Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API

From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "worried"
-
People are worried that AI will replace them in their jobs.
But guys.
We are still using php.
I think we are safe for the next 200 years.18 -
(overheard parents talking)
Mum: I'm worried about our son, I guess he was hacking today
Dad: What? [Chuckle] No. He's not that grown up enough. Prolly programming.
Mum: But, the screen was all blue and there was nothing but text on it. And then suddenly it went blank. So, I asked him what he was doing and he said it was a BSOD. That sounds scary NSA level stuff.
Dad: it isn't [came out of the room, saw me there]
(And we laughed and laughed and laughed)4 -
Programmer was smoking...
lady nearby: "can't you see the warning smoking is injurious to your life!"
Programmer: "we are not worried about warnings only about Errors"4 -
Any devs here that Code in C/C++...?
Or am I lost in "webRant".
I am worried about the future " code everything in javascript " generation :)
Make pointers great again!75 -
So my cousin approaches me with his Android phone and, with a worried tone, says:
- "But... is it true that if you enable the developer mode you can get arrested?"
- "What? No. Why?"
- "Because this screen says so. I once enabled them out of curiosity but then I couldn't disable it so I had to reset the phone."
Turns out that, in Italian, "arrest" is a synonym of "halt". The message says "these settings can cause the _arrest_ or malfunctioning of the device"
Couldn't stop laughing 😂18 -
For years I worried I was not a good programmer because of bugs, issues and not giving accurate timescales.
Then I discovered devRant and realised that there’s thousands of us that have the same issues.17 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
My colleague just committed some code with description "improved some bugs"
...should I be worried? 😂7 -
My last episode of Game of Thrones got ruined because of spoilers on social media 🙈 So to ensure that I don't get any spoilers for the GoT finale, I created a small chrome extension which automatically blurs out any GoT presence or prospective spoiler from websites I visit.
So for all those who are worried about the spoilers, can give it a try over here: https://chrome.google.com/webstore/...
Might be a bit buggy here and there so do share any feedback you have. 👍🏼 #WeekdayHackathons13 -
Her: What do you do?
Me: I'm writing my thesis on bringing AI to smartphones.
Her: I think AI is terrible!
Me: oh, you are an engineer too?
Her: No
Me: oh, you've studied economics and or ethics and are worried about its implications on society?
Her: No, but have you?
Me: I have a degree in economics, an MBA and an now about to get my BSc in CS.
Her: well, regardless I still think it's terrible.
Me: well in that case how about you shove your unfounded opinion where the sun don't shine!18 -
Does my old computer count?
2016:
Windows XP
Visual Studio 2010
1GB RAM
An old Pentium inside
I am now worried that both Raspberry pie 3 and my phone, both costing less have better specifications11 -
!rant
Got pulled into a meeting with my PM at 4:30 yesterday. Was a bit worried (been feeling some imposter syndrome recently), but then he starts out, "These are my favorite meetings to have." I got a pretty big raise! Totally unprompted. I love my job and my PM.2 -
Morning after my linux administration exam my mother called 15 times to wake me up. When I finaly answered the phone she she was worried so she asked.
Mom: wtf is wrong with you, is everything okay?
Me: not sure, i think something went wrong. I'll send you the log files later. *Hangs up the phone.
Apparently I do shit like that every time she tries to call me in the morning as she writes down our "conversations" just to laugh at me later.
brain@sleep:~$ sudo rm -rf /9 -
You all, something is wrong. No one has pissed me off at work recently (other than boss, but he does that by existing). I'm not sure if they've all learned, or if shit is about to hit the fan.10
-
Getting older. I've been needlessly worried about my age as a developer since I was 23, which is hilarious.
People always need good devs. You don't have to become a manager or commit suicide at 30. Just be awesome and someone will pay you.5 -
So I used to be a chef, then I got married and decided my weekends and holidays were better spent than making food for ungrateful shit-wagglers, or getting screamed at in Lebanese by the exec Chef during dinner service at the end of a ten-hour shift, so I went back to school for Computer Engineering. I was so worried because I swore compulsively from day one of classes.
Little did I know way back then, the first programming language I ever learned was swearing.2 -
Today @ 4pm:
New dev: I need help with this issue, i've been stuck on it all day.
Me: ok let's look ...... ok, and did you try google this?
New dev: ... no
Me: ... why?
New dev: well this is clearly my issue, why would I google it? I only google for things I don't know
Me: ... ok ... we'll do you know what this bug is then?
New dev: haha ok, fair point, I'll give that a try. Thanks for the tip.
Seriously, should I be worried? I feel worried13 -
Yay my stickers finally arrived! Thanks guys <3 @dfox @trogus
And it freaked out my mum. She called me all panicked like "you've got an international letter what did you do did you get scammed or something"
...
"Mum, those are stickers...I got for free"
"Ohhhh... ok then"
But shre was very worried there ^^'19 -
Reinstalling arch. I broke it while grading homework. Sad. Also worried my phone is going to ring and I'm going to not have my laptop ready.16
-
Dear Microsoft,
It's been almost 2 days since you have asked me to update to Windows 10, I'm beginning to get a little worried, is everything ok?2 -
Happy to announce my middle mouse button has started working again!
I know you were all worried... :/3 -
I just came across some code I wrote a year ago that I don't entirely hate.
I'm legitimately a bit worried.2 -
I received my Driver's licence today. Yayy!! (I had been waiting for it for quite some time,worried if it will ever reach me)
Then I casually asked the postman. If there was any other package for me, because I am expecting a little blue package sent from US.
And he said he'll go back and check.
A few minutes later the door bell rang again 😍🤩
Here they are 😋.
I hope,even the devrant stickers reach me soon 😣.40 -
#¤%@ kid!!! My 5yo son has obviously been playing with his mom's mobile phone. At first, I thought it was a little cute, when I received incoherent texts about Roblox, one of his favourite games.
But then, I suddenly heard from my sister who was really upset and worried. She was wondering if my gf really wants to see her dead, after receiving a facebook pm in English, saying "oh die :-)".
No need for auntie to take it personally though; turned out she was not the only one getting the same message :-O
A little boy is facing a mobile ban for a very long time...8 -
I just got hired as a systems administrator at a company that develops web forms. NO ONE in the company has heard of git. They don't use any kind of version control.
I'm a little worried...6 -
I'm reluctant to introduce devRant to my co-workers because I'm worried they might connect the dots and realize I've been complaining about them :/8
-
To everyone in hurricane war path...
YOUR WONDERFUL STUBBORN ASSES BETTER LET ME KNOW YOU'RE OK. I'M GOING TO BE WORRIED SICK UNTIL ALL THESE FUCKING WATER TORNADOES ARE DONE.32 -
Online ads....
I think the problem is that in the age of "AI" and "machine learning" etc etc - the reality is that targeted or personalised advertising is absolutely shite.
All I see when I browse around are ads for things that I bought. It's like - I FUCKING BOUGHT THIS WHY ARE YOU TRYING TO SELL IT TO ME??!
I think anyone worried about the machine uprising enslaving humanity can relax and not worry about it, at least until amazon can understand when it has sold you something or you just looked at something.6 -
!dev related
Wife is not pregnant......
.....we have been trying to...STAY LIKE THAT FOR A WHILE NOW and after a big scare I was really worried :v we have one kid already and that Is how we plan to stay until I start my business.
These are the best news I've had all month.
Yaaaaaaaaaaaaaaay24 -
Previously on devrant
https://www.devrant.io/rants/455085
This little shit is actually worried about her ideas getting stolen.
Do you think she'll pay me in stocks or pennies?
#INB4itsAShitIdea14 -
Running a huge migration on our production db.
Takes 45+15 minutes (migration+tests) on my lappy. So. I'm going to be bored and slightly worried for the next hour.
Hopefully the production servers will be faster.7 -
Only a few days in on using my new phone, already gathered 67 tabs in my browser and counting.. should I be worried? 😥20
-
The public seems to be worried a lot on the Facebook "data breach" yet doesn't bat an eye on a bigger website that has already been selling private data for more than a decade.
Google9 -
I might lose my Job. Thanks to Central Bank of Nigeria's shenanigans, a promising FinTech startup might be about to go under.
Last month I got married, last month I got a raise. This morning, got told I'm being put on compulsory leave without pay (same as everyone).
Expecting no salary this month. I guess I'll be fine with some Laravel/Flutter freelancing.
