improving and redesigning a perfectly functional script to automate a 10 second task for zero gain aside from cleaner code. "But the code for this quick-and-dirty script I'm never going to look at again looks so much better now!"
... If only it did a bunch of complicated parsing, regex matching, and error checking just so I can answer one less prompt.... Unless that parsing fails. Then it should still ask me for that prompt... And also validate that the answers I give are valid and correct....
That feeling when you spend a whole nother day starting from scratch to implement error checking and complex parsing logic knowing full well the original task takes 10 seconds to do manually and is needed at most twice a day (for a grand total of 20s a day)
WHY AM I LIKE THIS?!?!?!4 -
OMF you motherfucking Eclipse developers. All I want is to build an application with SWT. WHY THE FUCKING FUCK is that near impossible.
1) why are there no SWT maven artifacts= only 3 year old ones on a custom github repo?
2) why is is fucking rocket science to even find a guide on how to build this fucking piece of shit yourself
3) WHY THE FRIGGIN FUCKING FUCK OF FUCKS is it so hard to build it your self - outdated docs .... nice, dead links and repos, nicer .... referenced maven artifacts from a non-existing, none-documented repo, ... wow you're really kickin it here.
All I want is to fix this nullpointer in this fucking piece of shit you call framework ...
Have you actually tried to read your docs (can we really call that shit docs?) from a none-100years-swt dev's point of view?
Noone understands shit!
Why is there no standard build system, like maven, grade or for fuck's sake even ant?
It almost feels if you devs don't want anyone use your abomination, so it can die in peace.
Arg, I could puke ...5 -
Bloody fucking Android! Updates, updates and more updates! My development Nexus 5X won't allow me to sideload apps since it updated... Hello, printf debugging! Goodbye, profiler and debugger!
My hate for Android grows with each version after 4.0.$something... 2 was shit, I missed 3, 4 was OK, and since then it's going steeply down.
And don't get me started on Material Design...! Good luck figuring out what's a button and what's a label...
And what's up with the "let's keep all apps running all the time to save a few ms on start" philosophy!? Who thought that is a good idea!? Yeah, System.exit(0) works, but... Is it so hard to determine when it's not needed anymore (has no services running etc.)? Why should a web browser (for example) stay in memory after I quit? Minimize is a thing (Home button), why make it so confusing?
Another thing - feedback-less async tasks - why? I like to know when it is working in the background... How the hell am I supposed to find out if it is supposed to do this or if it is frozen?
And Android deciding to kill your process whenever it pleases without any callback... Happened to me once with an Activity in the foreground (no exceptions anywhere in my app, it just quit). How do you do IO properly? It seems you can't guarantee some file or socket or something that must be closed doesn't stay open (requiring to restart Bluetooth 'cause the socket wasn't closed, for example)...4 -
You people ever heard of the BeamNG game? The detailed vehicle physics simulation...
The question that has been bothering me lately is: why the hell are BeamNG videos so addictive 🤔 I get those videos sometimes in my YouTube feed; and once I start watching those, I usually cannot stop.
Like, the car with parts stripped from it over time. Or the truck carrying an ever-increasing number of rocks uphill. And the crashes, of course
But the question is: what do I find so fascinating about those videos? Why is it so hard to stop? On the surface, it is nothing special. Just some silly experiments involving vehicle physics
Weird; so weird... ☁️1 -
Spent 4 hours trying to figure out why API endpoint keeps returning a 404, the data guy checked the database and the row exists. Didn't know the one endpoint it was using was for debugging, which also isn't working.
Turns out Angular somehow decided to switch environments and called the wrong endpoint. I was working in an HTML template and then suddenly shit stopped working. Someone probably committed the debugging endpoint by accident and I pulled the change into my code. Imagine a dev puts some super secret API key in there and pushes it to the remote repo. Congratulations, you now leaked a potentially private API key.
"Good practices", my arse.
The way Angular uses environments is retarded. Just use fucking .env files, why is it so hard?
Angular is retarded. -
So I have this habit of copying all my family pics and kids videos onto portable hard disks. Have a 500GB Western Digital since 2012 and another WD 1TB since 2016.
Had one portable HDD failure before that back in 2010, but that contained only old projects code {when I didn't know git} .
