well that explains it...
all i had to do was break them up and now its up and running

Oh my god... Storytime.

A customer comes in with I assume is his father or grandfather.

Customer: I need a computer, but without all the internals

Me: So a case?

Customer: Yes, I need a Dell computer outsides, but without the internal components.

Me: Well, we don't have Dell cases, but we sell custom build cases and they come with a power supply.

Customer: *says nothing, but looks interested*

Me: *walks over to the cases to show him* So this is what the cases look like and we have two types, one for a ATX and one for a micro-ATX.

Customer: *still says nothing, but looks at them*

Me: What motherboard do you have at the moment?

Customer: Well, I don't have anything right now, but I'm replacing another computer that didn't work very well. I'm going to be getting some Dell parts to put in here.

Me: O-okay. So this other computer, I'd like to see it in shop to see what's going on with it.

Customer: Oh, you do NOT want to do that. I hooked it up to another computer and it blew it up.

Me: Huh, that's weird. I'd still like to look at it if possible.

Customer: Oh no, it's all wired wrong and... *some bullshit, but stay with me*

Customer: I am the best at technology. My hand has computer parts in it--government funded. *some more bullshit*

Me: Okay... *I try to bring it back around* Well, I'd still like to see the other computer for myself. So you don't have parts for this new build yet, right? You don't know what type of motherboard you have?

Customer: No.

Me: Well, I would get the internals first, so you know what size of case to get, and then get the case.

Customer: Okay. Thank you for your time.

He shook my hand with his "cyborg" hand and I was tempted to say something about "try not to crush my hand," but elected not to. Also during this entire exchange, the old man continuously farted in the background.

So... A random morning moment:
(c - Cient, m - me)

C: Help!!! Our users are complaining that our website is not working as intended!!! This is crucial!!!!
M: What's the problem? What is not working?
C: EVERYTHING!!!! FIX IT!!!!
M: Could you be more specific...?
C: Look at the bugsnag - it has all the errrors!!!
M: *looks there - no errors* - But... It has no errors...
C: Okay, so client told me he's using Galaxy SII - does that ring a bell?
M: *thinks that I'm fucked* - Asks, which browser?
C: Why do you need it? It's a browser after all...
M: Yeah but not all browsers are the same and I need type and version to investigate...
C: It's Samsung default browser... Last updated 2012 January.
M: Well, tell that user to update the browser, the site is working fine on newer versions...
C: No, you update it.
M: Browser?!
C: Yes, what else?!
M: Of course, I'll fly 3000 kilometres to press UPDATE button on clients phone...
C: Well, he's not doing it himself - he's afraid!
M: Well, that is his problem. Site is working fine for other users with newer browsers.
C: But... He's a client
M: I get it but he's a client that uses 6 years old browser and tries to visit our website. Don't you remember that we ditched IE support on your behalf for the same reason?!
C: Oh... I see... Can you make something that it works with 2005 browsers?
M: Of course... *evil laugh starts* I'll make the website work on EVERY single device EVER - make it plain text.
C: Are you joking?
M: Are you?

----

And since then, we ditched the actual need for supporting users with old browsers that don't update to modern standards... Feels great!

Conversation today...

Guy: "Hey I need a real quick script to pull some values out of an XML document...is that possible?"

Me: "Uh...yeah that's pretty simple if that's all it has to do."

Guy: "Ok excellent I'll send you some files and documentation."

Me: "Ok so is this like a one time use thing or do you need to parse multiple of these?"

Guy: "Actually it needs to run all the time, on this specific PC, watch directories for any files that are added, then generate a XLSX files of the values, and also log information to a database. Etc"

Me: "Oh that adds quite a bit of complexity from what you originally said. It's going to take more time."

Guy: "But you said it was easy."

Well fuck you...

Recently had an interview with a company. At some point an SELinux question came up and while I didn't provide the best answer ever (I'm hardly familiar with SELinux and mentioned that as well beforehand so they knew), it was technically correct and the reaction of the interviewers was funny.

TI (technical interviewer): say your php script isn't executed and after a while you find out that SELinux is blocking php script execution, how can you fix that?
Me: setenforce 0...? (essentially disabling SELinux at all)
TI: disabling it entirely for getting php execution to work?! That doesn't sound like a good solu...
HRI (HR (non technical) interviewer, also present): *turns to TI* - but, would it solve the problem?
TI: 😐 well, yes, but... That's a bad thing to do so I wouldn't count is corre..
HRI: *still aiming towards TI* but you simply asked him for a way to solve the php execution issue, would his answer work? Regardless of whether it's the best or worst solution, would it be a solution which works?
TI: well... yes...
HRI: then he answered correctly I'd say, next!

(yes, I'm aware that my answer wasn't good as for security at all but it would have solved that problem which is what was asked)

Prospective client: “I have a website through which I sell music, both physical copies and downloads, but am having all kinds of issues with it”.

Me: “Like what? Tell me more.”

Client: “Go to www... I’ll go through them with you”.

So I go, and client proceeds to rattle off a list of totally random shit for the next 26 and a half minutes without even stopping for breath, telling me what he’d prefer, talking through how easy other “similar” websites are and comparing his own website to them, as well as all the things that flat out just don’t work. He ended with the line “I just paid my developer who told me it was all good, but now he’s telling me he’s too busy to work on it”.

Meanwhile I’ve had a gander at “view source” and can see it’s been “built” with Wordpress, and with a fuck ton of plugins and shit to boot... you can only imagine the sense of euphoria I’m feeling at this point.

Me: “Did you have a contract with your developer?”

Client: “Nah”.

Me: “Do you have a budget in mind, either for just making right or for ongoing development?”

Client: “Yes, but minimal”.

Me: “So what do you want from me?”

Client: “I want to know how much it’s going to cost to fix!!!!” (apparently irritated by my question).

Me: “Oooook... Is there any way I can have access to your website to investigate, or clone it so I can recreate what’s going on?”

Client: “Yes” (gives me details of how to log in to his hosting, and WP admin).

Turns out, he had over 50 active plugins for literally EVERY. SINGLE. FUCKING. PIECE of functionality on his website. Furthermore, it was pretty clear that some plugin functionality overlapped, because... well, if you don’t know how to do something, install a plugin or seven to get it done, right?

Me: “So can I ask, what exactly is your budget? Just to give me ballpark as to how best move forward?”

Client: After going into how he’s already spent a lot of money on it already, “If we could we agree on below £200?”

Me: “...what, a month?”

Client: “No! In total. To make it right. Once it’s done it’s done, surely?!?!”

*a long silence*

Client: “So... what do you think?”

Me: “Burn it. Burn it all down”.

//Long rant

[Boss man]: Hey, we need you to build us a web app.

[Me]: Okay, what do you need it to do?

[Boss man]: We need staff to be able to login from anywhere, create new appointments, check room availability, display live times for the rooms, schedule future appointments, record all the data as stats and export the stats to (email address).

[Me]: Okay, sounds useful, anything else?

[Boss man]: we also need it to send all relevant data to a calendar where certain staff will be notified by email of events.

[Me]: Okay... I'll get right on starting this.

[Boss man]: So you can have it done by the end of the day? (4 hours from this time)

[Me]: *Internal screaming* *WHAT THE FUCK* Uhm, no, I don't think that is possible to complete in a four hour period by myself.

[Boss man]: Okay, well by tomorrow then, I'm leaving for the day though, have a good one.

[Me]....

//End long rant

So today this Mother F**ker get HR to back him up to accuse me of not communicating well in the team because I consistently asked him (the code owner) why he kept coding not following the coding guideline.

How is it not communicating? He literally ghosted me and blocked me every time I ask him questions. Which I somewhat don't understand what he is trying to do. HR lady told me that a senior software engineer should have the knowledge to understand everything and all the code.

But the code looks like this :

Going on a vacation, so notify all clients that I won't be available during two weeks.

Client: well we have this huge presentation and here's a list of stuff we absolutely need for it
Me: sure I have a look.
Me: holy shit dude! That's gona take about 2-3 days. I'm leaving soon!
Client: it's realy critical to have them in a week as it's a very important presentation! Is there any way you can make it work? If we can do anything to help, just name it.
Me: well I'll do my best (planed 1 day for such rhings)
Me: *pulling a 15h day*
Me: here, all done budy! Did a 15h but now it's done, so do that presentation!
Client: oh, nice, but it wasn't that urgent
Me: ...

Next day:
Client ssh in to the server, fucks shit up
Client: well I did a thing and now stage and prod is fucked, can you do anything?
Me: (knowing it will take 30min to fix) well... I try my best. Btw. I'll leave in a few hours and won't take my computer, so try not to fuck every thing again, okay?

Working with a radio chip we selected because it had built-in encryption. Cannot make the encryption work, thus in contact with the manufacturer:
"- I cannot make the encryption work, it's like the chip doesn't want to take a key.
- which key do you use?
- does it matter?
- well yes, you can't just use any key!
- why not?
- you need to get an approved key from us.
- why is that?
- so that your competitors can't read your data!
- ...
- ...
- so the way to get working keys is to get them from you?
- of course!
- keys are 256 bits. Can we potentially use all of them?
- OF COURSE NOT!
- how many can we get from you?
- one! We reserve it from your company.
- are you telling me that all units within a company will need to have the exact same encryption key?
- yes!
- so anyone with our product could eavesdrop another same product?
- well yes, but it's all within your own products.
- ...
- ...
- that's not how encryption is supposed to work.
- but it's safe, your competitors cannot eavesdrop!
- I'm out of here."
(We finally found a satisfactory work-around, but i am still pissed at them)

Apple has a real problem.

Their hardware has always been overpriced, but at least before it had defenders pointing out that it was at least capable and well made.

I know, I used to be one of them.

Past tense.

They have jumped the shark.

They now make pretentious hipster crap that is massively overpriced and doesn't have the basic features (like hardware ports) to enable you to do your job.

I mean, who needs an ESC key? What is wrong with learning to type CTRL-[ instead? Muscle memory? What's that?

They have gone from "It just works" to "It just doesn't work" in no time at all.

And it is Developers who are most pissed off. A tiny demographic who won't be visible on the financial bottom line until their newly absent software suddenly makes itself known two, three years down the line.

By which time it is too late to do anything.

But hey! Look how thin (and thermally throttled) my new laptop is!

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

Dev: I’m taking a vacation next week

Manager: Good you need a break! I’ve put together a list of tickets for you to action during vacation since you’ll mostly be free during that time

Dev: Do you know what vacation means?

Manager: Well I work during *my* vacation

Dev: You write non-answers to emails and interrupt devs with status questions that are easily answered by a single glance at the kanban board. Also, you’ve just assigned a month’s worth of storyboard points to me on my week long vacation. We’d get more work done if you didn’t “work” during your vacation.

Manager: Well it all needs to get done! It’s the only way we can catch up and get ahead of schedule.

Dev: Why do you exist again?

Just got this little stinker added to my board this morning….

Ticket Title: Weird shit going on in app

Ticket Description: (blank)

Attachment: <Screenshot of app logo>

Manager: Well what do you think is causing it?

Dev: Causing what?? This ticket doesn’t describe anything at all

Manager: Well it’s a bunch of different things! The ticket is just a high level summary. Now how long do you think it’ll take to fix?

Dev: …

Had this yesterday on my way back home from the meeting. Bumped into an old study friend who was never fond of Linux even for servers.

"so what do you use at your company?"
"oh uhm yeah uhm right.... Ehh yes ehhhh so uhm like we use like uhm Linux for the servers"
"ah, and? Works well?"
"uhm well uhm yeah ehh yeah works uhm pretty..... Pretty ehhhhhh good 😅. It appears to eh work.... Like uhm very good for servers after all..."

Hearing that coming out of his mouth....

Damn!

Dev manager: great news guys. We’ve built a new tool to do automated testing on apps. We’ve gotten rid of the old Appium solution we were using and built this new one.

Me: why not just use the inbuilt native stuff? Click to record works really well.

Manager: nah we thought it would be more flexible to build it ourself.

Me: ... ok ... moving on ... how does it work?

Manager: well this new .jar, you download it, pass in a config file, setup up your simulator and appium and the jar will do everything for you.

Me: ... wait you said you hate Appium? Now you’ve built a wrapper around it? And it doesn’t even set everything up, you’ve to do it all by hand?