Now, how to break the news to my wife. She knows I love my job, she's gonna be even more heartbroken/worried than I am. We were supposed to move to a bigger apartment next month when yearly rent here is due.
I guess we'll be alright. It is what it is.8 -
I just found this example in our school book. Should I be worried? (My teacher wrote the book BTW)19
-
Okay, this is me panicking. We're switching to Microsoft Teams at work. This means that I will have to cut the Slack and switch to a fucking Microsoft solution for chat. Am I supposed to be worried?24
-
My coffee to water ratio in a cup is starting to be 1/2. I'm worried in the future I will be eating coffee not drink it anymore 😂4
-
Dreamt I was writing code for work last night, pretty sketchy stuff. But then at some point I woke up, and in my daze panicked thinking that I'd actually written that code. So when I fell back asleep, dream me was working on fixing all the issues that I actually had never writen. Woke up again, worried about if I had left everything well, and realized my stupidity.
I need some days off... 📴2 -
!rant
I got a promotion at work!
Is it weird that I don't want it because I still feel like I have too much to learn to no longer be a "junior"? I'm happy that my hard work is paying off but I'm worried that this is how bad senior devs are made.7 -
I bumped into my PC early this morning, and it took me 12 hours to realize that 3 out of 4 RAM sticks were chilling on top of my graphics card... together with the CPU cooler.
I'm not sure whether I should be amazed that it kept running (with a few random reboots) with just a crusty chunk of thermal paste as a cooling block, or worried about how fried my hardware is now.12 -
Context: a co-worker had sent an email and was worried about possible collateral damage.
Co-worker: uhm, you know how it is when something just doesn't feel right?
Me: sure, every time I clock in here.6 -
Don’t know if I should be worried that I received an invite to a 1-on-1 meeting with the company CEO…14
-
the dev team freaked our boss out by being overly nice and polite to him for a whole day .
Normally we're pretty laid back and tease one another, so he was pretty worried.
You know you have an awesome and tight-knit team when your boss threatens to fire all of you for being too nice and you can laugh about it.
#AwesomeBoss1 -
I just dropped my office laptop !
😨😨😨😨
There is a crack on the corner of the body but the device is Ok !
I am worried they will charge me the whole cost of the laptop ( i.e. 3 months worth salary )19 -
*team worried about Slack conversations being tracked in the company*
Solution: Shared text file over network. Edit and save it for private communication. Best idea ever?28 -
I earned devie middle. Bought devie left. I came in this morning and devie right is looking at me???
This may be a Tribble situation! Worried when I open my office door Monday they may come pouring out. What will I do with thousands of devies???5 -
recently people have been worried about what people were going to say I.e "no hate" , don't hold back!
In devrant we only mean light hearted banter if we are pissed we don't want to hurt you we are pissed at a thing and not directly at you. Not that I speak for dfox or trogus but I'm sure that's what they are going for, and it's what ive seen!
We are nice here... This isn't YouTube , it's a credit to devs we are nice people. Hell it isn't stack overflow!
Also I'm brutally honest at times but I love you really.10 -
I hardly even know javascript, but I was able to identify and fix a problem in my Father's corporation website. Should I be worried, that the developer working for him wasn't able to do so?5
-
So, I told my programmer friend to bring food for us while you are out.
He has still not came, Should I be worried ?2 -
So I was just wondering, do any of you guys know what happened to @BlueNutterfly, I mean besides her parents taking away a lot of her beloved belongings. How is she? Is she still on devrant? did she get her things back? Did she move out? The last time I saw her here is a couple of months ago. I miss her and I think a lot of you do as well. It really sucks what happened to her and nobody should go through these kinds of things, I really hope she is okay and moved out or does so soon. If anyone could shed a little light on this, I would be very grateful, I'm really worried about her.14
-
I forgot my password to [SITE]. Of course, I click "forgot password", and enter my email, which I did remember. Fairly routine "ah shit we have a problem" steps.
Now, it takes a second. This is to be expected. So I'm not worried. I then get the email and...
Now, you will notice that I redacted some information, like the company name, email, and my PLAIN TEXT PASSWORD, and my name.
I would like to note that this isn't a small, very local company that's new (even then it'd be unacceptable), but this is a multinational, multimillion dollar company.
How'd someone fuck up THIS badly?13 -
To the coworkers who won't read this -- If you have a question to message me, type the QUESTION ITSELF. Don't coyly request permission to ask me a question because you're worried you'll bother me, that just turns it into TWO questions. Let us put an end to saying 'hey, can I ask you a question' and then virtually walking away.9
-
I have some how managed to put my self in a Software Architect role with a salary of a Junior developer, My team, who are even more junior as a swath of fresh grads are looking up to me to design this project. I am doubting my abilities and am worried I am going to under deliver, how am I ever going to learn this. Stressed.8
-
Long time lurker, first time poster. This site has been a huge source of fun and laughs for me on bad days.
So dear fellas,
I've been a software engineer for about 5 to 6 years which was intense as fuck and I've been burnt out multiple times. My highest rank was a senior software engineer so far.
I was offered a new job recently as a Technical lead for a small team which would mean I have to make architecural decisions on top of good ol grunting out the code. I took up the offer but I'm more worried than happy.
Impostor syndrome has kicked in heavily ever since I agreed to the job. What if they realise I don't know certain things that engineers are supposed to know? What if I get in an embarassing situation where somebody asks me a question and I'm not able to answer? What if people who I work with laugh behind my back cos I'm not a rockstar engineer?
I'm depressed and scared as fuck right now. Usually I had someone senior to ask my questions or get my doubts cleared with, now it looks like I'll be making those decisions and getting things done and I'm shitscared and worried as fuck.
Does anyone have any pointers, tips or anecdotal advice that might help me? It would be much appreciated.
Sorry for the incoherent rant. Have a good one y'all8 -
I just had my cell phone cloned yesterday. End of the day, my phone lost signal suddenly. I thought it was a problem with my chip, so I decided to check that on a store and buy a new one next day.
Today, after I recover my chip and number, I started to see the mess. Someone used my number to send message to all my contacts on whatsapp, asking for money. Also, I had some contact info changed on the bank broker, which is really serious. I do not know what else is compromised, and I'm truly worried about it.
Someone has some good tips for improving security while using cellphones?25 -
Sleeping well cleans our mind and let us approach a problem in a different way and help us find the solution. For some days I was worried about how to solve a couple of bugs, but this morning after a good sleep I magically realized how easy the solution was:
WON'T FIX2 -
Should i make my game open source? It will be free, but i'm worried about theifs..
(reuploading as their work, or selling)21 -
I am worried of a future in which JS has taken over everything, fortunately wasm is here to help :D5
-
So I found out few days ago that I’m pregnant. All’s well, except this guy who sits behind me in the office and keeps going out for a smoke every hour and returns smelling strongly like cigarettes. The smell fades after a while and he goes out again. Repeat.9
-
Our HR guy is a tool. He requested I help him extract some data from our database. Which based on what he requested I supplied he then started trying to bully me because the data I gave him wasn’t what he wanted. Ringing me every 5 mins asking if it was ready, comparing me to another colleague who wrote the system.
When we blew up at him telling him to back off he continued. Anyway he still works here and persists in being a tool. i on the other hand ignore him.
I’m pretty sure that the HR bullying an employee is wrong, not massively worried about it just annoyed6 -
Just overheard a conversation between 2 pilots while waiting to board a flight at an airport about some airplane related software. The guy talking seemed very proud (read egotistical) about his tech knowledge. It went something like... "Well you see it's open source so they are worried someone might have put a backdoor in it somewhere".
That's the point of open source you dumbass you actually have the ability to check 🤦♂️ -
I slept on my phone.
Like, physically ON my phone.
Now I'm worried it might be broken in ways I haven't noticed yet... 🤦🏻♀️14 -
Our company is changing the default branch on our main repo from master to main.
We're literally on the verge of global genocide and a holocaust, and people are worried about over-sensitive people's feelings. I'm sure a branch change will end racism.5 -
My father calls me very worried: hey, do you know your mother's email login username and password? We need it
Me: no? Why would I?
My father: well, she sent it to you on email when she created it, so you'd remember!
?? What?2 -
Seems like the ad spammers are quite active recently. I‘m worried.
Also: fuck every single one of them human scum.13 -
Really worried about one of my devs tonight. He's going to go into surgery. Hoping everything will be okay. :(
-
After being let go from my previous job (previous rant) roughly two and a bit weeks ago I already have multiple offers for new jobs.