So any advice you guys have for me on managing backups of these life memories? I mean I don't trust cloud storage - Google Drive, DropBox etc. And don't want any 3rd party poking into my stuff. That's why these items go straight from Camera to HDD.
What should I do to prepare for another failure? And is there any kind of RAID available in the form of portable solution?
Is it a good idea to change HDD every 5 years or so?8 -
TLDR; Send help, need VR video player that works on all the platforms (not IE, that can burn in hell)
Okay, don't get me wrong; I love iOS and most of it's features like being able to connect to the same WIFI-networks without having to fill a password twice.
But holy shit; Fuck Safari.
They made it so hard to access the stupid motion thing which you can use for VR.
Why do I know this? Well of course I have been building an app for a client which needs to display 360 degree video, which would be best viewed by turning your phone instead of swiping across your screen.3 -
!rant
If any of you were wondering why all the panic when we keep hearing reports of so few people personally knowing anyone with covid19 symptoms, I think I just figured out why.
So as of yesterday, assume unofficially fatality is 15%. Yesterdays death total was 3861.
If we assume roughly 15% death rate, based on ten days average for a case to recover or die, then the cases that would be recovering today on april 1st would have been infected or started to show symptoms on march 22nd.
At that time there was 32882 cases total in the u.s.
Therefore for april 1st, that would mean by the end of the day today, if the ~15% fatality rate is accurate, there would be at least 4,932 fatalities logged today.
I don't know about you, but here it's almost 9am, not even halfway through the day, and we're already at 4067 deaths.
And now we get to the part where all this shit starts to make sense.
For a long time since this outbreak has started somethings been bugging me and I couldn't place what it was till now.
Why did it seem, no matter how high the numbers climbed, no matter how much this spread 'like the flu', no matter how hard I looked into it, very few people seemed to personally know anyone *in real life* who died or at least came down with this?
I mean we'd all heard the rumors that it was more lethal, and then mums the word, it seemed like media the world over simply except the official "it's only 2% lethal" line. Same as the line about it only infecting people of asian descent.
And it didn't make sense to me why the numbers were so high, and why all the panic if it's just the flu? I knew in the back of my mind it wasn't I just didn't have a specific reason why.
Here it is: This thing is still pretty contagious, but not as contagious as it *could* be with a lower fatality rate. And with a fatality rate at 15%, combine with *just sufficient* spread, it would continue to burn and fester in communities for a year or more until those panic-numbers we see on the news would become a real thing. And then no matter HOW flat we made the curve, it would be x5-x50 times worse than a bad flu.
So we get panic and fake numbers. Because you really don't want to catch this thing. It kills 1 in 6.6. And it spread just enough that it is hard to effectively fight.7 -
Why must pixel perfect scaling be so fucking hard... It all works perfectly but I'm limited to a max of 540p for the games camera view but as soon as you drop your resolution bellow 1080p you get stuck with 300p or lower... Ughhhhhhhh
Why did I choose to do pixel art... Wonder if converting everything to vectors would help, wonder is smashing my head into a fucking wall would help... -
1. Speaking strictly physiologically, masturbation and intercourse orgasms aren't that different in what it feels like down there. The only difference is what it feels like in your mind, but that depends on your partner and your compatibility.
2. Fleshlight Stoya edition obliterates everything that breathes in terms of orgasm power, except for one single blowjob I received from an autistic mind-reading trans boy. But he's rare.
3. If you wonder whether no-fap or no-orgasm lifestyle has benefits, it doesn't. My high score is three months without orgasm. After two weeks, you stop thinking about sex. Morning wood disappears completely. You have considerably less energy, and every time you ask yourself why, you remember: “ah, it's that no orgasm thing.” Then, it's quite hard to go back to having sex — your penis just won't go up.
4. Sucking your own dick feels weird, just like tickling yourself. It's hard to focus, and the pleasure is next to none. If you always wanted to do that, you can forget about it — it's not worth it.
5. If you're a penis person, high quality anal orgasm is THE best physiological feeling you can get without drugs. Totally blows anything penis-related out of the water, including edging and other advanced techniques. If you chase self-exploration and wonder what your mind/body are capable of, definitely try it, though you have to find an experienced partner & be patient with your body.