Manager: oh we had too, would be too much effort to replace it. Don’t worry we can now write all our tests in .yaml config files instead of using Appium.

Me: so we’ve lost the ability of auto-complete and type ahead, everyone has to upskill on a new tool, it offers no new features over what’s available out of the box and we’ll have to deal with new bugs and maintenance and stuff our self ... because we need more flexibility?

Manager: oh don’t worry. The guy who built it is staying here. He’s going to deal with bug fixes and add features. He’s only one guy, but he’s really sharp, it’ll be great for us and the team.

Me: ... ... ...

*audible noise of soul breaking*

Me: ... ok thank you. I’ll look into this new tool

Client: "I need you to implement a feature which does x"
Me: "We can it do like this, I can do it in Y hours."
Client: "Perfect do it"

Me: "Here you go have a look and if you give your ok I'll implement it on production."
Client:"That is not what I need. I need Z"
Me: "Well then you should have said Z and not x. But I can do Z if you want me to."
Client:"Do it it is urgent!!!!111"

Me: "All done here you go."
Client: "That works like what I said what I need, but I meant more like xZ."
Me: "Ok, you know I have to charge you for all this, do you?"
Client: "What why? It isn't the feature I wanted!!11 Do it right and I'll pay you for the right one!"

Me: "It might not be what you wanted but it is exactly what you specified to me. I'll send you the bill and will not continue working for you. Good luck finding someone who is willing to do unpaid work for you."

I am so done with that kind of client.

If the below is you, please stop. I'm starting a revolution called #AnswerTheQuestion

A: Hey, just checked your code, you have a huge security issue in XYZ, you should really address that.

B: Oh god I had no idea, how do I fix it?

A: Well it depends on how you *want* to fix it, no one solution is always the right one.

B: ... Ok, well could you give me some advice?

A: Well, there are many ways to approach this kind of work, but all I can say is that this way, is definitely not the correct one.

B: ... Ok, well how would you do it?

A: That would depend on the customer requirements.

B: ... the requirements is to have a website that isn't easily hackable, what do I do?

A: Nowadays, its pretty hard to make a website completely not hackable.

B: ALL THE SERVERS ARE SHOWING RED, PLEASE HELP ME!!!

A: ........ you really shouldn't prejudge colours. The colour red doesn't always mean danger, depends purely on the use case.

Employer: so why do you want to join this organization?

Engineer: well like i said in the first 4 interviews, I love desks. Sitting behind them. Standing behind them.

Employer: are you a standing or sitting man?

Engineer: i like to sit in the morning and then switch up to stand at lunch.

Employer: a man with a plan. Very good. Do you remember anything from school?

Engineer: not a goddamn thing.

Employer: perfect. You don't need math. Just emails. You like emails?

Engineer: love emails.

Employer: there's gonna be a lot of emails.

Engineer: can't get enough emails.

Employer: perfect. Do you like a clear separation between life and work?

Engineer: oh not at all. I like it to muddy together in a never ending hell.

Employer: alright and you're familiar with work culture?

Engineer: oh those hours i work for free?

Employer: yes.

Engineer: I love that bullshit.

Employer: alright terrific. And are you familiar with the hate hierarchy?

Engineer: yeah the tech's hate the engineers, the engineers hate the tech's and the managers hate everyb-

Employer: everybody. Perfect. Alright I- honestly I think we'd like to make an offer.

Engineer: well, first I gotta leverage that with my current employer for a raise. And if they don't budge, I'll jump shut.

Employer: no loyalty at all?

Engineer: not at all.

Employer: you're hired.

Just discovered that one of my coworkers(well...my boss really) has the uncanny ability to detect fonts and sizes with extreme accuracy.

For some of you that may be not impressive at all and some can probably do it too. But its like...not only on websites man...she can do it on things that we see printed, menus and stuff.

That to me at least is very impressive.

Had a fun little conversation with a potential employer...

Him: We use git for version control. To work with our team you'll be expected to do the same and be proficient at it.

Me: Not a problem. I am well versed with all things git! May I ask, what does your work flow look like?

Him: All of our source lives in a single repo and everyone commits straight to master.

Me: 😐...

Him: Conflicts will not be tolerated.

Oh well. Let's see what the hype is all about.. devRant made me do it. 😂

I have had this conversation well too often:

- (him/her) Do you mind helping me with this problem I have on my computer ?
- (me) Sure, what is it ?
- (him/her) *proceeds to explaining the problem*
- (me) Ok, I don't know about this particular thing, you should try googling it.
- (the pissed off version of him/her) Never mind, I'll find someone who's willing to help me.

Please stop taking that as me not caring about your problem.
Googling things is basically what I do all day as a developer.
You really should try it. That thing is actually pretty useful.

Dev: Hey that internal audit you asked me to perform didn’t go so well

Manager: It has too! I’ll get in a lot of trouble if it doesn’t pass.

Dev: Ok well it’s a lot of work to get it to a passing state, we have to dedicate a lot of resources to fix all these findings.

Manager: We don’t have any spare resources, they are all working on new projects! Why did you have to find things??

Dev: ….It’s a lot of hard to miss stuff, like missing signatures on security clearance forms

Manager: Ok can’t you just say that everything is all good? They’ll probably not double check.

Dev: I’m not really comfortable with that…Look all of these findings are all just from one member of the team consistently not doing their job, can’t you just address that with him and I can make a note on the audit that issues were found but corrective action was made? That’s the whole point of audits.

Manager: You don’t get it, if anything is found on the audit I’ll look bad. We have to cover this up. Plus that’s a really good friend of mine! I can’t do that to him. Ok you know what? You are obviously not the right person for this task, I’ll get someone else to do it. Go back to your regular work, I’m never assigning you audits again.

Apparently, part of being a software engineer means knowing how to read minds and do other people's jobs.

While implementing a user story for marketing, we found some associated features that, according to the database, have not been used for years. We tell them this. We do the courtesy of asking, "Hey, is there anything on the site that is utilizing these features? We'd like to clean up the DB."

"We don't know."

Engineering suggests, "Ok, lets turn the feature off, then, and see if anyone complains. It's been years according to the DB."

Marketing gets angry and hostile and says, "That's not the way to do things!"

I don't vocalize, "Well, not knowing how to do your own damned job is not the way to do things."
-
Marketing asks us to integrate a third party feature to the site. We ask, "Ok, what page do you want it on, and what information do you want to collect, and what should it look like?"

"I don't know. You're engineering. You tell us."

We implement it as best we can.

Marketing says, "HEY! This isn't done right! It's missing this and this and this!"

"Did you ask us to implement that? According to the user story, it passes acceptance criteria."

Marketing says, "I thought you would just know that! I didn't know it was a separate thing. Just put it on all the pages, then. You guys really should know the site better."

Engineering gets angry and hostile
-
Marketing says, "We need this removed from the site."

Engineering replies, "We have a GUI for that. Just go to this URL and you can do it yourself."

Marketing replies, "Well, if that's a really complicated thing, can you just run a script against the DB?"

Engineering says, "If we've built a UI for you, we really shouldn't be executing SQL scripts directly against the DB."

Marketing gets angry and hostile.
-
Engineering tries asking nicely.

"Marketing, if you want us to add new stuff to the site, or change stuff, please tell us what it is and where it should go and what the customer experience should be like."

Marketing replies, "We don't know the site that well. We are leaning on you to tell us."

I do not vocalize, all while trying to keep my eyes from bulging out of my head, my face red with rage, "YOU ARE IN CHARGE OF SELLING SHIT ON A WEBSITE THAT YOU KNOW NOTHING ABOUT. YOU ARE ASKING FOR CHANGES TO SOMETHING YOU DON'T EVEN UNDERSTAND. WHAT IS WRONG WITH THIS PICTURE?"

Engineering is angry and hostile.

Today @ 4pm:

New dev: I need help with this issue, i've been stuck on it all day.

Me: ok let's look ...... ok, and did you try google this?

New dev: ... no

Me: ... why?

New dev: well this is clearly my issue, why would I google it? I only google for things I don't know

Me: ... ok ... we'll do you know what this bug is then?

New dev: haha ok, fair point, I'll give that a try. Thanks for the tip.

Seriously, should I be worried? I feel worried

*project manager + designer are showing new designs*

PM: so, can we get some estimates?

Devs (literally all of us): do we have a mockup for this interaction?

Designer: no.

Devs: What about that one?

Designer: not yet.

Devs: What happens when you click here? Hover there? How does this look if I select that option + this option at the same time? Does it make sense that a user can select *this* option with *that* option? They're kind of mutually exclusive.

PM: Well...

BTW: code freeze is in two weeks...

Winter break is next week and I don't know what to do...

I have an exciting programming project I want to work on!

Buuuut, I also have this 1,500 page book I want to read!

Buuuuuuut, my manuscript still needs some work! I want to work on it as well.

If I do all three, I won't get to finish anything, so only one task during break.

Three of my favorite things... Why must choices be so difficult?

Also, the picture is the 1K page book I bought. :) It's beautiful!

This is my first post. Had an exam in php, xampp wasnt working, assistant came and said i dont know to configure codeigniter, after 30mins of calling he came, tried and sad "well this isn't working". He then called administrator to reinstall xampp. I lost more than half of exam time. I didnt finish it in time, he said that i could do it in a less time by his opinion. It was full working php site with crud and customer view. When xampp started working i had 1h to do it all. After some time and arguing i got a a new date to do it. It is tommorow. Help me god hahhah.

*makes course outline*
Management: Um yeah make the outline similar to this course from earlier
Me: Hmm, so Yocto etc.. well that'll require a good amount of research because I've got no idea what Yocto is or how I'm supposed to use it.
*researches about Yocto, prepares build VM and Raspberry Pi target, thinks of how on Earth I'd make my coworker without Raspberry Pi interface with it from across the world*

2 days later..

Management: Yeah actually we don't want Yocto. Just do simple stuff like application development, GPIO etc.
Me & co-worker: Awesome mate! That'll make things a lot easier. Except for the 2 days of lost work, but we can live with that if it's just GPIO and such.

3 days later..

Management: guys your course outline sucks. Do it all over again, we want Yocto to be in it after all.

YOU MOTHERFUCKERS!!! Why don't you behave a little bit less like a fucking client that doesn't know what they want for once?!!

"Can you do this?"
Sure, give me the information I need...

"We don't have all of it yet"
So I can't do it then

"Well when can you do it"
When you get the information

"Do you need *all* of it"
Well, it's either I do half a job and waste my time, or get it all done in one shot

"The client wants it tomorrow"
When will we have the information?
"We don't know"
Well they aren't having it tomorrow then, are they...

Sales people... don't care *how* things work, as long as they get a tick against their name to show they've sold something...

Fuck you StackOverflow! Why do you ban people who have a positive score? Shit, I'm raging right now. I have a positive fucking score! It is not because I asked a few questions that were not well received by your fucking elitist overrated frustrated community that I should be banned!
And fuck off I'm not a native english speaker, it is OBVIOUS that I won't be able to make perfect sentence in all contexts.

FUCK FUCK FUCK FUCK

You either die a "tempfile" or live long enough to see yourself become a "asdf"

My boss gave me a project without any meaningful requirements and asked:
boss: can you finish this in 9 months?
me: well I really can't give you any estimate.
boss: well just do it.
8 months later I summarize all weekly requirements that the client has given and estimated I should be able to finish the project with just 3 months, if only the requirements are ready and not changing from time to time. What a f***ing waste of my time? Why the f*** people do this? And after all this my boss said:
boss: I think we should be able to finish this project faster.
YOU THINK!

Okay so even at my advance 52 years of age, I still pull all nighters to handle emergency remediation projects, and clean up other peoples messes. I don't mind, I'm a geek, I get high on the challenge of fixing shit that is broken all to hell.

But tonight was different. Tonight has me raging.

I am tasked with renovating a website, and building a sister site to that main site as well. no bother, I haven't done any web dev in 15 years but I'll power through pulling 18 to 20 hours a day for a couple of weeks to get in the groove...

Little did I know... CSS is a pain in the ass to be sure, but FLEXBOX is total and complete bullshit.

I don't give to shits about all the fancy shit it can do, it can't do simple shit worth a damn. Fuck Flexbox, and anyone involved in producing that useless layout model.