There's lots of sterotyping for how difficult it is to get a new position in this field. I was worried, this is such a relief1 -
As a student on platforms like these, hearing people talk about languages and concepts you've never heard of6
-
Am I the only one who gets extremely nervous the night before an interview as that technical test can encompass the entire academic field of CS. I'm just worried I'll forget the difference between a clustered and non-clustered index or fail to convey the difference between TDD and BDD.
I'm ten years in to my career now, so I 'should' know my stuff. I've produced the tests my self, hired other devs, but I still feel the nerves.8 -
Worried about your application crashing? I have a fix. through the entire thing in a try/catch and catch Exception. 😁😁2
-
I once built an app because my girlfriend travels a lot and I was worried she might be kidnapped. App becomes a big deal, now I have to add more features. I really just wanted a holiday and peace of mind.1
-
Is a week enough time to figure out if a company is right?
I'm not sure if I like this new leadership team...
I'm starting to think that I might have been far happier with my previous gig...11 -
My new favourite quote...
"I can't be the only one worried about the deadline"
By boss speakign ot my team who is expected to deliver 6-8 months worth of work in 5 weeks time...
Too bad he does not know he IS the only one worried, when you going to miss a deadline by that much when you never agreed to it in the first place, have not seen a single API and the scope is still actively changing and lets not forget we have no DevOps yet...
why the fuck would you worry...1 -
Our UX guys have all congregated in a conference room and are practicing their joker laughs.
I'm slightly worried. -
Worst experience: being laid off when the startup I worked for lost a deal. I loved that project :(
Best experience: my new company sent me to USA for a few days to meet the client. I've gained a lot more of confidence on my spoken English. I've didn't use it in years, so I was worried. Perhaps you wouldn't think it's a "dev" experience, but English is actually a required skill for a developer who has it as a second language.1 -
Started a new job and our tech lead doesn't know how to use GIT in a team environment, has only ever used it while working by himself on one person projects. Kinda worried...2
-
< 1 year of professional software experience - company: there's too many of you, come back when you have 3 years experience
3 years experience - company: those entry levels have now gotten 3 years experience just like you and now there's too many of you, come back with 7 years experience
7 years - company: too many of you, come back with 20 years
20 years - you: create sentient AI and order it to destroy the company. AI: sorry, I'm looking for an owner with 100 years experience, sorry.
Fuck.4 -
The human in me knows casting a datetime to a decimal(20, 12) is fairly future-proof.
The dev in me is worried someone working at the same company in 273669 years will get mad at him.5 -
By the way, did anyone ever went to hospital because drinking too much coffee? I drink it, you drink it, we drink it, but I'm seriously worried sometimes about my heart and blood pressure.13
-
Just started my first "management" role after 12 years as a developer, first thing I learnt is its just like my last role only I don't have to do any of the hard work.
Worried they'll figure out I'm doing almost nothing soon, any tips? Should I just start scheduling meetings to discuss meetings?4 -
Recently got promoted to Senior Engineer position. Should I be worried for not knowing what that 'Senior' means? 😳21
-
When you can't sleep, because you are more worried about your code review...
That's my state right now... -
I like writing bash, im just really worried about the time when the management eventually decides we need to support windows.1
-
Apple is really worried about their huge failure with the i9 6-cores, worried they won’t sell.
How do I know? Well, this...2 -
I want to ask for my devrant stickers but I'm worried the South African postal service will just lose the package or steal it themselves6
-
Is it just me or with every Dev rant avatar the males seem angry/annoyed and the females look worried?7
-
I DID IT! I got my first co-op job!! I’ll be starting in the fall and I’m super excited 🤩
Finally I’ll get to do real work and I’ll get to see just how far schooling has gotten me.
Gotta admit I’m a tilt bit worried I over sold myself in the interview but we will cross that bridge when we get to it 😅
I’ll also finally have some real rants soon enough 😏😅1 -
Received an email from my previous employer (I worked there two years ago)
They have positions opening up in a few months and want me back.
Here I was worried my current job is at risk and now more than likely I have a job waiting for me now.6 -
An area of my company hired a new director who directed his “DevOps” team to implement a process that would prevent the CI server from running tests on a PR unless the code was reviewed first. He was worried that there would be too many tests executing with 400 developers committing code frequently.
He’s from Yahoo.12 -
Im slowly going from emails like "looking for developers" to "hi, when can you start" and i dont know if i should be happy or worried.
-
Wow, y’all are depressed.
https://twitter.com/williamsbk/...
I don’t work in medicine or military so no one dies if I use “<“ instead of “>=“ because I wrote the variables in the wrong order. I’m not worried about skills, I’m worried about saying the wrong thing to the wrong person because direct, clear communication is out of style right now.21 -
I'm worried. I would love to internship for my current boss over the summer.
But there are only 4 spots and 10 people competing.
She basically wants an assistant to help with her photography gig. But many of the skills she's asking for are graphic design related minus the website building.
Fingers crossed that what little knowledge I have there can be enough to get me free housing for 8 weeks. Would also love the chance to build a website. Here's to the interview tomorrow.2 -
!rant
Made my research about mechanical keyboard and was worried that my first one was going to be too loud at work.
I can hear the majority of hammering cave trolls smashing their membrane keyboards louder than I can hear my MX Brown.
This shit is like heaven for fingers.
:D9 -
College is rapidly sending me into a never-ending spiral of depression. I have to take Calculus-based physics for Computer Science, and it's making me want to kill myself. I'm not going to get anything higher than a D in it, so I'm going to have to take it again no matter what. I'm worried I'm not going to get a D in it because if I don't get at least a D in it, I won't be able to take the second part of it in the spring, which will remove 5 credit hours from my schedule that I will then have to find something else to fill with.
Worried that the terrible Physics grade I'm going to get is going to drop my GPA below the requirement for my scholarship. Worried that I'm going to get kicked out of the honors program as well. Worried that I'm going to be here for three more years. (My scholarship runs out in Spring 2020.) Stressing out about my Physics final tomorrow that will determine whether I pass or fail the class.
Im starting to wonder if that Computer Science degree is worth it.6 -
My smartphone's fingerprint reader just stopped working, after EXACTLY 36 months of usage.
I always took care of this device to make it last, as I'm worried about resources consumption and what the production chain involves (like having working children in African mines).
I'll try to keep using it as long as possible, but I can't stop thinking that this problem shouldn't be always on us, the consumers, suffering defective devices designed to last only for two years.
We should put more pressure on producers to reduce electronic waste, and to invest more on the maintenance & repairing sectors (which are almost non-existent).
That's all folks.3 -
My bookmark bar has a random entry for "Clam Poisoning" , between all the Amazon Web Services and Ruby entries. I'm not sure who put it there? It wasn't my wife or I. Should I be worried? Should I avoid all the shellfish for a while?
-
Just wrote an angry email about the unrealistic demands towards my team. Got a call an hour later from [product owner] where he had the most worried voice i ever heard because we are the only data scientists in the research. I expected an email reply in 2 weeks, seems like we are somewhat important here.2
-
I'm still wet behind the ears as developers go, and about a month ago I cobbled together a webservice. After many bug fixes I somehow got it working as intended, held together by tape and shoestring and creaking all the while.
This week, one of the consumers of the service wanted me to open it back up to change the name of the request .xsd. no functionality changes, just a name change.
I protested, worried my service would fall apart if I breathed on it. But he insisted so I made the change.
I just tested it and... it's working as intended.
But I still want to be mad about this!! -
I have more side projects than I'll ever be able to finish. When I do finish them (or at least get a mvp), I have no idea how to market them, and in many ways, I don't even want to. I'm worried that it will kill the fun of it for me.3
-
My boss creates so many wtf moments with his total tech "un-savyness", although he is the " lead" dev, that I'm getting worried that I might be doing the biggest wtf faces every time ... I can't pretend like nothing is happening anymore .... Fuck!
-
Are you worried about your development environment becoming more and more unstable?
Let me give you an example: I've been (mostly) a .NET developer for about 10 years now and yes Visual Studio crashed sometimes but not very often. Also whenever I found something that seemed like a bug in e.g. the MVC framework I always realized that the problem was in my code. However recently there is a VS update almost every week, and I more and more often bump into open GitHub issues without a fix.