Pro tip: if you're a man in a traditional monogamous relationship (if so, what are you even doing with your life?…), it might be easier to convince your female partner to allow you having affairs with penis people than to go full polyamorous mode.1 -
As hard as I fucking try, my stumbling block, every fucking time is exports/imports. I can't wrap my head around them, at all.
What do you use in browser vs in node?
Whats the *most commonly used standard*?
Whats the difference between "modules.export = Foo;"
vs "exports.Foo = Foo;"
what about
export class Foo? Is that the same as modules.export or export.Foo?
Look at this shit...
import FooComponent from "./Foo";
export default Foo
const Foo = require("./foo")
const Foo = require("./foo.js").Foo
import { Foo } from "./Foo.js";
And probably a dozen others I don't know about.
Why does there have to be so many fucking ways to do a fucking import/export?
What the fuck is going on here?8 -
2 weeks ago I ask my coworker, who btw hates me and try to sabotage me every time he can, for a login for our brand new dev-system (webserver + dbserver).
I needed 8 days until he told me "no, work on the test envoiriment".
I escalated it to my boss, but he told me "no time, do as he says"...
Well okay.
So 3 days ago our bosses boss boss came to me and told us to do this very very important things - or we all will be in HUGE trouble and someone gets fired.
So I do it, I work as hard as I can, finished yesterday.
Today my coworker decides to play with the testsystem, because it is a testsystem, and boooom - accidentally kills a few databases and stuff for this very importent thing. Non recoverable.
And that is, guys, why you never work on testsystems.
He will get fired friday.
Karma5 -
Why it's hard to look for an Android developer position abroad is so hard ?
Basically am lebanese with 2 years of experience
But hey rant reader if you can help please comment below1 -
Intelligent Development class (yeah, that's how it's titled), teacher leaves us as first task to develop our own Database, because later we will make it a fuzzy database.
She gave us three days. Three (counting me) in the team. I began working on Interfaces (Java development) and so on, using GitHub for VCS and documenting each method.
This assholes didn't even ask what was missing or what should they do. One day before date, I told them "Hey, I think I can nail the underlying file management tonight, so, work on the language parser, please"
Stood awake until 1 A.M., waiting for their reply, but there wasn't any.
Next day, I'm the only one of the team and I tried to decline the presentation of my work, but a friend encouraged me, because it was my work and I worked hard.
Presentation went better than expected.
After the class, I have another with one of my team members, he asks "How did you do?", "Us? You meant me, because the other prick didn't go".
And that's all, not another single question nor explaining why did he didn't answered the DM's I sent.
Fuck those guys, fucking team of shit, I hate it when you can't pick your team, but I guess that's just a common place for all of us here, isn't it?3 -
Why is making a git UI so hard? I've tried many and they seem all suck in some ways. Newest is gitKraken, and with that you can't even trust that it pulls the latest version of the branch you are on.
So what I did was:
1. Open a repository
2. Press Pull button
3. gitKraken says pulled successfully, you already have the latest.
4. I wait 2min, then check the gitKraken again, and it says there's 4 new commits ahead of me. And trust me the person has pushed those long time ago.
I just wonder how can you screw that kind of basic operation in a git client? They must use some kind of internal cache layer there, that takes time to update that the user does not have the latest version yet.10 -
So I’m tryina put together a resume and I see a lot of dev résumé talking about increased revenue from x to y or user base from z to w.
What I don’t understand is while yes the user base did increase from z to w it wasn’t just you that caused it. The entire company was working hard at it to get there so why are u claiming that it was you. And apparently recruiters love these kpis that u make out of your ass.
Should I give in and just put them in there anyway?
I worked in a startup so my job didn’t really have a definition of what to be told to do and do I had to deal with building front end with vue to figuring out how to automate our deployment flow and it’s really hard to quantify my performance like sure 3000 tickets solved but u don’t know what portion of them were full blown features what portion was just a one liner.2 -
So I got the new macbook pro 15 with touchbar .... this is my first macbook that I have ‚issues‘ with.
* the new butterfly keaboard doesnt feel as good as the old one
* ... abd its friggin loud!
* the keyboard backlight just randomly drops out and forces me to cold reboot WTF??