The sheer number of idiots promoting that hunk of shit a solution that is to be applied to any task other than wiping my ass is astounding.

Fuck all you jerk offs out there posting your shitty mark up turds as if they are gold, when you know better than anyone it works, sometimes, then doesn't, and is so easy to break it may as well be called "Web Design Jenga".

I'm still tired as hell, and tomorrow I will go back to slogging through CSS as the layout method, but at least I feel a little better now.

Oh and before I forget FUCK YOU FLEXBOX you piece of shit.

Second day on the job, only one with no real degree in software development (did much stuff in free time, just finished school, got the job mainly because i knew people there)
So you can imagine that they were sceptic about me.

Chief executive whatever told me there is a problem with some JavaScript they can't fix cus there is no time and shit for that.
I was like ALL IN and said i could do this in a few mins.

Fixed it in 20 mins. Everyone was cheering. I was like "Well it was the right decision to not do my homework back in the days.." 😁

Boss: We need health data for this iOS app.

Me: Cool, so we'll use apples HealthKit.

Boss: No that requires the user agrees to it.

Me: ... well yeah ... its private data.

Boss: No we need it to work regardless. If the user says no to HealthKit, just give them textfields for all the metrics HealthKit has and they can enter manually.

Me: .... but ... eh ....

Boss: and we'll partner with some companies and support their devices.

Me: ... see, the thing is ...

Boss: We also need to store it locally and then sync it to the cloud app. What do you think?

Me: ... ... ... no

Tech support: we need to install backup software on your laptops.
Devs: what for?
TS: to backup all your important files, like word docs, excels, etc.
Devs: we don't use those. everything is on git/confluence/etc
TS: my boss told me to install it everywhere, so I have to do it.
Devs: well just disable it. uses too much tam, disk time and such
TS: whatever.

So he installed it on each laptop separately, took half a day, then we just disabled it and proceeded with our tasks. Now we get a question every other week why nothing is being synced from our computers. "We paid for the system and we want you to use it".
yeah..

Trying to setup server monitoring for one server (will deploy it on all my servers once this works well).

Getting these email notifs to work is a bitch 😅

(can't do pushover etc since those require GCM and I've got Google blocked out of my phone)

Me vs a government employee in India...
Me: You should have setup net banking on your website. I had to travel 20 miles to get to your office to make a payment.
Employee: Sir, we do have net banking enabled.
Me: I searched all over your website but couldn't find it.
Employee: Oh! Well, I guess it stopped working since it rained yesterday.

Weekend projects are fun! Although front end is still a challenge, it looks good enough.

Suddenly got the idea to do something with letsencrypt/nginx wildcard subdomains (*.example.com) so created a project around that now through which you can check what your ip address/user agent/operating system/ip version is (maybe more to come) but due to the wildcard part you can enter quite a number of subdomains which all show the related info.

I'd find it very useful myself, not sure if other people would but oh well!

Funny how it's the conversation when I give my 2 weeks notice that all this comes up, like:

1) how they were "talking about giving me a raise"
2) how they were "hiring more people" so I could spend more time coding and less time doing bullshit
3) how they were going to fix all the other broken things in the company

How do you think it would fly if instead they fired me and I promised to fix everything that's wrong about my working there after the fact?

Anyway, I knew they would pull this bullshit so it was expected. Excited that I signed the new offer today. Finally getting market rate pay and expecting better work environment as well. 🐶

Hello "friend", whom I haven't seen or talked to in years. How have you been? Please don't mind me, my life is boring as shit and nothing happened to me since. Yes, I'd gladly make an app for your company because you agreed to do it but apparently you lack the skills. Oh, you've been fucking around for a month doing nothing? That's sad but sure, I can do it by Sunday, I don't have plans for the weekend anyway. You say you can't pay me more than what I earn in six hours doing my day job? And your boss should think you did it all by yourself? Well, let me consider this cool little opportunity. I'll be in touch, talk to you "soon"!

It's only day one of the year and I'm already pissed right off

Why the fuck do all clients expect you to come up with absolutely everything!?

All I ever get is we want a website. I ask well what do you want on it.. our products .. news? Contact maybe ... Urm our business information ... That kind of stuff.

Well what are they?

Pft.. I here is a name if our products. And other stuff

WE ARE SELLING IT WAT ARE THE PRICES AND INFORMATION DO YOU HAVE IMAGES

Yeah do you want them

Of course I do 😐

Great here's 2 of them we have 1100 so I'll get more to you soon.

😤 Thank you!

Holy shit it's always like talking to a fucking brick wall.. why do people have to make our jobs so hard it's already fucking tough

I have no time to plan your entire website by myself I don't know what you want on it. How could I possibly know that!? It's your fucking site

My friend who is new to Android App Dev was trying to make a simple app that programmatically takes a pic then sends it as an MMS. He opened Stack Overflow, copied code and i heard him murmur "hmm this is simple". Knowing the future, and the wrath of Android Studio, i leaned into my seat and waited. 2 hours later i knew Andy Studio had pissed all over him and it was written all over his face. I walked past him as if to go to the toilet then back again, his screen was blood red with errors and my heart danced and sang.

3 hours later i was out of the room and he sent me a text saying "I give up". I replied, "well tbh, im suprised it took you that long"

Thank you Android Studio for showing all those who think all we do is copy and paste code that they are freakin retards.

PM: Can we have it so the usernames are case-sensitive?

Me: uhh, sure I guess.. But thats like really pointless and adds no real usefulness.. In fact makes the whole logging in thing a tad more complicated for no reason..

PM: Well this one other product we have uses "Admin" for the login versus yours that used "admin" so it needs to be implemented.

(note that mine accepted "Admin" anyways...) *implemented it*

PM: So there's a problem with the username sort, it sorts by capitals then lowercase.. eg:
alpha
beta
Alpha

Me: Yeah, you asked for case-sensitive usernames..

PM: Well can you fix it?

Me: I could create a second field within the user data that is the username in all lowercase and sort by that. But that negates like all of the whole case-sensitive usernames thing.. OR I could drop all this actually important work I'm doing and do a whole bunch of work on a custom sort for this useless fucking feature you wanted me to put in..

*it's been 2 weeks and still no reply...*

Tl;Dr: Client-side validated online test

Some stupid questions in an online test.
Not all of them were coding questions, but all (yes ALL) were client-side validated and to solve the tasks all I had to do was to copy one array into another and set the time I needed for that task to a legit number.

Well at least it was an online test that doesn't required 3hours.

Mid-Friday: Boss: Start programming this application.
Me: Cool, how will it be setup? what lang-
Boss: Everything's already setup, just start programming in PHP. Check in and make sure it's done by Wednesday morning before 9.
Mid-Tuesday:
Me: Cool, it's done. Had some trouble with connecting our database to the clients, some permissions were conflicting.
Boss: Now I need you to pull it, publish it to our other azure portal, change it to ASP.NET Core 2.1 MVC and install it to teams. Also change the database to MySQL.
Me: I thought everything was already setup.
Boss: things change.
Me: Cool.
*Pulls an all nighter*
Me: Something isn't right...
Wednesday
Me*hasn't slept yet*: It's done.
Boss: Why do you look so tired?
Me: I was working last night
Boss: Well you shouldn't do that.
Me: The deadline is today. only way it was going to get done before 9 was to do it last night.
Boss: Doesn't matter.
9am Meeting:
Boss: it was easy, no hassle, it's up and running.
Me: no hassle?

Typical conversation between my parents and me

Parents: Can you make stuff?

Me: Make what?

Parents: The thing you do all the time.

Me: "Computer stuff"?

Parents. Yah...

Me: Well, yes, why?

Parents: What can you do?

Me: Well, I know C# the most...

Parents: Can you then make software like Facebook, Twitter, etc?

Me: Well, I can, but that will take a lot of time.

Parents: You should really make something and make money.

Me: Ok. (goes into my room, and turns on laptop)

(a few monents later....)

--[[CHORUS START]]--

Parents: U DOIN COMPUTER???

Me: Uh-huh.

Parents: When did I said to do "Computer stuff"?

Me: Well, you said to rest.

Parents: But I never said to do your "Computer stuff"!

Me: But you said to rest. For an hour!

Parents: WHY U SHOUT AT ME!!!! TURN OFF THAT **** NOW!

Me: Ok.... (turns off and opens C# book immediately)

Parents: What's that?

Me: C# book

Parents: What's C#?

Me: Programming language.

Parents: Where can you use it?

Me: Make stuff.

Parents: Like what?

Me: (lists my personal projects)

Parents: Show me.

Me: (turns on the computer and shows one of it)

Parents: Good. (leaves)

--[[CHORUS END]]--

Me: (deep breath) Can I FINALLY use the computer?

--[[CHOURS]]--

I saw a quote maybe 2 weeks after I signed up in this Heaven, I can't (read "I'm too lazy to") find the quote but some guy was lowkey panicking about the fact that all his friends were "currently building X, almost finishing to dev Y", while all he ever did was a small project like "yeeey, I can do something with my 10 fingers"

This rant was interesting, but the top comment kind of marked me, if I remember well, it said something like "All I read is 'doing' and 'almost finished', while you 'did'. I would trust you over these guys".

From this day, while I worked on two side projects, there was always a moment where I thought about this sentence.

Today, I finished one of my side projects. I DID it.

Dang it I feel complete.

Well, I guess all the Linux folks are going to know what I am talking about. Do you know this feeling (Yes, you know. Don't tell me anything.) when you use Linux and nobody else uses Linux in your Work/School. And these people come to you and say.

Stupid people : Oh! You use Linux. That's bullshit!
Me : No it's not. It doesn't do 24/7 updates like Windows.
Stupid people : No, Linux is bullshit you don't have money for Windows. And Linux can't run professional Applications.

Unfortunately there is no medicine that cures dumbness. Just saying ...
I'd rather stay not dumb like these people instead of buying another Windows license.

Time to rant about JavaScript tutorials.

If you don't know the 'jQuery basic arithmetic' joke, Google it now. It'll make you laugh, promised.

In that manner i just remembered a JavaScript tutorial my fiancee tried to follow when she did an internship at the company i work for last year.

She was tasked to create a temperature interface for our server rack, which she wanted to do via an Arduino and a webserver aswell as an SQL database.

The Arduino part wasn't really a problem, but since she had no experience with js she very closely clinged to a chart visualisation tutorial.

All of that worked very well, but beeing the person i am i looked at the code and found something off.

The chart library had no dependencies to external libraries or any local files for any of them. Though the tutorial used a jQuery import.

So why did it use jQuery?
Well...
To load the chart initialization after the page has loaded.

So they pulled the entirety of jQuery in just to do what fucking window.addEventListener('DOMContentLoaded',function(){...}); could have done.

I wonder how many people who just want something to work did this shit. I hate it that so many tutorials do not adhere any kinds of standards, override behavior because they don't like it, even though it may have a very good reason to exist, pull entire libraries in for something vanilla <language> can do in 3 lines, etc.

Fuck.

Well, the system is offline, links are broken and users are complaining! Developer, what did you do?

After some digging around the designer made a "simple change" to a csv file, add a column to include the image file name of each item...

I mean, it just shifted ALL THE COLUMNS in a csv file but what could go wrong? 🤦‍♂️

I dont hate PHP, but I do hate when lazy admins do stupid things.
Why can't the PHP-maintainers do a proper website? Why the fuck can't I subscribe to mailing lists?

Well, it seems like when I do a request, the webserver sends a email with MY EMAIL. And guess what, the listserver REJECTS it because it fails DMARC.
They also refer to the manpage of ezman, but they have disable ALL the functions there too.

What kind of retards is doing that shit. I completely understand why people hate on PHP now.

Fuck (some of) you backend developers who think regurgitating JSON makes for a good API.

"It's all in JSON. iOS can read JSON, right?"
A well-trained simian can read JSON, still doesn't mean it can do something with it. Your shitty API could be spitting out fucking ancient Egyptian for all I care, just make it be the same ancient Egyptian everywhere!

Don't create one endpoint that spits out the URL for the next endpoint (completely different domain, completely different path structure). Are you fucking kidding me?

As if that wasn't enough, endpoints receive data structured in one way, but return results in another!! "It's all JSON", but it's still dong.