Is this the same with other development environments? I also had a lot of issues with XCode/Swift but I never expected that to be stable...1 -
What do you think about my resume?
I would like to apply for other jobs, im tired of my shitty actual job.
I'm worried about the ranting on the resume, is that politically correct?
https://drive.google.com/file/d/...15 -
High paying unstable job at a startup vs. Low paying stable job at a huge company.
I'm currently at the latter and I'm expecting a job offer (hopefully!) from the other one today.
Low paying job:
Pros:
1) big name. (their stock has recently gone down tho)
2) insurance and stuff.
3) quite stable.
4) can re-skill and move to another team.
5) work from home.
Cons:
1) shit technologies.
2) lots of fake "we are a family" kinda crap.
3) shit pay for a huge company.
4) boring. I feel very unmotivated.
5) obsolete systems and management processes.
6) it would take years to save for a car even with my upcoming promotion pay raise.
High paying job:
Pros:
1) awesome salary. Like 6x my current.
2) up-to-date technologies. Something I'm passionate about.
3) team lead position.
4) I can buy a car in a couple of months.
5) might get a visa sponsorship in the future.
6) small team, my voice will be heard.
Cons:
1) it's a startup so it can go down anytime.
2) no insurance or any kinda benefits.
3) no work laptop.
I'm kinda in the beginning of my career, so my gut is telling me to risk it and go for the unstable job.
It will be my first time to be an "official" team lead and honestly idk how I'll go about it yet.
Which one would you go for?
And wish me luck! The interview went pretty well but I'm dreading for some reason.17 -
See? And you were worried it would take our jobs away from us. It's still got a lot to learn!
I mean, you, developers, are fucked. It's us, Performance Engineers, whose asses are safe15 -
Finally got an offer from a multinational org i could previously only dream of. Ugh i really deserve it plus i didn’t fuck myself over by not negotiating this time. Got an extra 10k on stock options which was wild. Bye bye leetcode, hello Netflix and weed for the next month until i resume in August.
Such a relief knowing my family will not starve and die (joke but i am my family’s support so i was a quite worried last month when the interviews just seemed endless).7 -
I really really really need more RAM. 16GB is far from enough. Had to witness the kernel kill all of my Chrome extensions and most of my tabs and an IDE and still it wasn't able to run that container in the 8G RAM it just freed up...
I remember the days when 8G RAM was an overkill.
The times have changed. Now I'm looking into getting a Linux lappy w/ 96GB and still worried whether it'll suffice my needs....5 -
Command: "Infantry unit, this is Command. The enemy is approaching, what's your status?"
Infantry Unit: "Command, this is Infantry unit. Just a quick note, my pronouns are they/them. Can we please use that in all communications going forward?"
Command: "Infantry unit, the enemy is upon you and you're worried about pronouns?"
Infantry Unit: "Command, this is Infantry unit. It's not just about me, it's about respect and inclusivity"
Command: "Infantry unit, you're about to be inclusively dead. Defend yourselves!"
Infantry Unit: "Command, this is Infantry unit. Wait, what? Oh s***."
(End of transmission)15 -
I would like to proclaim my utmost love and respect to a programming language and one of its framework.
This language/framework combo was so beautiful that during development I had fantasies about it coming to life as the women I want to marry. I genuinely felt love in my heart to her. I even felt butterflies in my stomach thinking about her!
But I'm worried I might jinx it. So I'm not gonna name it.
I love you.8 -
Just got a job offer in a DevOps team, the cloud company is Netherlands based. But I'm worried about the Brexit because the day is a coincidence... and I'm in London.6
-
I am a senior .net developer and I should be promoted to a software architect over Java and .net soon, and my parents independently asked my wife and me if my job was stable. They also asked me if I was worried about losing my job. They have no idea what I do and they think it is nuts that I get paid what I do for the hours I work... I doubt they will ever get it.2
-
Omfg... Fixed 3 LifeRay 6.1.1 ce security bugs in less than a day. I should be proud, but I am actualy fucking worried I've been with this project for too long if I can already make liferay fixes THAT fast...
Am I becoming a legacy...? Shit5 -
My current project involves storing parents and children of parents in to a community database.
My current parameters include "availablechildren", "selectedchildren" and "forchildren"...and I'm worried somebody in this office is going to see this and I'm going to end up on some kind of register :S12 -
I'm worried about me, and my future carrier path...
I don't know in what direction should I walk, to become the best as I can
And I'm going to be as best as I can...but Google Maps doesn't just show the direction, it gets lost as me...eh...
Yesterday, I've told to dev genie just 2 wishes, but as my third wish, I'd like to know in what direction should I walk, which roads should I avoid, what shall I do.4 -
Either my server is hacked or I fucked something up two days ago without knowing, I suddenly start receiving a dms file when I try access my domain or either by IP, file name is: valroSG0.dms
Do I need to be worried :S10 -
that's convenient...
IDK whether I should be happy it crashed or should I be worried because it knew where I was going and pretended to crash1 -
so there is this guy on blind network who makes half a million per year... and he is worried about his job "since it might be automated away" and he is looking to switch career paths!!!!
mind boggling that a "software engineer" with that type of pay hasn't recognized that LLMs are all hype and no bite
wild
it's insane to me that people making more money in a year than i've made in my decade career know little to nothing about software
what an absolute insane time to be alive4 -
hey guys, i was recently appointed to be devops engineer in a company. i did want to be a software developer though but they chose me for devops because my lack of java knowledge and a bit knowledge of linux and stuff.
my question for u guys is that... is devops good? for future career as well.
i m quite afraid to be honest, wouldn't want to have made a bad career decision. 😅😅
i must admit i have always enjoyed programming and hence i am worried in devops.40 -
I'm not a freelancer! made my account on Fiverr back in 2017 during college never really used it. Eventually logged into Fiverr last night and got a message from a girl who was worried about her college project. It was just a weather app in JS. That I created by copy-pasting from some indian guy's blog over internet in 15 minutes. I didn't know if it is ethical she was like praising me for making a good app in just $60. It doesn't feel good but here is her review😂3
-
When updating + restarting your Windows PC fixes the random exception being thrown in your controller when you were worried your frontend code broke the site. 😲
-
I wish I had that self esteem a lot of my classmates posses.
I'm working for my prof, I've kinda made my very first step into the industry. Somewhere deep inside I know I'm talented and smart. However, every day I am worried that I'm not good enough and it will be noticed at the job soon.
Is that common thing in Dev community? Just want to know opinions7 -
Relative phones up worried about installing Adblocker as it "can store and modify the websites you visit"...my answer.."so can GCHQ, NSA AND CIA so just give in to the fact that you have no privacy and click ok"...*long pause*.."ok one more question, what's a chrome extension?"..FML
-
Recruiter bot just emailed me with some offers, let's take a look...
"Hand-on Experience with SQL and NO-SQL Databases preferably Redux"
Whew! I was worried for a second, thank god they are using a Redux database and not one of those really crappy React databases! I'll really consider applying now.
smh2 -
I'm fairly new (less than a year) to programming and I'm just wondering what everyone's thoughts are about this.
Is taking college math courses necessary to be a good programmer?
I am learning online and I'm worried I won't be a great programmer without all the math. The last course I took was Trig :/
Also add any suggestions you have. Thanks all!24 -
The company where i am working at currently is kinda weird. The company is run by a gujrati guy and he has placed almost all his cousins in high positions...and on top of that the CTO (whos the bro of the owner) micromanages people and also fires them on a whim...i am kinda worried that if i am not able to do a particular task, i would be fired too...He has asked me to do unit testing of some complicated functions on mocha/chai and i have never done all this before. I am not understanding what to do and there are no senior devs in the office who knows about these things...7
-
Does anyone else ever get so distracted/tired/pent up with other shit going on that they become a liability?
Last night I had about 5 hours sleep and have been worried over general UK politics lately.
Today, on a phone call to get support over getting locked out of our Apple Developer Program account, the call centre agent asked if we had the password.
I immediately replied "Sure! It's **begins saying actual password allowed over the phone**6 -
I have to go onto windows to do something that Linux can't do. Should I be worried about all the updates? (particularly worried about them overwriting my other partitions since I dual-booted)7
-
My boss wants to put an Amazon Echo Dot in the conference room. So I suggested covering it with a cheese cover (those glassy dome thingies). He thought it would be an artsy statement, but I was actually worried about privacy.