* they bigger left/right cursor buttons make it so hard to feel where you are, that I constantly confuse up and down
* the touchbar is basically unusable for a keyboard centric person like me. It forces me too look down to the keys!
* I constantly hit the esc bc im used to have one finger there to hit it if needed, but now im forced to hover it bc otherwise it is pressed
* and why of fucking why did apple remove magsafe??? Now i dont even see anymore if is is being charged without turning the screen on
* i hate the usb ports too, why not even add a free usbc to usba port? (Well, i guess bc it would make the macbook even more expensive... free wouldnt be free anyway i guess)
It is way more powerful though, but the time i would buy a personal one is over and will probably never come back.
Im a happy hackintosh user btw 😅3 -
Cont. on: https://devrant.com/rants/3533743/...
So yeah, kind of had to figure out the semi-hard way that Yew really isn’t prod ready yet (as they clearly state somewhere). Too bad. Or maybe because I don’t have the experience in Rust to overcome some of the issues I’ve had... so it’s back to plan B, id est Vue with TS. At least I got much of the thinking work done already, so I could just write the damn code - and the stuff I had problems with in Yew were all simple for me in Vue.
Or that would’ve been the case if I hadn’t decided to use the newer composition API instead of the options API already familiar to me. Damn it took me all day to wrap my head around it and I’m sure there’s much more head-wrapping to be done. Still, I’m likely done with this at least 2-3 weeks before the deadline, so I can maybe spend the some time figuring out the Yew implementation, too... not sure why, but maybe it ends up better?1 -
Another part of messy network gone.
Caching fucked me hard....
Isn't it just lovely that nowadays you need to nearly wipe a machine to get it from claiming stale data....
And thanks to DNS, HAProxy -/ service names / ... I think I know now why the curse of babel is so powerful.
When you have to think for 2 mins to make sure you've set the zone's right, cause otherwise you need to ProxyJump with SSH through more tunnels than imaginable (VPN/HO) to fix possible caching on several DNS servers.... You'll realize that it's russian roulette with too much bullets. :(
And If a monitoring service asks another monitoring service for status information which asks the first monitoring service which then asks the second monitoring cause you were too late...
You'll get very funky monitoring statistics.
Too slow, had to nuke it (mismatched a DNS name, the second monitoring service should have been a service node).
I think I've had more near death scenarios in the last 2 weeks than I like.
Hopefully I'll never have to do that again.
(Splitting and reordering a few dozen VLANs, assigning proper DNS names, loadbalancer migration....) -
<rant> Why is Apiary's editor so weak? It has no support for navigating from request to its code, it hides inheritance (so in the end you end up navigating source code via ctrl+f which is very cumbersome) and is buggy as hell. It randomly scrolls around, after awhile is laggy, syntax highlighting often breaks on a blank line with few spaces and so on... I wish so hard it would have had a plugin for IntelliJ IDEA with proper navigation and request preview. The web "editor" is just so clunky and generally bad :(.</rant>
-
OK. We've got this tiny little pet project of mine (work related)…
I rescued it from the git archive, simply put: someone hot glued an elasticsearch scroll + document processor (processing) together.
After a lot of refactoring, I had an simple, much improved (non-parallel) Akka Worker System without an Akka topology / hierarchy.
I left out the hierarchy at first, because I didn't know Akka at all.
I've worked with a lot of process workflows, and some systems that come very close to IPC, so I wasn't completely in the dark.
Topology requires knowledge / creation of a state machine / process workflow. And at that point of time I just had... Garbage. Partially working garbage.
I finished yesterday the rewrite into several actors... Compared to before, there are 8 actors vs 2... And round about 20 classes more. Mostly since I rewrote the Receive Methods of Akka as Command DTOs... And a lot of functions needed to be seperated into layers (which where non existent before)
Since that felt more natural than the previous chaos of passing strings or other primitive types around, or in the worst case just object....
(Yes: Previously an Actor was essentially a class with one or more functions "doEverything" and maybe a few additional functions which did everything - from Rest Client to Processing)).
Then I draw the actual state machine based on everything I've written in the last weeks and thought about how to create the actual topology and where / how parallelizing might make sense.
Innocent me stumbled in the Akka Docs on Akka Typed... (Didn't know it existed, since I'm very new to Java and Akka).