How do I abstract that, you piece of shit? Now I have to write ever so slightly different code in multiple places instead of writing it only once.

How the fuck do I even model that in a database?

Have a crash course on implementing APIs on the client side and only come back when you're done.

Morons.

Me : *trying to download latest version of android studio*
Google: "Your client does not have permission to get URL /studio/index.html from this server. That’s all we know."
Me: FUCK YOU GOOGLE
Me: *googles: دانلود اندروید استودیو* (which means download android studio)
*and downloads it from a random website*

It happens every goddamn time, why the fuck i can't download this shit !? Because these countries are fighting each other all the time! What did i do wrong in my life? I just want to download your fucking app to write another shitty app to continue my fucking life. I don't know shit about this wars happening, I'm just a dev like others all over the world.
Downloading an app, is that too much to ask? Well fuck you then.

Backstory: Offering manager brings a project through a few months of requirements gathering / feasibility study etc. Project spends 8 months with a R&D team to flesh out. Our team gets 6 months to turn it into a ship able product. 4 months in, offering manager calls a meeting.

OM: ok so you are all working on project X, well I need your input on something

Team: Ok, go ahead

OM: what do you think the app needs to do?

Team: ... I'm sorry?

OM: well we've been looking at it, and we don't think it does very much compared to existing apps. We need a killer feature but we don't know what. Any ideas?

Team: well we were looking at project Y originally, which was a lot more advanced. But you pulled the plug in favour of this.

OM: yeah, believe me customers will want project X a lot more. It just needs to do something interesting ... you know what I mean?

Team: not really, if it doesn't have anything, why did we go for it?

OM: ok I don't think I'm being clear. Point is, if anyone has any ideas let me know, we need to ship it in 2 months and it needs to be killer

I handed in my notice that week and was asked why ... let's just say I told them.

Manager: "Hi Almond, how is X going?"

Almond: "...I don't know, Bob is in charge of that."

Manager: "Ok. Do you know the status of Y at all?"

Almond: "Not sure, isn't that Bob's responsibility too?"

Manager: "Well, yeah, but I never seem to be able to get a good answer out of him. Find out on both fronts and let me know ASAP please"

...sure, I know how this goes. I'll stop all the dev work I'm doing, do your job for you, talk to the lazy bonehead that never bothers doing anything, report back that he's done sod all (or still "in a requirements gathering phase" as he puts it), be asked "why is he taking so long", have a bit more back and forth, then decide we'll just leave him be as actually trying to get him to do any work is going to be too much like hassle 😒

Just got a warning email from OneDrive saying my account would be frozen soon because I had used 28.1Gb of my alotted 5Gb...

Erm... First off, I do not use OneDrive. I use Google Drive and JottaCloud. I have actively tried to get RID of OneDrive in Win10, with all those damn notifications all the time.

Secondly, I guess it's nice that if you DO use OD and hit the limit, they don't just cut you off instantly. But nearly 500% overuse seems a little late to react, no?

So I logged in and looked around to find out what the hell was in there. Turns out, MS had decided to upload my entire images folder. I did not ask them to do that. Deleted them, but will have to check the damn OD service when I get home so I can KILL IT!

And I am going to have (yet another) talk with MS support as well, I think...

IntelliJ has this tutorial where it teaches you a bunch of shortcuts for making life easy, since version 2017.3 or something like that. Most of it is pretty meh, some of it is pretty useful. And I just came across a keybind to auto format code.

What else do I need. If I can quickly format my code and make it look pretty, that's all I'd want.

"Try reformatting the selected code with Ctrl+Alt+L"

*Linux Mint goes to lock screen*

*logs back in, code is unchanged*

Well played...

Isn't it disturbing that all major operating systems disrespect the computer's ability to do things? Everyone is becoming a walled garden, and people are increasingly developing and limited languages that consume more resources than they deliver value. Today VisualStudio on a corei7 is less performant than a Delphi 5 running on a Pentium 166mhz.

Much of its processing, energy and carbon emissions are used to display ads that "interest you".

Well, thank you *BSDs, Linux (except Ubuntu) and Illumos, for continuing to respect my computer's capabilities.

In my first year of college right now, and on the first test we had to write some C# ConsoleApplications. We got instructions of what we have to taken as input, what we had to do with it and output it to the console.

I've tested them all and they all work correctly, which was the main objective. I have used the correct data structures, but I didn't get top mark. Instead, I got lower because "I didn't do it her way".

WELL F*CK YOU TOO!!! I hope this is not how every test/exam goes

Well, it finally happened.

After 25 years coding in all types of languages and environments, I’m no longer having fun.

It now seems like it’s a fight to get interested in the code. I used to be something that I would spend hours / days doing. Now I just want to walk away from the code.

Is it true (do you think) that after a while all you see is a for loop, an if statement, a null check and you just think to yourself. Fuck this! Because I think I’m there.

God it’s depressing to think that I no longer find it fun.

I do own a HI-end XPS 13 w/ i7. I have it for more than 3 years by now. It's a fucking beast! It's running cold, VERY snappy, does its job VERY well and VERY fast. I cannot imagine owning a faster machine...

Today I've noticed that all the 3 years I've been running in powersave mode (cpu capped at 1.7 GHz).

Jesus hugging Christ!

Microsoft Teams can burn.

Their latest feature ? Well, turns out that when I get notifications on mobile that I do not get on desktop BECAUSE I AM FUCKING INTERACTING WITH THE CHAT OR CHANNEL THAT SENDS ME MOBILE NOTIFICATION, the notifications do not clear themselves. Oh, no, that would be too smart.

So EACH FUCKING EVENING I sit and browse all the fucking notifications to see if there is anything noteworthy I need to act on, or if it is a dead notification from earlier today.

Dear Lord, Microsoft are fucking experts at TAKE A WORKING FEATURE AND BRAKE IT.

Well I met my wife and decided my current profession wasn't going to give us the life I wanted for us. So since I did IT communications in the Army, I decided to look into that field, buy I knew I didn't want to do networking; I hated it in the Army. I read about programming I saw that I could learn some for free online before I chose that as a career. I did the website courses on Codacademy and thought it was a lot of fun! So I enrolled in It's software program, got 1 quarter away from an AAS in software development, then while I was on my honeymoon, they shut all the schools down and filed bankruptcy. Now I've started all over and community college to eventually get a BA in computer science.

Well two days ago, i was in a sap codin g camp (ranted about that)
The challenge: moke a robot that avoid collisions and 6inds a black mm spot on tha floor
We marginally had enough time te implement sth but well i tried to do an algo.
10 mins before deadline i realized that it wouldnt work. So i took an old prototype (without algo) from the trash bin, fixed compilation errors and went to the competition without testing. Because we had to do a little explanation for the parents about arduinos, we all were shaky. A friend of mine even failed to remember his text xD

Asso, because of Fortuna wanting to beat us down, we were the last team driving in the arena. Everybody got pretty fast times. (with a random algo). At the end, we took our robot with the untestet thrash bin program.
It drove pretty well, avoided collisions and then it happened: it reached (only robot not to collide) the black spot in 1:09!!! 😁

Now that I am coding for money, the motivation to learn and build new things is gone. It has become all about money for me now. I get tired after coding all day and I can’t open my personal laptop to learn new things and do some more.. well.. coding.

Will I ever get that motivation back? Because I have some good ideas in my mind. Just can’t seem to start working on those ideas.

A coworker and me did together a "hackathon by choice" this week to finish a project. We did it only because we thought it would be cool and be able to finish the thing. Well it was surprisingly fun to stay awake 36 hours, coding all through, having a good flow. After that, our boss came and was very proud of our work and he was able to send it for inspection to the client. I stayed a bit longer to fix a few minor bugs, but after 42h I was finally in bed. 😁
Our boss gives us the following Monday off.
But I think on other projects, often deadlines take the fun out of it, if they are not estimated well... I mean you do great, high-professional work but in the end you feel bad, useless, slow and incompetent because of the pressure.

!rant

Got an interview for a really cool position, don’t have specific knowledge about what they do, though. But willing to learn all of that beautiful stuff..
If I get the position, I will rock it:)

Wish me luck.
If you do, may your code always compile and your server stay up.

If you don’t, well yeah, whatever..

Just joined a new team at the organisation as senior dev.

Team lead keeps singing about how we need unit testing and good standards.

I implement domain pattern on the backend supported by unit tests.

It passes QA and then get an earful about the code not being 'restful'. What does that even mean?

Well, it matters not since team lead changes the whole feature in the release branch and all unit tests obviously fails. Builds start to fail.

The solution? Comment out all unit tests. In the sprint retro, we hear the same old adage 'we need 80% code coverage'

Do as i say, not as I do. FML.

This is a followup to my earlier RealTek networking rant.

After reviewing and researching all of the wlan adapter suggestions on that rant, as well as a few more, I settled on an Alfa AWUS036ACH usb3 wireless-ac adapter. Every Alfa I've ever owned has been amazing, so I happily bought it.

It arrived today, and I excitedly threw my existing RealTek garbage across the room, hooked up my fancy new toy, and... nothing.

Fearing it was doa, I ran `lsusb` to see if it was even showing up... and it was! but identifying itself as a RealTek device...?

All of my research showed it uses the Atheros9k chipset. It's advertised and praised as using the "famous Atheros AR9271 chipset" and the Ath9k drivers. Except this particular unit appears to use the RTL8821AU chipset, therefore requiring RealTek drivers. askfja;sldf.

I unhappily fetched the garbage from the dirty laundry where it landed, installed it, and began my research anew.

I found, among all of the wonderful promises of Ath9k bliss, a thread on the Kali forums corroborating the RealTek driver nonsense, and it explained how to get the RTL8821 drivers working with it. which is pretty much the very last thing I want to do.

If you've read any of my networking rants, well, they've all been about how totally awful RealTek linux drivers are, and that's pretty much common knowledge anyway. So I'm like extremely pissed off.

ARGH WHY IS NETWORKING WITH LINUX ALWAYS SO FREAKING DIFFICULT? haslkfjasgdskg

Today after working 7 days on a project. My coworker comes up to me and says he pushed everything on the server and that he cleared git to make everything cleaner. When he did I that he forgot to change some vital things. Now we have a black website running and no backup code. I was so passed at him. Luckily a stressbal works really well. I threw it at is head and felt immediately better. Sad part need to do it all over again.

Well I'm a first year student in computer science and in the first semester we started to learn C language and the IDE they told us to use for better learning was Devcpp.
We made a few small projects and all went well, but now in the second semester we started to make bigger projects with linked lists and memory allocation and Devcpp starts to be a complete bug itself... We are working hard in the project and after saving the project with no errors at all, at the next day, Devcpp starts to make any function we made invalid...
So we spoke to the same teacher about this and asked what can we do about it....
"Are you using Devcpp? You shouldn't, it is not that good for C"...
ARE YOU KIDDING ME?

(From a previous rant I made)
As a note to all of my brothers from India. I am not happy with the current state in which your country is in regards to this bothersome pandemic. I do not feel happy, I am not jumping around singing to the doom you are all facing. I am sad. I know your people are good and your engineers outstanding.

Were it for me you would all be here in the U.S with me chilling with some good bourbon in celebration to how strong you can make our tech be.

My previous post was in regards to scammers, and I am very well aware that you are not at fault.

Be strong brothers, you will all survive this, just as India has survived generations of struggles.

Well thanks to all the help from you ranters and some of my close friends, I decided to take the Web developer job. I start in two weeks as a Web Developer!

P.S. PHP is not as bad as I thought it would be. It actually allows me to do as much if not more than C# in ASP.NET land.

Well in America, developer is the current "hot" career if you wanna make bank and rightly so, you can make a great salary. However the "business types" politicize the position since it's trendy right now and do all sorts of undesirable things like looking for "10x" or "rockstar" devs, etc. It's really just an excuse to have you on call 24/7. Some jobs, you go home, but you never really clock out of work. Well, if you even make it home; you could end up always travelling for your work.

But at least it's a romanticized and well paid position, unlike system admin, who may work the same hours but will never have the "cool" job.