Anyone have any experience with listening devices in the workplace?3 -
Can people at least write a damn comment and tell me why the fuck they don't like the app???
Yesterday I released an update and noticed someone left a new review, without comments, just a one star review.
First I was worried because maybe the update has some nasty bug, but no, this stupid user rated the app without leaving a comment, GREAT!!!
Now google only shows that specific review because the others were of an old version, so great, now anybody wanting to install my app will only see this shit.
If you already took the time to open the play store specifically to rate the app, fucking say something!!! insult me, say it's a bunch of crap but say something you piece of shit!5 -
Sprint 1 of being a team leader. I wake up in the middle of the night worried about how to manage these newly arrived juniors.3
-
Me and a friend starting to program a game in Unity, he's worried and I think we will ace it! How f***ed are we? (5 years of website development experience each)8
-
So Is it just me thinking that no one would pay for my work (web dev, IT stuff etc...), because it is so easy to build a website for example. I'm kinda beginner, what's your opinion on wordpress? But mybe I'm just rushing things, we want to build a webdev business with my friends and I'd like to hear some idea/experience from you guys :)6
-
That guy at the office who gets really irritated and worried about newly introduced technology. He would spend 2-3 days talking trash about it, saying how much he prefers the older and less efficient approach just because he knows it.
That fucking guy.2 -
Something about my experience in a startup that I co-founded as a developer is that I feel like everyone always depends on me for almost everything. So when I just want to jump in and code, I have to be worried about who's gonna call me for what tedious reason. It really gets to me.
-
#! Linux 4.1 is out
Insanely great but I'm only worried about several massive patch sessions
https://theregister.co.uk/2017/02/... -
thank god, Microsoft decided not to use lignite coal for updating their OS. I was worried to update windows, it used to cause so much smog in the neighbourhood, one uncle even died because of lead poisioning.
now, I can update Windows in peace, no more pollution.5 -
56 repositories
14 stars
keynote speaker
once again your daily reminder that software is no exception: it's about how you appear and talk, not the actual work you get done or competance
this is why i'm not worried by technology or aRtiFiciAl InTeLLiGenCE taking over - there is so much bullshit politics and idiot "emotional" choices that in fact rule the career / industrial environment, not actual consideration of improving workflows or efficiency7 -
So worried people will fuck things up in work when I'm not there. It's causing such tiredness and such long days. 🙇I think it's caught up with with today. No holiday leave taken for 9 months and not a day off sick. 🏳1
-
Did anybody buy .dev domain from Google? Their website was quite slow yesterday and somehow I managed to add my first name .dev to the cart. But in the last screen I got stuck with "Registering this domain" message. I closed tab after an hour. Today it is still under pending domains. But if I search for the availability, it says exact match is available. Should I be worried?8
-
The university's IT Department has asked to talk to me asap.
I dont if I should be worried or not!12 -
Got my first job in a web development company. I am on a trial period, which means at the end of two weeks they will evaluate my performance and give me a full time contact. As a trial I am given task to work on internal CMS system. And OMG!! the coding is horrible. I think someone can start from scratch and redo the entire thing faster the adding new features to that piece of Hell!! Am worried after 2 weeks my performance is going to look bad.10
-
So I can guzzle like 6-8 cups of coffee a day, should I be worried about the caffeine or the sugar? 🤔12
-
Moved from a gambling company to a government body. Got to say I'm less stressed about estimates now but more worried about standards here.
Stress and career development < No Stress and less career development.
Ask me in a few months.4 -
Not sure if it is a rant or not but I'm getting worried about Apple... Two days passed uploaded a new update multiple times and all ended on the first try 😨
Usually it takes many tries for it to be uploaded 😨
On top of that, iTunesConnect is faster and no longer stuck at loading when token expires 😨
I hope I'm not dreaming 😅4 -
When your boss calls for a meeting with the whole IT department because he is too worried about losing face by lecturing the guy who talked back to him.
-
!dev?
Colleges now require proof of vaccination but admins are worried about the spread of fake vaccine cards
https://apnews.com/article/...
My mindblowing solution: require students to submit a covid antibody test result instead.
You can't spoof the lab test result number and it can be easily verified by calling the lab...
Can even create a site for that...
isTestValid.com
Worried about privacy... Have labs upload a hash of the data...
And user submit their hash...
Clearly nobody asked a dev for they're input... again2 -
I’m worried my manager denies me my role shift because I’m supposedly an invaluable asset to our small team, even though the request has been approved by the higher ups already. I would totally understand, tbh, but it’d suck nonetheless.
I don’t consider myself ambitious, but I’d like to move forward, not just run in place.5 -
This weekend, I bought a mechanical keyboard to use at work. I'm worried the clicking sound will bother my co-workers around me. Does anybody know if bringing the keyboard to work will make people hate me?
It's a Logitech G610 with Cherry MX Red switches. I ordered some rubber o-rings on Amazon to dampen the keys. They should be coming in tomorrow. Should I risk bringing the keyboard into work before I dampen the keys?7 -
Dear Passionate Programmer,
Do you ever wish you chose a different career?
I’m a self taught dev & wanted to make something of what I learned. So I moved from a small town, landed my first tech job (!dev), but the closer I get to my goal the more worried I get.
I’m worried that making my hobby a career will eventually lead me to loathing the one thing I love. And I’m not really sure if I should stay the course or turn around in hopes to save the ship.2 -
Do you guys worry about your non disclosure agreements at work? I use my personal computer at work so I do my own projects on the same computer as work but it makes me a bit uneasy. We're a broke startup and I'm lucky to have the job so I'm not going to ask for a computer.
Also, are you aware of it when you make rants- trying not to be too specific? Or are you not worried?7 -
I am in 3rd year of my college and I am a bit worried.
How you people apply for jobs? Do you just walk in a company and talk to the receptionist or.....?7 -
Did some contract negotiations with the company I work for a couple of months ago, when they offered me a promotion starting next month ... today I got the contract. Only one of the terms we have agreed is in the contract, of course that benefits them. No word about any promotion etc. Wrote to the guy in charge today but no answer so far. Should I just abandon ship or am I just to worried?4
-
Worried about college because there's only one year to go for me to graduate, but now I don't give a fuck about it nor I care about any of my subjects. All I want to do is working on my own coding projects and play video games4
-
So I am on a vacation for a month and a few days before it ends. My boss calls me and tells me "why don't you take one more week" then he told me that's when he will be back to work as well because he is traveling. When I told him why he said he wants to talk to be before getting back to work.
When he found me sounding worried, he said don't worry there is nothing you are missing we just want to align our plans and give you updates on the period you were gone for.
When I asked him what if I wanted to get back to work sooner, he said I prefer if you wait till I come back
And now I am super worried and paranoid, advice please 😥5 -
My gf wants to be a nomad.
I just like to code in my chosen place of work (home) and not lose focus with moving around.
I'm worried, I get anxiety if I don't find myself in places that let me be productive. I'm very much like a cat in that regard 🐈7 -
Developer-in-training at OSU, worried about being able to find a job. Contributing to an open-source project right now to try to hone my skills. Any advice from the more experienced?3
-
So after a couple years working at this company, the faculty I graduated from introduced a postgrad (masters) course in data science. I was always interested in the field, so I said fuck it and jumped the bandwagon...
I'm starting this week, I'm kinda worried my knowledge of maths and statistics got a bit rusty since graduation. Also most students there will be 4 years younger than me, and I'll keep doing my full-time job at the same time. But hey, at least I'll break the routine, and I can always quit my job if it turns out I can't do both, so whatever.
That's all folks!1 -
What are your thoughts about Elon Musk, is he really worried about AI or is this just a business strategy ? I mean I am a huge fan, love his work, but he wants to be the ruler and saver of the Universe.13
-
To the Irish devs here, any experience with employers in Galway or Cork?
Most jobs are in Dublin or Midlands but every now and then something nice pops up.
I really wanna move to the west or south in the next 1-2 years but I’m worried about the job market there.
Of course the salary will be lower than in Dublin but I’d assume it’s still very well paid for local conditions?
Dublin is just too international for me, I like the quieter, more traditional counties better..
Don’t hate me for that dubs😉3 -
Here's what's on my mind.
I am building portfolio website as my first project. But I am doing this going the self taught route. I do not know a single soul in the developer space. And none of my friends or family are technical.