Hm, that sounds an a lot like what I did. In an different way, yes. But not so different that it might be VERY hard to port to.... And I need to change (for implementation of hierarchy) a few classes....
[I should have known at this stage that my curiosity would get the best of me, but yeah. Curiosity killed the cat.]
Actually the documentation is not bad. It's just that upon reading the first more complex examples, my brain decided to go into panic state.
The've essentially combined all classes in one class in all source code examples [which makes sense more sense later], where it is fscking hard for an chaotic brain like mine to extract information....
https://doc.akka.io/docs/akka/...
The thing is: It's not hard to understand… actually very simple.
It was just my brain throwing an fuck you tantrum.
So I've opened more examples in other tabs and cross referenced what happened there and why...
Few frustrated hours later I got that part.... And the part why it's called Akka Typed. It was pretty simple....
Open the gates of hell, bloody satan that was too easy for fucks sake.
Nooooow.... I just need to port my stuff to Akka Typed.
Cause. Challenge accepted, bitch - eh brain. You throw tantrum, you work overtime. -.-
I just cannot decide wether to go FP or OOP.
Now... I'm curious wether FP is that hard... Hadn't dealt with it at large before.
Can someone please stop me... I'm far too curious again. -.- *cries*6 -
Saw my colleague debugging. He's got a try-catch, then I asked, "Why aren't you logging the stack trace?". He answered, "I don't cause it will be a security risk". So there he was having a hard time debugging.🤯
Can you guys confirm if what he said is true?4 -
Why is Drupal counter intuitive and unwelcoming! Why make it hard for new comers!
If you are looking for a feature, you have to code it anyway. So much code under the hood but you always end up using contributed modules or create your own. fck fck fck. So many buggy modules.
fck fck fck1 -
Why is it that nobody can seem to figure out you need a god forsaken "cause" field of type Error in your Error class
How is this so fucking hard to understand for language makers3 -
Yes but you see this function everywhere so why is it so hard for us to implement?
Next time i’m gonna say that this function is everywhere, but why is it so difficult to design? -
So I've sent emails to a couple of people (some of which I found on devRant) that were offering work. Typed a small story about myself and why I'd love to take the work.
No reply whatsoever.
Like, I get it if you don't want me, completely understand that, but how hard is it to let me know that.
Like c'mon guys, don't be a dick.
Disclaimers: I got the email address right, they did not land in my spam or whatever since I did receive an email from them in an earlier part of the correspondence. I did give them (what is in my opinion) a reasonable time to respond. They also didn't die or something since they are still active here...2 -
Please Google fix my Chromebook's new tab screen as well as stop screwing up every single screenshot extension. I can't directly upload screenshots slowing down skype meetings. Why are you doing this to me? Your product forums (https://productforums.google.com/fo...) are treating me like I am an old lady who doesn't know what they are talking about. I do not understand what's so hard to comprehend. 1 Google Support Chat, 2 Feedbacks, 1 Debug Log Sent, Screenshots and everything yet you still fail. I have provided significant proof that there is an issue caused by you. Now please fix it because I can't since the Chromebook disables all code not signed by Google (unless you are in dev mode aka annoying screen + lose all security). You guys like hate me or something :(
-
Okay, can anyone explain to me why this is the third time in a row that I have to re-disable "fast startup" after a windows-update?
I know, some of you might think that windows sucks, and I agree, to some extent, but I still want to be able to play my games there.
So, is there any rational explanation for the fact that windows seems to suffer from some kind of amnesia when it comes to settings? I don't believe it was either bad intent or complete incompetence from the developers...
Is it a certain design decision? Or is is that hard to implement "persistent" settings storage?3 -
Sigh millions fail
Millions make up bad ideas
Millions more commit crimes
Millions more squabble and weaponize laws to steal the lives of others unsuspecting and innocent or evil
Millions fail at everything
And stress is overwhelming
If we wrote software like this country works random servers would turn off
Coding teams would give up
Make code that didn’t do anything
Redirect requests from one service to another service randomly
And turn off peoples comps
Not to mention set server rooms on fire
Why is it so hard to fix the basis of
Our society so we don’t have to view the same failed commercials with some hyper method yelling about “you want to learn to code !”