I really don't get all the Musk fans. I mean, sure you can find some value in Tesla or SpaceX, sure you can think theses companies are truly innovating. But why give all the credit to the rich businessman who seems to spent more time promoting himself than really working on science stuff, and not to all the ingeneers and creatives who are really putting some hard work on every day ? All Musk is really doing is running a business. He seems to do that pretty well, agreed, but after all it's "just" that: business. He's not the genius, nor the creative. He has money and invests it well, that's all.
I don't get why so many people give all the credit to him, even here on devrant where it should be logical to find more people supporting the real brains behind the tech.

"He has a vision about the future, he's imaginative..."

- Well that's bullshit.

Once again: he has money, a lot, and a certain skill about how to invest it (and about doing some proper marketing too), which companies to buy, etc. That don't make him such a great visionary about the future of the human being, just a great businessman. I'm sure you can find millions of people around the world with better ideas about the future, but they're not in his position. They're not rich, they're not CEOs, they're mostly unknown.

Stop follow the stream by glorifying businessmen just because medias are talking lot about them. Instead, know where the real talent (and work) is. Give credit to Musk employees, not to him.

There was an android project that I got from my senior.

he told me that another developer already completed most the project and all I have to do is minor changes...

Well when i saw, i was amazed that the code he commented is more than the actual working code without any structure.
He copied most of code from internet.

If it's not working, put in comment else use it.

It took me a whole month to figure out what's going on.

And another 2 months to fix the issues.

Well in last my senior told me that the developer took 1 year to write this code
(to be honest any normal developer can complete that project in less than 3 month)

You do know that "why do I need you if I can copy-paste code from SO?" joke floating around, right? Today I had a real-life situation perfectly illustrating it.

So I bought a set of parking sensors. Cheap ones, from AliExpress. Prolly the cheapest ones I could find. Installed them w/ engine turned off. All seemed fine. Cleaned it all up, got ready to go, started the engine and beeeep beeep beeepeeeeep beepp ..... beeeeeeeeep.

fuck.

Tried unplugging/replugging them one-by-one to find the faulty one. Nada. Apparently they all were false-alarming. They must all be bad, bcz they seem to work well w/ engine turned off (ignition on) and only false-alarm when engine is on.

Allright, I'll get a new set next weekend, a more expensive one and replace them again.

There goes my €20 and another week basically w/o parking sensors (car length is >5 meters, so sensors do help a lot).

Today I spend a few hours removing my rear bumper again, replacint all the sensors, wiring, etc. Tests show promising results - all sensors seem OK even w/ engine on! Close it all up, start a car again and.... beeep bep bep beeep beeee..eeeeppp.

MOTHER FUCK!

Another 30min-hour goes by while looking for a possible culprit. And I found it. The fix could did not take longer than 5 seconds. Apparently a wire feedint the sensors' controller was too close to sensors' wires. All I had to do is to push that wire a lil further from the controller with my index finger.

I could have saved €30, a week of time, half a day of work if I only knew what wire to [literally] poke.

shit...

RANT!
AAAAAAAAHHHHH!!!

BLOODY FUCK TURD BORN FROM THE BACTERIA OF YOUR MOTHER'S POOP, BRAINLESS WHORE
. JUST ONE SECOND OF YOUR NON EXISTENCE WILL CHANGE THE WORLD FOR ME.

Well this is what I would say to my brain deficient friends who think I don't have a life and sit at the computer all day playing GAMES and that I should get away from my computer and learn to PLAY with them in real life

BITCHES DON'T EVEN UNDERSTAND HOW IT IS TO WORK YOURSELF A LIVING, ALL THEY KNOW IS THROW MONEY AND GET THEIR DICKS SUCKED OFF. FUUUUUCCK!! AND DON'T EVEN GET ME STARTED ON THE GAMES PART. ALL THESE PUNY FUCKS CAN DO IS TO POST POUT FACES FILLED WITH DOG FAECES AND CRY ABOUT THEIR LOST LIKES.

I know we have a lot of talented people here. Piece of advice, what ever you build, believe in it. See it through. No matter how good of an idea incompleteness won't get you anywhere.
After all every other day we all analyze different successful products and say "huh... that's nothing. Even we can do that".
Well thats the difference "We" can do that, they DID it.

See your ideas through. Stay motivated =)

Building my own router was a great idea. It solved almost all of my problems.

Almost.

Just recently have I started to build a GL CI pipeline for my project. >100 jobs for each commit - quite a bundle. Naturally, I have used up all my free runners' time after a few commits, so I had to build myself a runner. "My old i7 should do well" - I thought to myself and deployed the GL runner on my local k8s cluster.

And my router is my k8s master.

And this is the ping to my router (via wifi) every time after I push to GL :)

DAMN IT!

P.S. at least I have Noctua all over that PC - I can't hear a sound out of it while all the CPUs are at 100%

I use a library and it gives me some strange error message. No problemo, just file an issue on GitHub asking the maintainer if I'm plain stupid or the lib actually has a flaw. As it was a question, I have not posted a dump and all the shit.
Maintainer responds with a snarky comment about his crystal ball being broken and I have to submit a log, a dump, debug information and a bunch of other stuff.
Well, what choice do I have, I collect all the requested information, create a wall of text comment, all nicely formatted.
And the issue ends here. Myths say, the maintainer got asked to join Elvis on Mars.

I mean, why do you ask all the shit from me in a unprofessional manner just to stop answering? Just say "I have no clue why it behaves like this" and I know whats playin. But that's just ... sad.

Simple there are four other developers on my team. Yet, I do all of the work.

I'm picky about spesific tasks, so I would rather do THOSE by myself, by we have a Trello board where I've marked the tasks I want to do myself, and everything else is open for grabs.

Some tasks I will asign others (one developer specifically) and days will pass and no code gets touched. So I end up having to take it over. :|

Like, guys, I get it. You have other things to do. But could you atleast *try* and help me without me having to ask? If not, then why did you even sign up? I want to get this out the door so our project doesn't go under and we can make some money. I have other things I would like to do as well, you know. Like take a day off, or spend time with my girlfriend.

Let's share information! Communicate! How do we do it? Via email!

You got question? Send an emai!
You want to share some excel? Send an email!
Not sure who to ask? Send the email to everyone!
Have a 100 message long email thread and then need some help? Send the whole fucking thread to me and just add "what do'ya think?"!
Send some attachment in email and then 2 weeks later refer to it saying "but I sent the file to you!"? Well surely I can remember your special email from the hundreds of email I get every week.

I did complain to the mangers that why the hell do we have these mega-email-threads? Why do you send all the meaningles release notes to the whole company? The anwer is simple: all information needes to be transparent and if you don't need the info, then just don't read the email!

And fuck you, you CEO wanna-be who sends seasonal greetings through his secretary and thinks anyone gives a shit.

Why do people mix JS vanilla with framework syntax? That's horrible.

Why do people use jQuery anyways? There's no need at all anymore. It is just dumb JS for dumb devs.

Did that trigger you? - well....

Just lost my shit with a colleague which went for the Nth time "Oh MaN tHiS sCrIpT sUcKs So BaD".

Dude, I wrote the thing in 5 days, and back when I did I had no experience whatsoever with JS -or with programming at all, for that matter. It was pretty much my first project and I was as green as it can possibly get.

And yet, that script served us well for well over a year and a half without being touched once. It always worked for everything you could possibly want. Shut your mouth or do it yourself, buddy.

Me: *Make a PR*

Seniors: *takes 5 days to review* This must be changed

Me: Okay. *Make changes and PR on same day*

Seniors: *takes another 7 days to review* Oh, you also need to change this

Me: really? Okay. *do the changes*

Seniors: Well, I'm gonna accept it. But maybe you should rework all the integration later.

Me: what.

I'm super tired of this shit.

So I promised myself some down time this weekend since I usually end up working all night and in a blink my weekend is over. I also declined going out for better 'relaxation'. Here's how it's going so far...

>Gets home. Hmmm what should I do I can do anything! *thinking*
>Pours a stiff whiskey
>Trys watching something as well as playing a game, gets bored of each and abandons them.
>Opens a dev newsletter
>*blinks*
>Realizes I'm elbow deep in some repo... starting to feel inspired.
>Decides to code something "fun"
>Uses "Well as long as I'm not *working*" to justify his addiction.

I'm really not sure what I did for fun before I started coding. It ruined things by being so damn enjoyable and ultimatley many other things became well... less fun.

This is what addiction looks like.

"Let's go to buy Laptop for you. You're going to be Computer Engineer"

after 2 months
" What do you do all day spending on laptop?"
"Programing"
"Well, how's that work?"
"It follows some algorithms to get desired output"
"???, Some important files are accidentally deleted from my usb storage. Can you recover those files?"

😮😣

Got to know about OSMC/Kodi last week. Took out my Raspberry Pi. Setup OSMC over the weekend, did all the cable setup for 4 external hard drives and connected to TV via HDMI. After few configurations, I'm all setup. I'm astonished by all the features it provides. Fetching data from TMDb (I had actually created a javaFX app to do this for my local library just last month), remote control from Android as well Web Browser. Enabled UPnP and now I have my complete media center floating around my house network. It is one of the best open source project I have laid my eyes upon. Wish I could attach more pics.

One of our politicians at the late-night-show

Q: who wrote La Traviata? Giuseppe or Verdi?
A: ummm.. Ammm.. Well.. *confused af*

Q: so do you know it or not?
A: I know it! I know. I know but I won't tell you. *in all the seriousness*

[true story]

somehow reminds me of IT guys who pretend to know everything just to look cool :)

i'd rather burn a site to the ground to preserve it in its current state than let it devolve into a place for SJWs to basically outlaw everything because they're special snowflakes. It's about breaking video games, you don't need to say "well you can't use he/she/him/her pronouns ever, you can't acknowledge binary genders, you can't say the word 'retarded' even when referring to the dictionary definition of the word (synonym of regression), you can't send PMs at all because privacy is against God, you can't say/reference God or Christianity because #NotAllReligions"

just fuck off. We break Pokemon games, we don't plot to genocide the white race because all whites are cis racist Nazi cucks like you do goddammit

;-;

Was talking about how I implemented CI/CD in one of our projects as a starting point to others and how it worked by running tests and deploying to the server and one of my colleagues laughed about having to have tests at all, I explained and asked him what was he gonna do that morning, his answer:

"Well, I'm gonna test the system X and fix some bugs"

To what I replied:

"If you have automated tests you could have those tests automatic(?!) and they also help you finding bugs early"

Wtf do ppl have in mind that they prefer remediation over prevention and they end up wasting their time with shit that could be fully automated?

My new co-worker is extremely stressing. I have to give small tasks so he won't forget to do anything. I also have to explain what he has to do in detail, give him the full solution, and show him exactly how he has to do it.

And he has no idea how to use git. He makes a feature branch and pushes all his various, half-finished features into it and makes a pull request.

And then I still have to refactor his crappy code everytime cause he uses variables like $data, $accA, $accB, $accZ and forgets to use the definied color variables in sass.

I literally have to do my work and his as well -_-

Interviewing is much harder than it was even a few years ago. I go into it knowing I probably won't get the job. It may sound negative but it relieves the pressure. I also make note of what I didn't do well on so I can work on it. Last year I wanted to leave my job so I would go to interviews at lunch and do phone interviews in the parking lot. I was turned down for soo many jobs. Just a couple of years ago I could get a job in one or two interviews. Things have gotten more complicated. It used to be if you knew even a little about a backend language and a little sql you could easily get a job. It has all changed. I think the javascript framework of the month thing has only made it worse.

About starting your career at a medium-bigger company that's well-established, versus starting at a smaller company.

That's my point of view:

It's always wiser to begin at a company that's more established (you will also be sure that you will get paid on time). I started at a well-established company, and I managed to buy gear, travel, do stuff, and then I realised that I wanna do more, not only live to work 😎.

Smaller companies are kinda risky, think of it, their goal is to reach the level of a well-established company, which is some levels lower than that. On the other hand, if you do well at a smaller company, your next goal will be to work for a bigger company, which will surely be nicer, more professional and will pay better. So you will have managed to et there with all the skills in your pocket already, which will come in handy later!

Bigger companies are excellent if you have a family (wife and kids), they provide stability, that's the most important thing, but I believe that in order to get "settled" in a company like that, you should at least have tried something else first, like doing your own thing or get challenged in more complicated gigs that require you to up your skills.

In the end, it's all sun and fun, with you code editor by your side 😉. I'm interested to see your opinions.