How can I get feedback on my site?7 -
Orchid syntax highlighting
I gotta say, I really like the text image of my new language ^_^ This is something I was worried about, although that's part of the reason why the entire syntax is defined natively and can be modified on a whim16 -
I don't think we need to worry about judgement day anytime soon... If anything, we should be worried they miscalculate where the ICBMs are going to land...4
-
Hello ranters, I have to send my beloved laptop to acer support to get somethings fixed and I'm worried for my stickers. I don't want to get them damaged or lost (maybe they need to change the screen back plate or maybe they send me a new laptop all together). Is there a way to peel the off and reapply them with new glue?5
-
Hey guys!
I have a question
When I'm coding sometimes I get sick
I mean this is getting me when I'm worried if the deadline coming day after day, I get nausea a lot
By a lot I mean a lot
I can't even look at my computer screen or even touch the keyboard
Is it only me or it's normal ?!!
I think it's stress13 -
OK I'm getting real tired of people posting stuff about Net Neutrality on here, as we all know about it at this point.
The one thing that gets me more angry is that these people get it wrong.
People look at this Net Neutrality thing and instantly think: "Oh, well, I would have to pay more. That's bad."
What it really is is that your ISP can see what you have been searching and would be allowed to send that information to a third party, or change the speed of your internet if you search something their sponsors don't like.
This is what you should be worried about. Your privacy, not your wallet.5 -
Me: Spends 4 hours configuring my new IDE
Me: Hovers Apply for the last apply
IDE: Crashes
Ne: Reopen IDE, not worried as I applied and saved multiple times during setup
IDE,: Totally zero'ed EVERY SINGLE SETTING...
Me: Googles alternatives to X -
Getting back into job hunting and job interviews after 2 years of employment is like going back to dating after being married for 5 years.
It feels weird and I'm worried I might be too forward on the questions. But I like how easy to apply for jobs now. Easy one-click apply from my LinkedIn account. Not sure if I should apply for startups or not -
Hi friends of devRant. I'm looking for some advise.
I love learning new things(tech). I want to try out a lot of things like crypto, game dev, AR/VR, etc. I'm also a student and worried about my career. You know you just can't keep exploring technologies and not focus on a single track. Currently, I'm good with web dev. It feels so difficult at times. I hate leetcoding/competitive programming. So you can guess I'm not great with whiteboard interviews. How do I manage time to learn new things and also be able to land a job in a domain? Do you ever feel the same? Any career advise?5 -
He said,
"With AWS, when trying to create a new instance
'Your quota allow for 0 more running instance (s). You requested at least 1'
with regard to the problem, I want to know a method to surely solve it."
I said,
"As far as I see it has reached the limit of the number of simultaneous execution instances, what kind of solution would you like to see?"
I am worried coz he has no reply. -
I worried i would be jobless for six months. Ok i applied at at least 20 different companies but i’m only jobless for two weeks now =D
-
Fuck, I love my new Varmillo keyboard with black silents, its actually somehow quieter than my colleagues membranes. The membranes those guys use have a sharper "thump", whereas mine sounds muted.
Before buying a mechanical for use at work, I watched a lot of youtube videos on sound comparisons between different switches. I was worried about the noise levels because it didn't seem like there was a whote lotta difference between a dampened switch and a regular switch. It seems like everyone is cramming a microphone right on top of the switches and not a whole lot recording from further distances.3 -
Does anyone use pushover.net or know a reliable / cheap push notification app with an api behind It?
Im trying to setup some monitoring alerts back to my phone, using slack / teams etc for personal projects seems pointless.
Emails are currently being sent but this relies on me actually looking at them and I tend to miss a few important ones. 😂
Not to worried about daily / monthly limits, it's going to be < 20 notifs a day kind of thing on a terribly bad day.6 -
I finally got my new home server.
A Lenovo ThinkCentre M720q in one of the higher configurations.
Any ideas what top level OS I should put on it?
ATM, I'm thinking Proxmox, ESX or Alpine.
I like proxmox because of the neat UI for everything but I'm kinda worried about how it basically takes the most important parts of the system over.
I like Alpine since I already use it for quite a while as my goto server OS and because of AWALL, which IMHO is the best linux server firewall.
I didn't get to evaluate ESX yet.6 -
I don't program for days on end. It takes a few weeks and then I fell good about it again. Sometimes I wonder if I even like programming. I do well in college, but I've never had a job as a dev (aside from student "research" positions). I'm worried that I'll just burn out and get fired or quit and lose interest. Maybe I already have? Can't think of any side projects to develop either, they all seem out of reach. Still figuring out how to cope with it. The test grades don't do it for me anymore.1
-
So far nothing yet, since I'm in a region of the US with no confirmed cases. Am worried about relatives in China though.
-
I'm soon gonna leave my secure and well paid job I'm actually doing abroad for trying remote working from my home country. Let's see how this will play out...
-
I'm worried that this question will probably get downvoted on SO and I cannot post from my account as well, so here it is..
How to play youtube embedded video in mobile over a custom button / svg / image ?
One idea I'm currently working on is to trigger &autoplay=1 onclick but it is only appending that parameter to existing URL?
Please let me know if you have any thoughts, and I'm doing this for only mobile devices only
P.S I cannot use YouTube API11 -
!dev
so I got asked how much I wanted as my monthly salary for my first dev job and I said 300 USD, did I overshoot ? I haven't gotten a reply yet and I am worried I messed up
backstory, I had this online video interview but during that period i was working for my dad in a remote village, the background was terrible, I had to tilt my camera to an odd angle to make it less terrible, after all the usual talks on "our company company's vision and mission........ we are trying to create....... blag blah blah.......". he commented on my area and I said I was working odd jobs to keep up,
him: how much will be enough for you monthly ?
me: I just need enough to pay for internet and maybe a little left for other stuff (I was this desperate)
him; no we need you to face this job squarely without distractions, how much will be enough ? send your reply as message, yes, they reached out to me through email and whatsapp
me; 300 USD
I'm fucking worried I was over the bar.9 -
We can't run linux on our work machines but I need to build a couple of linux scripts.One drive said it backed up my dev VM...so where is the hard drive file. Its been syncing to my new laptop for a day.2
-
Remembering of when I first learnt about the importance of version control.
There I was, working in Visual Studio, laptop unplugged; the laptop suddenly shuts down - battery dead. Not too worried, might just have to rewrite a few lines I had not saved. Restart the machine, open VS, the file I was working on now contains strange characters - totally damaged.
Google for help, find a question on stackoverflow with the same issue (comforting moment). The answer I get:
"First question, why wasn't your code on source control?"4 -
Web Developer should not worried much about the older browser and modern browser. If people want to visit today's website without any problem, they should upgrade their browsers.5
-
Is exclusively being assigned bug tickets only for a whole sprint (they're not my bugs) while another dev does feature work a bad sign? I'm a Senior SDE but my domain Knowledge is far weaker than the other SDE 2, so he can get feature work done faster. Bug fixes are general project ones that are either suddenly very critical or lower priority and leads me to keep debugging some other aspect of the system (not much documentation sadly so have to check whole flow slowly to understand it, very financial based).
My manager also just yesterday said as a senior my expectation is to lead a project and we'll discuss the requirements of my role. This is my direct manager, the one who assigned me all the bugs is the project manager, who also acts a bit like an SDE sometimes. The problem is I want to deliver work my main manager suggests but I simply don't get the time due to suddenly high priority bugs occurring (last night 1 hour before I log off, other manager says to find root cause analysis of a high priority bug), this isn't an oncall rota or task either, just normal bugs all the time.
Is this a bad sign? Am I about to be PiPed?9 -
I want to code, but I have to prepare for my GRE, but I can't, coz I want to code, which I can't either, coz I'm worried about my GRE. As I open my books, my heart craves to see IDE. I'm fucked up, literally.4
-
4 hours until major release goes live, should I be worried that the lead dev on handling releases called in sick today? If it goes badly I have no access to fix it until tomorrow.4
-
I think I'm balding where my headphones usually sit...
Still not gonna change to those god awful in-ear ones though !1 -
guuyyyssss....?
What'd just happen....?
I remember this happening quite often on Windows machines: occasionally some random popup window appears for a second or two, does whatever it does and disappears; usually it's either a cmd or a ps window.
Just a few moments ago a weird window popped up on my screen, its title bar was saying something about VisualStudio, and after ~2 seconds it disappeared.