And all this other regard shit -
I just submitted "a lower price found" on GrubHub for an order I just made. Haven't gotten back to me yet but apparently if they agree, they'll give a $15 credit.
I think other services have this gaurantee too... So wondering...
How hard is it to write an app coloring menu prices between all these services...
Could get a lot of credits... And why haven't they done it themselves.
I'm not really up for the task at the moment but basically you just generate a table with all the prices from each service and highlight the ones that are different...
Then profit!!!6 -
So I love what Apple is doing with the new Macs, great hardware, streamlined optimization, blistering performance.....great stuff.
But here's the thing. I think I'm gonna get a ThinkPad and just install fedora on it. It's far cheaper and outside of only going up to 16GB of ram it meets all my needs.
But between you and I a big factor in why I'm finding it hard to go Mac is the system settings. Like why is it like that? Why when I click something a separate window opens.....odd.6 -
I love watching how all these retards who were laughing from people who took the virus seriously from the start turn into the same ones they made fun of and thinking they are the smartest and best. Fucking proud of you all, thank you for doing such a service for all of humanity. Or people who think they "can't" get sick so they endanger the others. Why are people so stupid and they wake up only if it is already too late? Is it so fucking hard to stay at home? To not go skiing? To not be selfish and sit on your fucking arse at home? Fuck!
-
Why can we deprecate a regular language like Python 2 (26 months can't come by fast enough) but yet it seems web development is impervious to the idea? If you want to make a website, you must use HTML, CSS, AND JS (or a transpiled language).
I get we use it for backwards compatibility but this combo makes web development so messy and weird, it's hard to understand from a newcomers perspective.
Maybe I'm just too stubborn to understand 🤔3 -
Everyone is trying to cover up the most worthless morale destroying perverse and depressing part of history, and then they try so hard to drag people back through it, now you're all acting like it never happened just like the last group consumed by it. Why are you all so fucking crazy ?
And btw if you're all wondering
Was life better without your evil lying asses ?
Yup
So go on
I'm curious how I'm going to be 38 again heh8 -
Typescript is so fucking frustrating sometimes to deal with
The snippet above AND below do the EXACT SAME FUCKING THING. But because you double tap, it loses the fucking (not needed) type before the mapTo. If you aren't paying attention, you get this extremely fucking aggravating wall of red.
God damn it, can't this be better? RxJS is pretty fucking important, so why is this so god damned hard to just get some coherent fucking code highlighting!?
/rantover4 -
Why are apple so fucking back assward and stubborn when it comes to their app review process?
So, at work I made an app. It's a simple one, but it's an app.
It makes it so that the user doesn't have to enter their credentials to sign in to a system developed on our platform.
If you give it a hard oded config it will only connect to that server, if not, it fetches a list of available servers and the user has to select which they want to connect to.
I've uploaded basically the same fucking app thrice, twice with and once without a config.
Two of them when somewhat smoothly through the review, but the last one has been stuck for almost two fucking months! And guess what it's one of the ones with a config!?!
How is that in any way consistent?
They fill us with shit like "your screenshots aren't representative", so I update them.
They go "this is not an AP for the public", I tell them I give less than a steaming pile of fresh dung from a retarded donkey, the intended users are freelancers, so just fucking greenlight it.
Then they go "your screenshots aren't representative", so I tell them to pound sand or specify which screenshot is wrong or what they think is missing.
How are they so fucking inconsistent with their process? Isn't is this process that they used as of defence for their shittastic monopoly, that they don't want to call a monopoly?
I'm so fucking tired.4 -
Fuck xrdb and it's shitty documentation. Why is it so hard to setup pywal ? Why can't you put simple docs? Configuring anything sucks!1
-
Alright, I found the root of the issue from my last project post.
It’s the damn MEM indicator.
In my project, I want to be able to load presets from an SD card in order to let the user switch from preset values to values determined and calculated from a potentiometer.
So it’s pretty hard to discern when you’re using the memory and when you aren’t without some kind of indication.
Every fucking time I try to put on that indicator (a red “MEM” at the bottom of the screen) it completely fucks the entire display.
I HAVE NO IDEA WHY!!!
Might be possible that there is a VRAM space issue... idk.
Will probably use a LED for indication instead.