Recruiter reaches out to me, he says he saw my LinkedIn and thinks I'd be a great fit.

I say ok and send my resume.

He gets me a phone screen. I do it, I think I do a pretty good job. (I'm able to answer all the questions well, I think I'm onto the coding interview for sure.)

A couple days later I get a generic rejection email.

I'm not sure what happened. They had my resume, I know I did well on the technical questions (I do that kind of thing for my current job all the time.)

No idea why I'm rejected. If it was something about my experience, they could have seen that from my resume. If it was something from my phone screen, I have no idea what it could have been.

Just wanted to rant >:[

A lot of larger companies seem to be a happy about forcing employees to change their password every three months or so. They do it for security measures so that it is more difficult to break through the system, however most people end up making the worst passwords.
Instead of forcing a very good password on them every year or two maybe, they all end up having passwords like: "Summer16", "Qwer1234", "London15".
I used to work for our national police, and this was the case there as well...

There’s so much we can learn from Gordon Ramsay..
I wish I could swear & insult like he can..

Woman: “who do you think you are? You insulted my friend!”
Gordon: “well if I did then I probably meant it, now get your fat ass back to your table”

“Congratulations, you just got your head out of your own ass. Now piss off”

*Customer wants more spinach*
Gordon: “ ok I’ll make you more spinach *dramatic pause* and push it up your ass”

Or my all time favorite:
“You fucking donkey”

Central team: No, your team must be doing something wrong. Our pipeline is super-configurable and works for any situation! You just have to read the docs!

Me: Where are the docs?

Central team: Uhh, well, umm... we'll hook you up with a CI/CD coach!

Me: Okay, cool. In the mean time, can you point me at the repo where all the base scripts are?

Central team: Sure, it's here.

Me, some weeks later: Yeah, uhh, the coach can't seem to figure out how to make our Prod deployment work either.

Central team: That's impossible! It's so easy and completely configurable!

Me: Well, okay... but, here's the thing: your pipeline IS pretty "configurable", in the sense that you look for A LOT of variables...

Central team: See! We told you!

Me: ...none of which are actually documented, so they're just about useless to me...

Central team: But, but the coach...

Me: ...couldn't make heads or taisl of it either despite him literally being ON YOUR TEAM...

Central team: Then your project must just be architected wrong!

Me: Well, we're not perfect, so could be...

Central team: Right!

Me: ...but I think it's far more likely that the scripts... you know, the ACTUAL Python scripts the pipeline executes... while it took me DAYS to get through all your levels of abstraction and indirection and, well, BULLSHIT... it turns out they are incredibly NOT flexible. They do one thing, all the time, basically disregarding any flexibility in the pipeline. So, yeah, I'm thinking this is probably one of this "it's you, not me" deals.

Central team: Waaaaahhhhhhhh!!!!!!

I’m slacking been so busy, forgot to post yet another book..

Soo here ya go..Engineering A Compiler.

For those who don’t like the Red Dragon compiler book for whatever reason, most don’t like it because they don’t believe the dragon book covers topics in a “Teachy way” and doesn’t explain certain things. As well as not cover one topic.

Then this may be the book for you. It’s significantly newer than the “Dragon book” and I believe it does do a better job laying out for “learning”.. I could see this book being used in universities.. I’m sure it is, but mine never had a compiler course so whatever. Good book

Fun fact.. it references the dragon book, as well as the other books the dragon book authors wrote as well as articles in the ACM..AND! It also references Knuths art of computer programming and other books of knuth AND references the Algorithms book. All books I have previously posted.

I have not read this book, only skimmed as I have recently received it this one. May do a follow up or even at it to the list to make a YouTube playlist going chapter by chapter thru the book.

That’s it I’m done with writing documents like Software Product Specifications and Software Requirements Documents and Software Architecture Documents, manuals, data sheets and more in MS word..

I’m doing it all form this point forward in LaTeX... I can stay in my editor, it works beautifully with version control because it’s just text... I can split it amung multiple files.. it looks damn sexy. I can focus on the content rather than being distracted by formatting and spelling issues and the rest of that shit.. ALSO.. it doesn’t crash or get corrupted.. well at-least I’ve never had a text editor crash or corrupt my files.

Idk why I didn’t learn latex sooner and do the switch.

Taken partly from an article I just read.

Russels paradox is a problem discovered by Bertrand Russel in 1901 when studying set theory.

He describes a set that contains all sets which do not contain themselves. The set of all pornstars does not contain itself for example, so it can be include in Russel's set, as well as many others.

But what about Russel's set itself? It doesnt contain itself so shouldnt it be included as well? But that would mean it DOES include itself which means it DOESNT belong to the set. And it would keep switching like this, monotonically, forever. Hence the paradox.

If it is monotonic then where we begin in the sequence doesnt matter. So lets do away with that bugbear.

Now if russels set IS the set of all sets that dont contain themselves then we get a paradox.

However if russels set merely *has* as a single subset, all sets that dont contain themselves, then shouldnt russel's set with one level of indirection, contain itself?

I am so mad, I have no words for how fucking much I hate ever having to work or pass work to other incompetent developers or teams, what a fucking waste of time and resources.

After handing off the frontend - for the client to find some team, that would do it in the short time and budget he needs (multiple developers, more fast, much good), he found a team that seemed to be alright for the job and seemed alright to me too, now maybe a month or two later, the client contacts me, that they fucked something up and if I could talk to them.

The email I then received from them seriously made me speechles, mad and sad, all at same time, I spent multiple upon multiple hours, getting a very good readable documentation up (markdown with TOC, properly rendered headers, bulletpoints, all that shit), with all files, all services used, all credentials, even converted all ssh keys into putty ppk format, in case the developers are using windows and are too dumb to do it themselves, nginx configs, it had seriously everything, even too much to list.

They somehow managed to fuck up the entire server, while attempting to "add ssh keys themselves", EVEN FUCKING THOUGH I have included all the keys they need, all the hosting credentials, everything, yet they decided to fuck with shit themselves and completely annihilate the server in the process (HOW?!), so not even the webserver works anymore.

I am fucking speechless, I made it so fucking easy to gather all info and files they need, all properly put into well named folders, along the documentation in an archive and they somehow managed to nuke the fucking server, while attempting to add ssh keys?!

If you don't know how to config a server, then don't fucking touch it and just use everything, that got served to you on a fucking silver platter.

---

I'll just instantly answer the most annoying comment, that somebody could come up with: "why didn't you do it yourself?"

Because in a perfect world, a fully managed team, can do much more than a single developer can, especially in the same timeframe and from what I heard of said client, atleast they did something in terms of developing the system. (which surprises me, considering it's the same people that nuked a server, while trying to add ssh keys)

The week where you have so much to do on different projects, that even if you manage to work on all od them a bit it feels like nothing has been accomplished.
The point of being so tired that even the mildest sickness feels rediculously awful.

And it's friday. I manged to do some work for one of my bosses but the work I want to do didn't really get done and now I have two meetings in which I can say I started doing xyz but couldn't finish it due to bugs and exhaustion. And for the other project I wrote documentation.
Well.
T_T

Mgr: composer require. That's all you're allowed to do. I want you to manually go through our word press site, check which ones need an update. And do a composer require in the command line for each to update them.

Me: wouldn't it make more sense to just increment the version in the composer.json and then run update?

Mgr: no, you don't understand how composer works, it's very complicated. Just do require. Don't ever do update.

Me: *does it anyway (reverting later of course) and compares update vs require and their differences in the lock file*

I mean it looks like 'update' is updating important dependencies for each of the packages as well as the package itself... The 'require' just seems to download the package itself but no updates to dependencies for those packages.

But seriously is composer that complicated that I can't just do an 'update'?

I've been reading the composer documentation and it seems to be saying that update is the better way to go...

I'm doubting myself these days...

Fuck it..
What’s the point?
Why do we care about a point at all?
Why do we even try to make sense out of it?
I’m religious but if you think about believe long enough that’s a point to question as well.

I guess the 2nd lockdown is getting to me.
I’m extremely introverted but this I too isolated even for me.

In the the 1st lockdown I made it for 3 weeks, now I’m breaking after 1.5weeks....

Fuck, fucking cock sucking stupid ass prick of a little black box, why, why the fuck do you not fucking boot any more, all you have to do is fucking boot but no, that's to much for you to fucking do!

Ah well, good thing it's only a Rpi!

It had a good life, now to wipe the card and start again! I

I swear to god, if I read another medium post on how you managed to be focused and productive I will fucking... well... roll my eyes, make a facepalm and rant about it on devRant!

Who gives a shit if I'm unproductive and unfocused?!

Well, look at me now, I'm fucking productive while I write about you, you fucking peace off shit! And guess what? I'm not even using any of your 40 todo apps or time trackers. There is no pomodoro timer next to me or framed quotes from Steve Jobs hanging on the wall. Oh, I must be a fucking genius!

But what if YOU became unproductive?
What will happen when YOU start to procrastinate?

Do you really think the world would care?

Oh, but you are not really a writer are you? you're a developer building your app!?
Well fuck, I guess you're going to change the world than?
It's your big project. Your life's work, your legacy.

Let me remind you...

All apps will be abandoned!
All blog post will be forgotten!
Productive people will die!
Focused people will die!
Enthusiastic bloggers writing about productivity will die!
All CEOs and CTOs will die!
All developers will die!
Steve Jobs is dead!
In x years, you and I will also be dead!

Whatever you do, it's not really that important!
It's really not.

You're not going to change the world.
The world doesn't need another app.
The world doesn't need your advice on how to be productive.
You are not special.

Deal with it!

SINGLE

RESPONSIBILITY

FUNCTIONS

HOLY GARBAGE UNTESTABLE DIFFICULT TO DEBUG JFC SHIT.

FUNCTIONS DO ONE THING AND DO ONE THING WELL. LEARN IT, LIVE IT, LOVE IT, OR JUMP INTO A LAKE

that is all.

Ok, so many people rant about windows update. It can fuck up things, starts unexpectedly (after 100 warnings and messages letting you choose when but ok) and it takes too long to update.

I use Windows daily so I update regularly and never takes more than 5 mins. 20 when its a major update twice a year. So let's talk about Linux.

Yesterday I wanted to try out .net core on Linux so I booted my antergos vm to do it. TLDR: Didn't do shut because, surprise, Linux updates.

So apparently I downloaded the wrong version of visual studio code. Uninstall and install the right one then. Nope, can't do that. Some dependency must be updated. That dependency is on the highest version on the AUR, I have to get a different one. Ok, no problem. But I can install the other because uninstalling the original breaks more dependencies. Well fuck then.

So I decided I'd do a full system update with pacman, shouldn't take long. 1.6gb worth of update. I have 200mb download so it should be fast right? Well, I had to wait a couple of hours.

So I couldn't do anything on my afternoon because of Linux updates. That's an original rant isn't it?

And before the comments get here, yeah I know it's arch, it's difficult and all that. This isn't about being hard to do. It's just annoying and making me lose time.

Continue with my ALL-OUT year of JUST DO IT. Trying to see what happens when I go YOLO for a year.

It started well about 4 months ago, but I slowed down a bit. I just want to pick up the pace again and JUST DO EEET. See where it leads.

Been working on a lot of side projects. I want to finish a few. One is already pretty much finished.

Then, towards the end of the next year, I think I'll start looking for a dev job.

As a .NET dev I get questioned about using VS Code in favor of full-blown VS. My arguments are that it is faster, lightweight and overall more user-friendly.

I use it exclusively, for all types of files and projects (JSON, SQL, Angular projects, .NET Core, ...)

Do you guys like using VS Code as well? What do you use it for?

Also, if you ever want to annoy a colleague, try associating all file extensions with Visual Studio and watch him go bonkers.

Best way to avoid procrastination : We tend to avoid commitments or to do large tasks as even visualizing them seems tiring and the longer it takes, the vulnerable we are to distractions

So I use this simple trick
I break my task into numerous sub tasks. For example if I need to finish a feature before day end, I would first list down all the cases I can think of in order and write them down using actual pen and paper.
I then start implementing them step by step.
I mark them checked once done.
It gives me a sense of achievement as I see those checks besides the sub tasks and I can also take breaks between steps.