The reasons I find this concerning:
- I don't have anything VS-related installed on my current environment
- I've been running Linux for years now
What the f did just happen...9 -
I have been an android developer since long time, yet android migrate everything from Java to Kotlin
But am really worried to migrate everything from Java to Kotlin or begin this phase can you please help and tell me where is the best way to learn kotlin and get easily adapted3 -
GraphQL or REST?
I'm not really worried about boilerplate (my research reveals it's roughly the same), I currently have a (very incomplete) REST interface, but that was just for testing.
Also, the API has no real usage yet (I only use it for submissions) and it literally exists for the sake of having an API (so I don't need to write it later).10 -
Well my PO introduced the concept of owning stories (which we naturally used to do) in our pairing environment. After we gave names, we started seeing each other like seven different kingdoms. Suddenly my PO looks like Cersei. And I am looking like Theon Greyjoy, hardly worried about other stories and stuck with no pair to complete my stories. That's how pair programming died a casual death.
P.S : Tomorrow is my (our) demo !! 😭😭4 -
Hi
i'm going to buy a new laptop in couple of days and i want to install ubuntu on it.
i'm worried about the hardware compatibility.
do you have any advice for choosing hardware?
thanks6 -
ChatGPT is blocked in my country, I had to get creative to finally create an account but holy shit it was worth the effort. That thing is freaking fast and I am honestly a bit worried about how these technologies will evolve in the future. Well time to make my boy GPT write me some code 🤪12
-
What do you think about the Crystal language?
It looks kinda cool, but I'm somewhat worried about the lack of Multithreading and the beta status so far.21 -
My comp lecturer accidentally created a duplicate of an assessment submission online and just renamed it "Duplicate Hand in (can't remove)" because he couldn't remove it. I'm a bit worried he was lecturing my second year OOP design class....2
-
Has anyone ever figured out why the fuck Android reboots seemingly out of nowhere at random times?
Is it kernel panics? Is it some shitty bug that has been plaguing this cursed OS since its inception? [sidenote: boy that was a mouthful of 's'es]
Or are we already at the mercy of the Big Brother, and someone at the controls likes to play random pranks on us when they're bored?
Thinking of switching to LineageOS more and more, but I'm kinda worried about resetting my phone since I've never done full backups/restores and I have no experience in the matter...7 -
When it's been one month you don't see that bug always worried you and you realize it fixed itself :)))1
-
I am quite worried about the approach users have towards technology...
I am starting now to work to my bachelor thesis research in algorithm, so I'm still very young.
But when I think about which mental process guides people when they use or try to fix their pcs is very worrying...
I mean I am no mechanical engineer but I don't pretend to know perfectly how an engine works. But I try anyway to understand it the best as I can...
Instead I see users that don't try to know at all our products... People (and not only elderly) which think that Facebook and Internet is the same thing, people that think that you can find anything one the net, while I found myself stuck many times in the middle of a research for something...
I had a course in human computer interaction... And I see the point of simplifying the user experience... But I fear that it will be soon to much :s3 -
Sorry not dev related
But feeling said, worried, angry and so disturbed after reading negative news about crime with girls everyday.16 -
Why the hell i find solution to every string problem with simple dictionary!
i m worried about my problem solving skills1 -
What's the real expectations for interns? Just to give it a good go, learn, and ask questions? Currently sitting at home sick af worried I'll look bad to my higher ups for not being there unannounced. Don't really have any way of contacting them.1
-
How do you train someone to be a programmer fast? (No not like a 'learn to code in a weekend' thing.) Books? Throw them in the deep end? Work with them side by side for a while?
We will be hiring a guy as a programmer. He is very tech/computer savvy, but literally 0 school or work experience programming. I've known him for a little while and honestly trust he'll try to learn but I feel with as little as he knows he is going to get overwhelmed fast. He is not technically under me but it's going to be my responsibility to train him.
I'm worried he's going to get completely overwhelmed and burn out quickly.15 -
Was so worried with all the whining about the windows fall update thinking my pc sucks so it will break for sure. But seems I have had it for a week now and not noticed.1
-
How many days an hour do you real professionals actually spending writing code... Right now between work as a junior front end dev, class and an applied project for school my brain is mush by the middle of the week and I spend my weekends trying to avoid opening my laptop, I hope I'm just overloaded right now and that I don't feel like this when I graduate.
Im getting a little worried though.2 -
I need professional advice. Or at least informed opinions.
I recently competed in a hackathon and won. My team wants to commercialize our idea. I'm worried that since we publicly displayed it, that the I.P. rights are a little "in the air". We NEVER verbally gave anyone the rights, and the rules of the hackathon don't even mention the words.
What would a legally savvy person do?3 -
I was called on a review meeting on why the task took so much time and why my performance is going down.
I clearly stated that I was not managed well and I had lot of dependencies in presence of my reporting manager. She didn't look happy. Now I'm kind of worried that she could act weirdly as women are also emotional beings taking everything to the heart.4 -
I love working at the new location.
My new colleagues are super chill and I'm within a 10 second walking distance to the coffee machine (one of these automates, where you just press a button and get a hot coffee within a minute, instead of having to start cooking a while before you actually need it)
But now I'm slightly worried, because my coffein-intake is skyrocketing because of this thing.2 -
I took leave without informing my manager. He called me and told you're not in college. He is pissed what do I do?5
-
has anyone tries sieera with mid 2012 editon? little worried the progress bar is nt moving and I am very desparate to meet sirj2
-
What's the best way to deal with constant dread? I deployed code after following every procedure, got every kind of thumbs up from QA and now it's my fault our 2012 admin site borked. Should I point out all the obvious flaws (again), or should I give up on our stagnant-ass developers and systems?
The fear of showing off anything new is crippling. I wrote up a Pyton API to hook into our current pipeline over lunch breaks but am worried if I even raise it as an option it'll just be cast aside and lost to time, regardless of business value. -
Are any of you worried/think that coding could become a blue collar job with just the sheer number of people from various fields trying to make it big in CS, and quality of coders going down day by day etc.?3
-
Best collegue is quitting. Boss man speaks with a tremble in his voice. Good. You should be worried.
-
Okay so I've been programming for around a few months learning python. I'm a slow learner so I try to stick with a learning schedule that suits me and i do got it, but I've come across a problem that keeps happening.
When will I know when to use certain functions like len(), range(), Or even modulas %. Because I forget they're there and im worried its going to effect me from being better.
Another problem while I have some of your attention is i dont know when to use math in my code really well but I've been getting better at that so I'm gonna practice a little bit for that.3 -
Midjourney 5. We should all be very worried.
This hedge fund manager doing grocery shopping in the evening does not exist.7 -
Hi everyone, I'm just a bit worried with my future status, I'm currently a Software Engineer here in my home country, I will be going to New Zealand sometime this March. I have a reason why I'm moving to NZ but do you think I can get a Software Engineer job there? I'm 20 and been exposed by my Australian experience (I'm not from Australia btw) from Angular and PHP. I've been trained by my Seniors top notch that they're letting me deploy to-live our largest websites.
Do you think I'll be able to find one or I'll be settling with convenience store related jobs there?
Thanks DevRant.2 -
Everyone in my family thinks I must be extra extra worried for matric results tomorrow.i don't feel that worried.i still gotta add features to my inventory app today.i have no time to worry.
-
Hello world! A short message because I know that many people here are worried about the future of GitHub, so there are some official links about it.
https://blog.github.com/2018-06-04-...
Message from Github's future CEO: https://natfriedman.github.io/hello...
Have a nice day! -
My friend said in front of manager 'look what this fool(manager) is speaking' to another friend.
Manager changes requirements on a daily basis and my friend lost his cool today.
Now I'm worried about getting implicated because he always comes to me for help.1 -
Am really worried about this major ( Computer science major ) in my country ( Lebanon ).
We have a very good potentials and very low salaries compared to it. And in case we apply abroad there is always an indian who have the same experience at least and most of them request a very low salary.
Trust me am really worried.2 -
Now is the time for me to start projects to get the hang of ASP.NET (Razor Pages then MVC), although it doesn’t seem like there’s a whole lot I need to worry about but I fucking feel like I’m messing it up already. I’m just worried about how I’m going to work up to sumn I would do at a job and remembering everything I have to do in the project and why12
-
I just one button away to buy this keychron k2 v4 keyboard. anyone using this keyboard? i need a little push
im only worried about if it doesn't support Linux. am using Ubuntu20.2 -
My current stress ball, should I be worried ??