So all it takes is just first five minutes of planning.
I had to do the above procedure, for this post as well.
Hope it helps fellow developers
:)

WhaT DO you DO oUTsiDE oF wORK? tell ME SOmETHiNg INtereStInG, PreFerABLY noT RelaTED To yOUR joB Or iNdUStry.

You think I have "time" outside of work? I fucking huff copium like every other fucking wageslave, and we ain't fucking friends so I'm not going to divulge the exact types and flavors of choice for me to be judged.

I don't have the time, money or energy to fucking have some respectable instagrammable hobbies for your stupid like about wanting well rounded people.

We both know all you need from me is to not be an asshole.

At a certain point it feels like the industry is going to compete with girls for shit-testing people except we have whiteboarding leetcode as well.

I’m fucking lost.

So, situation. I have a SQL table with about 3M rows (not a lot).

I have indexes. Indexes are used. BUT when I add where clause (On indexed column), it’s super slow. Around 10 seconds.

If I do select * (ALL 3M rows) and THEN I filter then on webserver side, it takes 0.5 seconds.

HOW my manual filtering is faster than DB filtering with indexes? I even tried bubble sort. Bubble sort is faster than SQL ‘where’. HOW ?!

I do not understand….

And if I add group by….. WELL, 25 seconds SQL time. 2 Seconds if I do select all and group by in code manually.

Does not make ANY sense to me.
What am I missing ?

"Do what you love and you'll never work a day in your life" is probably the truest statement, but there's a lot of people who get the definition muddled.

They think "Oh well that means there wont ever be hard days and there'll never be times where I'll struggle or get frustrated, and it means I'll go home at the end of the day feeling refreshed and ready to do it forever ad infinitum"

There absolutely will be days where you're fuckin done with semicolons or that you've had it with other devs, but the saying doesnt mean any of that. What it means is that while you may dislike the corporate environment or the fact that you dont really care for it after work hours, while you're doing your tasks in their purest form, you're not really feeling all too bad.

I know a lot of people have gripes with this statement. Pull your finger out of your ass and admit that either you don't love it anymore or that you didn't really understand exactly what it was you were loving all that much in the first place.

!dev

Long time, no rant. Why is facial hair so difficult to control? How do people even grow beards without looking like hobos all the time? Do I have to make some sort of sacrifice to a dark and malevolent entity?

Believe me, it's so much easier to keep on top of shaving body hair than taming face fur. Especially because your facial hair is, you know, on your *face* which means it's very visible. You can't hide it if you mess up. Unless you decide that wearing a balaclava is a good idea when going outside, like when going grocery shopping. Generally that isn't received too well though.

Well, I always say that if you going to make things a mess, do it a spectacular way. Today I kicked off a data import job that went bad, and in the process of canceling said job, I canceled myself, and the job went rogue, and became a zombie and ate ALL the system memory, bringing the server to a deathly crawl and throwing a dozen developers temporarily out of work for about an hour, before I was finally able to kill the zombie, and balance was restored to the Universe.

Fucking fuck fuck fuck outdated superiors that know jack shit about how software development works. Dnt even know about git, docker, cloud services. Everything is done on premise with network that is fucking crap and when an app is down "hey why is it down?" ask the fucking server and network admin how the fuck am i supossed to know? i have to create workaround codes when other devs just need to deploy their app and its fucking running as it should be. why the fuck do i need to spend my time debugging Ping timeouts? im a fucking dev. I have done designs, analyze requirements, build frontend, backend, optimize codes, paying attention to security and now i have to fix network problems as well? fuck off

Create Innovation my fucking arse. you just Keep saying that but then wondering "what is this new thing youre trying? its new and different why do that?" because you asked for innovation you fuck. If i copied some other concept its not innovation is it pricks.

Fuck them and all the brown nosers as well.

I once went to a client to get a brief for a website (the twat can't be bothered to write it, so he gets me to do it). I wrote all the details down and fired as many questions as I could. When I got back I wrote up the notes into a brief and sent it back to check before I costed it. He said it was spot on, so I sent an estimate. A few days later he must have shown it to another director, they both call me on speaker phone. Them: Will it do this, will it do that? Me: "It" doesn't exist, if you want to add some requirements then write or extend the brief and I will re-cost it.
They ignored that and rang a little later. Them: We have been discussing it, will it do .... and will it do.... Me: I repeated what I had said earlier, but my tone of voice had changed to reflect my annoyance. I never heard from these pathetic twats again. Moral: I always do background checks on a company, as well as accounts and financials check it's good to tap in to your network of colleagues, designers, freelancers. It can set the alarm bells going long before you commit any time.

A post today made me think about this interview I had about a year ago... I shall tell you all about it.

Went to a hiring event for this company everyone was cool but this one guy (who would have been my boss) was a total arrogant, douchey, know it all.

So anyways cue interviewing with him a week later. He says if I give you task A, B, C and they need to be done by the end of the week in which order do you do them. (Note: he literally said abc not actual tasks)

Me: I don't really know how to answer that question without more information.

Him: Well I like to see how people answer it... So think about it for a second.

Me: Ok I guess if doing one task would help me do the next task faster I would do it in that order. Like I can use code or concepts from C to do B faster.

Him: What if A would take 2 days and B and C would take 1 day.

Me: I don't see how that would influence the order I do them in.

Him: Would you complete one task after another or switch between them or do see simultaneously.

Me: It would depend on my previous answer and what would be the fastest way to get them done but without more info I literally cannot give you an answer of like I would do B, C, A.

Him: Would you do the longest task first or the shorter tasks.

Me: I don't know I guess it depends on if it would help you or somebody else move forward with something if I got a particular task or the shorter tasks done first.

So cue more of this kind of back and forth about arbitrary details about undefined theoretical tasks for like 10 minutes.

Suffice is to say I didn't get the job and I'm glad.

Translating win32 calls to whatever the hell there is in Unix and Unix-like OSes (well, most of them) in order to port a certain game net code library and dear god why did I volunteer myself for this task

At least pevents is there to help, but too bad cmake doesn’t want to compile it with the flag I need (“-DWFMO”) in order to make the “WaitForMultipleEvents” method to work at all. Instead no matter what options I give it on the command line or how I tell VS Code to do it, it seems to give me the finger to my fucking face.

Doing it for games on the cooler OSes... doing it for the community... come on...

I want you all to think back on how "transparent" and "helpful" everyone was to you when you were useful to the company.

And then as soon as you were gone, did they just complain and say something like "how could fullstackclown leave us??!?!?!"

I swear, the last call I was on, I literally heard the phrase "we are such a good team, we think up great MVP products and you guys execute so well"

Let me translate: "we are whimsical fucksticks and you are our slaves to implement it because we ourselves are too incompetent to do it"

Well no more.

Fucking tools, all of them, everyone just wants to use us to get ahead. No competence, no self-understanding, just encapsulate the "IT" or "tEcHiE" people to some department - doesn't even have to even be near us, they can be from any geographic location; they can just be replaced at a moment's notice!

Yeah, well fuck you, because we're growing in skill and understanding, and fighting against you.

Fucking 🤡🤡🤡🤡🤡🤡🤡🤡s

The unionized revolution of software developer is coming soon.

**it's 17:47*"**
Dev: Hi manager I have those 13 tasks on me and I won't finish on time.
Manager: Well all those items needs to be finished on Time, how YOU are going to resolve it?
Dev:😵😵😭😤🥺
Manager: there is additional defect to check please take it on priority ,it a real easy one , I'll do it my self in 5 min but I'm too busy
Dev: ETA?
Manager : by the end of the day.
Dev: Well it's already end of the day.
Manager: Exactly, I knew I can count on you .
Dev:🥺🥺🧐
****Next day *****
Manager: Hey sorry to call you on your cell but I see there were no progress on yesterday issue.
Dev : Sorry Manager I'm sick.
Manager : O.K feel well (🤬)
Dev : thank you so much (😎fk you asshole😎)

I honestly don't understand people who genuinely believe formal schooling will cover all the basics they need to know to do a real-life job, and still get barely passing grades on all relevant subjects.

I genuinely don't understand people who copy GitHub projects to pass classes, and graduate from a university with goddamn StackOverflow instead of a brain.

Whom I understand even less are people who don't do anything major-related on their spare time.

I mean, change your fucking major, do what you actually like, do things that actually light your nuts with passion.

Please don't waste my time pretending you are in it not just because it's potentially well-paid and "cool".

Please don't waste my time being my coworker.

Yes, I'm looking at you, trendy wanker with a CS degree and no personal projects.

P.S. Junior here. Yes, I'm full of hatred for all the "real programmers" in the industry out there. I hoped for a better experience.

P.S.S. I mean absolutely no offense to people using either GitHub or StackOverflow outside of the aforementioned context.

Not specifically a Dev job, but I did do a bit of development at this wifi startup. It was a wifi shop where we set up wifi for hotel clients all over the US. Anyways, they said I would make great money doing "on call" support, and me being an intern and naive I said absolutely I'd do it. Well 3 months later I was put on call essentially every day and one weekend I was with my mother and it was her birthday. At her party at this nice restaurant, with all of our close friends/family, I got a call. It took me 45 minutes to solve because of how idiotic the clients were, and after that I got 4 more calls equally as frustrating and long throughout that night. I asked for help from employees, the owner, ANYONE. Nobody helped. Needless to say I emailed the owner and said farewell that following Monday.

Does anyone else have that project that they work on in there spare time? Well mine was a Pokemon MMO because I'm not a games developer and found it a really nice challenge/break from normal work. It's almost ready to be played but it's sad that it'll never be released. I mean I could recreate all of the sprites and game mechanics but that wasn't what I originally set out to do.

Some marketing people function on a whole 'nother level. They write internally in the same way they write to represent the company externally, using all the bullshit-laden buzzwords, using exclamation marks all over to convey fake enthusiasm. I wonder if they feel exhausted after doing this for a whole day. I know I would. But I suppose if it helps them perform better, well, let them do it, I guess.

Project requirements include a database. I don't have permissions to create a new database on the server, so I go to the person that spins up new servers and deals with group policy. They rustle some papers around, looking aggravated, throws up hands and says, "I guess I'm the DBA now..." Well, what the fuck am I supposed to do shithead? Ask the web team to do it? We don't have a DBA. My boss has been gone all week and, really, this isn't a hard task. You check a fucking box.

Whatever, I'll remember this when they need a favor from me.

I like to code as a hobby as well as do it as a day job so it surprises me quite alot when people get all funny about me coding outside of work/uni. It's just funny because half of these brain dead students know nothing about anything other than what they're taught in education. Most students are so fucking stupid nowadays and they don't like to read or research or learn. But I'm the anomaly. Ok guys. Well done, go get pissed; it's the best you can do with your braindead selves.

There's this weird situation where someone rants about their work situation and commenters dive in with suggestions and comments about what they should and shouldn't do without knowing all the details.

It really pisses me off not just when it happens to me, but I see other posters using devrant here as impromptu group therapy only to be bombarded with "do x or suggest to your boss...".

Now... I've been suggesting and asking the same thing to my boss for over a year, still no change. I'm demotivated because of the lack of progress, I can and do keep bringing it up with him. However having someone here (presumably well meaning) suggest basically the same thing doesn't help, it just reminds me of the frustrating situation.

When this place is supportive its great, when we're all second guessing each other it's frustrating.

Can we all be just a little more excellent to each other? I know I'll try to be. Instead of assuming someone hasn't done x or y, I'll try to be a little more supportive and assume that the most obvious things to try, has been tried.

//rant

So i ordered myself a web server and am trying to get access to phpmyadmin.
I got generated username and password for the phpmyadmin login.
So i created mysql databases and database users, outside the interface, but that's fucking it, i need to create tables as well, can't do that without the interface, cuz NO ACCESS!

Fucking piece of shit service provider, they had one thing to do and they can't even fucking do it right. How dare they call themselves web hosts at all...

It's probably a badly configured config file but i can't access the file myself to start sorting this shit out, so i got to wait at least 12 hours till work hours to be able to contact with them and sort this shit out.

So I kinda started a project just a week or two ago, essentially a CSV to spreadsheet converter that could also do formatting, so you wouldn't have to do all the formatting after you convert it to a spreadsheet. But now I just kinda think that it's not a very good idea and I'd just be wasting my time with it.

I was in the middle of looking through some of the source for LibreOffice to kinda understand how the files are converted and everything. But now I think I would be using my time better doing something else. Oh well.

So just opened Twitter at work to see Dark souls remastered is a thing... Instantly though "here we go, a $100 rerelease capped at 30FPS on console, oh well still getting it", went to EB games and read the description for the Xbox edition, running at 60FPS and for $60 AUD.... Dear all AAA developers...

THIS IS HOW YOU DO A REMASTER!!!!

Up the frame rate to 60 if previously capped at 30, upgrade textures and charge a reasonable amount for it!

Well done Bandai!

Why is school such a bullfuck, we've learned SQL basics and I've used SQL a little so I thought I won't have a problem. WELL FUCKING HELL WAS I WRONG. Joining 4 tables together with inner join WTF who the fuck uses that, why the fuck do I need to know this, WHY THE FUCK IN A TEST WHEN WE HAVEN'T LEARNED SUCH BULLSHIT. Well how about adding a foreign key to a table that doesnt need one. Well ok have fun with a key that does absolutely nothing and on top of all those convoluted tasks the texts are a mess, they give unnecessary information with grammar of a 9 year old and the pictures are not even readable. They are fucking hieroglyphs.
Fuck school.
Gonna do it by myself at the end anyway.
Fuck everything.

Fuck windows!

Now that I have your attention. My problem is with "IAR embedded workbench", not so much with windows but I'll get to that.
I've used that IDE for a few years.. 2 years ago. Since then I apparently forgot how to even create a project from scratch with adding all the necessary libraries and all that.

My initial deal with a client was to give them a solution using whatever tools I deem necessary. As I recently moved to linux and IAR is not available for that os.. and I also enjoyed working with CLion and PyCharm which Are available I decide to use CLion to write my C project.
A problem was that to compile code for microcontrollers I need tools unsupported by CLion.. oh well. I can do all the compilation and uploading of the code through terminal .. so I make a bash script that does it all. Super convenient. Development is going well and all.. until they ask me for the project.

I sent them the project so that they can see my progress. They can't do shit with what I gave them because they don't even have make on their machines let alone the compiler. All they have is IAR. But the guy that wants to see the code is not really a programmer.. he is a hardware specialist so I can't expect him to do anything more than use what he knows. He doesn't need or want to learn more right now.

So I go to windows and start porting my code to an IAR project and 2 days later I am still stuck with it. FUCK. Not only was the installation process horrible but the tools I wanted to install additionally did not work as promised either.

I know it took me about 2 days to setup all I needed on linux but I was enjoying it every step of the way. While this garbage is frustrating me so much. The fact that I used to do it before adds to the pain.

I am this close to telling them to just look at my code in notepad and I can setup a vm for them in which they can compile it if they really really need to.

If they just told me from the very start that they want me to work with IAR that would have been fine. I would have never seen the easier way and would have gladly figure it out then. Not now.

No matter the hard work you want to do, how much time you want and really spend to complete something, always a scumbag project manager will set the dates so that you won't make it in f*ing time!! Really now, it is frustrating!!

Well, I moved to a new company and all seems vanilla. But you know. Now I have this lesson to remind myself.

My paper just got rejected. Again. The first time it was expected. But for this journal, it wasn't supposed to be. Some of the reviewers' comments are stupid. (for eg. I mention a no-loss algorithm fir a game which, so his/her comment is like what's no-loss? , like are you fucking kidding me, if you don't know that, then why are you a reviewer in the first place)

Anyway now I don't know what to do. I'm looking for more journals but all have so high impact factors and I'm not even sure confident to submit again. Had a good mind to mail the editor in chief but well, I don't think it'd help. What do you guys think?

In the middle of another project, another paper, online courses, now this. I'm just done. I didn't go home as well. It's around four o' clock in the morning here, so noone here is awake.

Can anyone hear me?

I only finished my CS degree last year but while I was a student and after I got my degree I went for a few interviews and none of the companies really asked me what degree I have or didn't ask at all, some just asked what I was studying. All of the companies asked what I can do and what my skills are. If I can do it, they were happy to hire me even if I didn't have a degree.

So to answer the question, a degree is not useful if you still don't know how to program (for example) or if you don't know your field well. If you are good at what you do, you will earn crazy money with or without a degree.

I know a few people that don't have a CS degree but their programming skills are crazy good...probably much better than a uni graduate with a CS degree.

When scrum master/agile coach sais "I know, I used to be a developer myself." ....

Do they think it makes me trust them and drop my point?

Honestly all I think is "well, plenty of bad devs out there, and there's a reason you'r not doing it anymore"

Why!!!
Why must some devs make life complicated!!!!!!

So, here I am enjoying my day (well enjoying the meetings that are taking me away from working) when I get a bug report that script X isn't sending out emails anymore.

Ok that's weird, this as far as I know uses the same email class as every other email being sent out from this project, and they all work.

Let's go have a quick dig...

function sendEmail(){
/*do a bunch of stuff*/
}
Is being used, well that's odd, it should be $emailService->send()
But what ever, it's probably an old wrapper for legacy sake since this script was written years ago. But nope, I almost cried, it's a wrapper for mail() isolated into this script.

Like for fucks sake, why in the hell would this be used when there's an entire fucking class that's tried and tested and only looses 1 email every few months, coz shit happens.

Errrrr.... sometimes i really wonder why people can't just do what they need to do the first time round.

Sometimes I do wonder why can’t I just be content at getting best I can get at what I’m already good at - and what brings in the €€€? Why do I go ”oooh look shiny intetesting language, let’s try do shit with it” or ”hey, let’s try this thing called kernel dev/pld/program verification which are all so far outside my core expertise they might as well be in a different universe!”

Dude I mean writing a kernel in V and doing proof oriented programming in F* are fun and all, but what good’s that gonna do me when I’m in all likelihood still maintaining legacy web apps in PHP ten to twenty years from now?

I guess what I’m trying to say is that I’m torn inside with my current workplace offering me everything I value and stuff that’s rare to find - but at the same time I’d love to be challenged more and don’t really have enough of those opportunities in my current environment. Or some shit like that.

Well fuck that, back to writing my own embedded DSL into F* in F#….

Combatting imposter syndrome is all about being more realistic with yourself imo.

Not in the way you might think. By realistic, I mean you NEED to regularly tell yourself that you are doing your best - especially in the work or areas that can promote insecurities of “not being good enough”. Acknowledge that you are only human, that all of us are different, that all of us make mistakes, and all of us have different interests in life. That, and practice gratitude for your situation. Your interests and decisions lead your different paths, so might as well embrace, enjoy, and love your uniqueness.

That being said, I also think it’s important to do difficult things. I think @wisecrack said it the best in that “real learning feels like falling”. Like the uncertainty of the abyss causes the most anxiety. Next time you feel like you don’t belong, recognize and separate that feeling and reframe it as a symptom to your own self improvement process. Take that risk and do things that are uncomfortable in the pursuit of personal success.

Well, I am not sure whether this is supposed to be about worst experience as a reviewER or a reviewEE so I'ma do both. First as a reviewer.

So, on my first project in this company, I introduced automated build scripting (read: suggested, was "volunteered" to do it, then had to bust my ads to get it done). Prior to this, our process was run the thing in Visual Studio a bunch of times (don't ask) and package the resulting files. Well, new requirements made this not sustainable.

So after many many meetings in which I assured my co-workers that the script wouldn't cock up and go sideways and format our server (HOW???) and showed them how to work it AND added all the features they requested. I finally send the script out for code review. Oh the joy. Questions like: "why did you implement this?" Came from the guy who told me to implement it. "Can you change the formatting?" I checked and no. "Why isn't this to the code standard?" Because the code standard doesn't include scripting languages.

And here is the piece that takes the whole piss soaked shitsicle pie "I don't understand why we're doing this in the first place. We have a build process already, why do we need a new one?" FUCKING REALLY?!?!? YOU WERE IN THE GODS DAMNED MEETING WHERE WE DECIDED TO DO THIS!!! SET OUT THE REQUIREMENTS!!! LITERALLY EVERYTHING TO DO WITH THIS SCRIPT YOU WERE THERE AND YOU'RE ASKING WHY WE'RE DOING IT NOW!?!?! Fucking hell. I forced it through anyway because I had the higher ups all signed off on it, but seriously. Just because we're doing something new that slightly inconveniences you, doesn't mean it doesn't need to be done. Stop being afraid of change.

Side note: these people actually would regularly hold up process and product improvement because change is scary.

All these companies not going the full 100% remote and requiring one day in the office, would it kill them to do 100% remote? My current role is fully remote and were spread through many timezones and still manage to work well, why don't companies see this and give an option atleast to be fully remote for developers?

Well payed co-worker is always crying about others salary being more than his...Fucking hate that guy. Remember he is just a fresher and is being paid way more than he fucking deserves. Today he exploited someone to gain access of other co-worker's pay scale information and kept obsessing over it all day long...!
Fucking prick is going to get away with it...And I can't do anything about it...!!!

Ok, so I have been lurking around here for a while now. Not at all knowing what to rant about. I like my work, I don't have to deal too much with annoying (or almost any at all) customers and all in all I feel fine.
However, I feel like I want to, in some way step into this awesome community in other ways than just comments and ++.

So this post will be about a book. It's almost our Bible. Well it's probably the closest thing to a proper part of the trilogy we will get.
And for not being written by Douglas Adams (the almighty) himself; this book is surprisingly good! If you haven't, and get your hands on it, do read it!

Remember how I gushed about one note?

Well I purchased a new laptop today.

Load it up, log in to fucking windows 10.

What do I find in one note?

All my notes from my previous PC.

What did I explicitly fucking disable on my other PC?

Sharing and syncing.

What has obviously been shared and synced anyway, completely ignoring my settings?

My fucking notes in onenote, including some very personal notes on my health and life.

Can anyone else confirm they had the same problem?

I'm interested in pursuing legal action for this bullshit.

Progress on my sudoku application goes well. Damn, what is javascript fantastic. While the code of the previous version that I posted here was alright I did decide that i want to split code and html elements after all. I have now a puzzle class doing all resolving / validating and when a field is selected or changed, it emits an event where the html elements are listening to. It also keeps all states. So, that's the model. puzzle.get(0,1).value = 4 triggers an update event. It also tracks selection of users because users selecting fields is part of the game. I can render full featured widgets with a one liner. Dark mode and light mode are supported and size is completely configurable by changing font-size and optional padding. So far, painless. BUT: i did encounter some stuff that works under a CSS class, but not if I do element.style.* =. Made me crazy because I didn't expect that.

I hate extremist to the point where I became an extremist of hating the extremist.

If life is as simple as 1 and 0, we won't even be fucking evolved and alive till this far.

Every story has different perspectives. Different motives. Is it Kingslayer the one to blame? Is it the Queen's fault? Or was it Little Finger?

We look at one piece of the puzzle and we talk and talk and talk. Well not only do we like to talk our own thoughts out loud, we like to persuade others to join our thoughts. Just like what I'm doing now.

Does this all sound simple as 1 and 0?

I really resent people who reduce the occupation to tickets. Our world is just tickets, tickets all the way down.

"well the ticket just says this, but that's vague, so what should I do?"

You either ask for clarification, or you get creative with the blank canvas you were handed.

"well that edge case wasn't called out in the ticket's specs"

this is _why_ we do TDD - to design our code to be able to function as expected for ALL cases

"is there a ticket to refactor that?"

what?! no, it's your job to always leave code better than when you found it (within scope/reason of course)

FFS we are not hired to be code monkeys or glorified typists. There should be joy that comes from getting to be more clever than the average bear and to solve problems and improve things with your code and logic.

shit bums me out.

!rant

Guys, Im curious, what you would say about situation if you are in need of some quite simple tool and you write it but becouse you need it today, not tommorow, you just dont give a heck about all the fancy stuff and (lets say for php) you start to write all in 2-3 files like you was back beginner?

Or you just nope out of situation?
Do you refactor that when you bored just becouse this cant be on my disk, noone can see this abomination?
Or you delete after usage (only to relaize 5 minutes latter you need it back :P )

Im curious your opinion.

PS.
nope, if you came to bitch about any of opinions even opinion "well, i wouldnt give a fuck and just not do it", go away and get lost.

E: typo