Looks like I'mma need those 500 +1s to get my new stress ball, promise I'll treat it differently this time 😂😂 -
Anyone with experience with system 76? Need a new laptop soon and I am intrigued with their stuff. Used Linux for some time so not worried that, more about build quality etc.11
-
Err so i gave in and decided to set up my dev environment locally as opposed to cloud. Especially since I wanna do mobile stuff now.
But yeah. I had to revert to npm 4 for react native with sudo but now I literally can't npm install anything without sudo...
Should I be worried or carry on?7 -
When you finally realize, you like to be #worried, you miss, being worried all the time to get things done.
#hustling at #work. -
So I have hitman pro alert, malwarebytes, spybot anti Beacon and,shut up windows 10. Yet I feel so vulnerable using my pc, I know Linux is better, but it's a gaming/school rig. I'm also forced to use Google for school. I dunno what to do, maybe I'm just too worried. While just those stupid security nut things I guess. Lol.3
-
Looking for feedback on Elastic's SSPL license type change. Is anybody else worried? Any other companies seek legal counsel already? What have your lawyers said about it?5
-
i got this new bitch locked in. she's obsessed w me. said she was worried i would ghost her and never text her back after fucking her 2 days ago
Good.
now I'll be fucking both my blonde whore ex and this new girl for a long time and they won't even know it
i message them from different profiles on ig too6 -
!Help!
So I've been working on a side project, it's intended to be sold as commercial software. I'm honestly making it because I love it's purpose, buts it's commercial because I have costs I endured while building and to keep the service aspect of it running.
Anyone have insight into issues I might have building cross-platform software, distribution, and support of a commercial product? I'm more or less worried about the "clueless" folks who don't read FAQs.2 -
Damn i used to be sensitive to you people's criticisms now 100 years it feels later I'm more worried that people seem to expect me to shoot people or deal with undeserved hell and the theft of every memory of every thing I ever worked on and better understanding of what scum they are while they try to trigger me into ending their pathetic useless miserable lives in a way less horrifying than they deserve heh3
-
Is rkt worth using than docker. I do know the pros for rkt over docker, but on the long run which seems to be better. My manager is worried about the memory consumption. Docker is big obviously when compared. Am I wrong?1
-
I have an idea I need to get out of my head but am not sure where to start. I want to figure out a good way to learn about real-time water simulation. I’m looking at either OpenGL, or Openframeworks, or Cinder. I have basic experience with c++ and a bit less with OpenGL but am not worried about learning. Could someone point me in the right direction? Andy good resources to learn or just general advice would be greatly appreciated.4
-
I'm really worried about my future as a programmer. should i learn a new language? I already experienced in PHP and a little javascript and vuejs and recently i learned some golang for web and previously I do some java/kotlin for android app.
should i learn a new language such as python? node? or some new framework/library like react?
or i should stick with what i already know?5 -
It has come to my attention that an IRL acquaintance praised my constructive activity in social media, but the only substantial activity I've had for like a year was on DevRant.
I wonder if any of my friends other than Mayank are on here.
Not very worried though, I hardly ever say things about other devs that I couldn't own if they found out.2 -
Can anyone suggest good resources for revising OOP principles etc?
I’m doing a degree with the Open University, and I have an exam at the end of this module, but I’ve not had a proper exam since I left school nearly 20 years ago.
I’ve been getting on OK with the various assignments etc so far, and I have all my text books etc, but I’m worried that’s I’m going to crash and burn come exam time.2 -
Anyone use docker in production handling monies and hundreds accounts? In Django in my case but doesnt matter the framework. More concerned with security and stability moving from paas to docker based paas. Worried I'll move everything to docker and end up moving back to vms bc of some issues or some vulnerability.
-
So, it turns out I have hyper-mobility in my hands. The constant flexing of my wrists in positions it shouldn't be in has been why I've experienced pain while working.
I've been advised to wear splints to restrict the movement but I'm kinda worried. Got my first job coming up and don't want to turn up wearing these fucking things. -
My late 2015 iMac won’t get past the progress bar on the startup. I’ve tried every combo keypress/restart procedure I can dig up in multiple Google searches. Starting to get worried I’ll have to completely wipe and reinstall. Online Apple support is not helpful. Genius Bar in my area is not taking appointments still due to COVID. And money is always too tight to buy anything other than another used Mac. Anyone got a surefire way to get back to a login screen? At least to ensure my backup is up-to-date before I wipe it and start over?6
-
My email account started sending malicious links to my 6 year old addressbook.
Only noticed it because most of the email adresses in it do not exist anymore. Now I am fucking worried about my semsitive data in my mail account. Wtf... -
So my TV tuner outputs the videos as 1-20GB TS files... To my secondary 1TB HDD...
But that's my main storage drive too. And well I'm recording every week and maybe transcribing some to keep.
Also seems for Plex, need to transcribe to mp4 beforehand.
So now I'm worried about drive failure, seems most DVR drives last around 2-4yrs... depending on use...
Wondering if I need an external USB "throwaway drive" or another internal, not sure whether there's an empty slot, need to check -
How do I prepare for a tech interview at top companies one year from now?
I'll be pursuing master's in CS from this august and want to prepare myself accordingly. I have a decent understanding of algorithms and data structure. Although I can solve problems at my work easily, I am still worried about my inability to solve medium - difficult hacker rank problems. -
When a team manager appreciates the team for managing multiple conflicting priorities & working long hours in an allegedly agile environment, am more worried about why those things were needed in the first place
Mismanagement ? -
Has anyone moved into A.I. programming from a decently long web dev career. Or maybe you work in AI and you have 2c.
Worried about what comes next. So, I've decided to pivot hard into core math and comp sci like linear, calc, probability, dsa.
Worth it? Naive? I was a calculus tutor way back.5 -
Any fellow Symfony programmers here? How's the upgrade from 2.x to 3.x going?
I'm worried about some bundles breaking tbh2 -
Has anyone ever accepted an offer of employment and then changed their mind and "cancelled it" in the UK?
I have an offer starting 6 months from now and I am worried I might get another better offer in the mean time but I'll be bound to this one since I accepted it...
Any advice would be helpful. Thanks.4 -
Everyone and their dog is asking for advice on dR so let me share what's currently on my mind…
Many people probably think it's a blast from the past but I want to install fvwm on Linux (or FreeBSD) and see if it's up to scratch for use as a daily driver, and if so, how much configuration it requires until it gets there. There are a couple projects such as https://github.com/dustincys/hifvwm and https://www.box-look.org/p/1018275 that make it look worthwhile.
I'm predominantly worried whether it would work correctly with a multi-monitor setup (including dynamically adapting to plugging and unplugging monitors). Does anyone have any recent experience with fvwm? -
80% of people who comment online are small people. 100% of small people who read the previous sentence thought they belonged to the remaining 20%.
It's not who likes you, it's who hates you. If small people like me, I should be worried. If small people hate me, that means I'm not one of them, and I'm doing good.
The above is true for every online community at any moment in time.6 -
Help!
Anyone familiar with the culture/environment over at NCR?
I have a job offer from them but am a little worried because I have worked mainly in smaller startups my whole career.
Am I going to end up wanting to kill myself after 6 months if I take this job? -
Do you recommend hiring junior or mid-level dev for a python role that involves mostly data transformations with pandas, growth and marketing projects like social media bots, consuming APIs for data and some experience with Azure SQL db? I’m worried if we hire too senior then they will leave as the role doesn’t involve any advanced software engineering, like caches, web apps, rest apis, etc. It’s more of a handyman that can automate and hack a solution to a business problem: for example, learning openCV to automatically crop thousands of images extracting only the text3
-
!rant
'Ol Rowsdower's got some of the major players interested. Deep down, I know that I know my sh--, but I'm worried that I'll get a bad case of impostor syndrome. Anyone have some words of advice?1 -
I’m worried, as I’m sure many of you are about covid 19 and work drying up. I can work from home but who’s gonna want to get a new site or app done now with so much uncertainty!1
-
Had an internship interview earlier this morning, it's a newer company just getting started says they don't have any technical aspects or employees yet so any programming interns would build the tech side up from scratch. They pay would start at $15 an hour with a guaranteed job at the end. Location is easier to get to than school.
I got an offer 20 minutes ago, I like the opportunity but I'm worried about them having college interns build the initial tech setup and work flow without supervision of a more experienced IT person2