Yesterday: Senior dev messages out a screenshot of someone using an extension method I wrote (he didn’t know I wrote it)..

SeniorDev: “OMG…that has to be the stupidest thing I ever saw.”
Me: “Stupid? Why?”
SeniorDev: “Why are they having to check the value from the database to see if it’s DBNull and if it is, return null. The database value is already null. So stupid.”
Me: “DBNull is not null, it has a value. When you call the .ToString, it returns an empty string.”
SeniorDev: ”No it doesn’t, it returns null.”
<oh no he didn’t….the smack down begins>
Me: “Really? Are you sure?”
SeniorDev: “Yes! And if the developer bothered to write any unit tests, he would have known.”
Me: “Unit tests? Why do you assume there aren’t any unit tests? Did you look?”
<at this moment, couple other devs take off their head phones and turn around>
SeniorDev:”Well…uh…I just assumed there aren’t because this is an obvious use case. If there was a test, it would have failed.”
Me: “Well, let’s take a look..”
<open up the test project…navigate to the specific use case>
Me: “Yep, there it is. DBNull.Value.ToString does not return a Null value.”
SeniorDev: “Huh? Must be a new feature of C#. Anyway, if the developers wrote their code correctly, they wouldn’t have to use those extension methods. It’s a mess.”
<trying really hard not drop the F-Bomb or two>
Me: “Couple of years ago the DBAs changed the data access standard so any nullable values would always default to null. So no empty strings, zeros, negative values to indicate a non-value. Downside was now the developers couldn’t assume the value returned the expected data type. What they ended up writing was a lot of code to check the value if it was DBNull. Lots of variations of ‘if …’ , ternary operators, some creative lamda expressions, which led to unexpected behavior in the user interface. Developers blamed the DBAs, DBAs blamed the developers. Remember, Tom and DBA-Sam almost got into a fist fight over it.”
SeniorDev: “Oh…yea…but that’s a management problem, not a programming problem.”
Me: “Probably, but since the developers starting using the extension methods, bug tickets related to mis-matched data has nearly disappeared. When was the last time you saw DBA-Sam complain about the developers?”
SeniorDev: “I guess not for a while, but it’s still no excuse.”
Me: “Excuse? Excuse for what?”
<couple of awkward seconds of silence>
SeniorDev: “Hey, did you guys see the video of the guy punching the kangaroo? It’s hilarious…here, check this out.. ”

Pin shoulders the mat…1 2 3….I win.

Sit down before you read this.

So I interviewed a guy for a "Support Engineer" internship position.

Me and the team lead sit down and are waiting for him to enter, but apparently he's actually making a coffee in the kitchen.

This isn't exactly a strike since the receptionist told him that he can go get a drink, and we did too. It's just always expected for him to get a glass of water, not waste 3 minutes brewing a coffee.

In any case he comes in, puts the coffee on the table, then his phone, then his wallet, then his keys and then sits on our side of the table.
I ask him to sit in front of us so we can see him. He takes a minute to pack and tranfer himself to the other side of the table. He again places all of the objects on the table.

We begin, team lead tells him about the company. Then I ask him whether he got any questions regarding the job, the team or the company . For the next 15 minutes he bombards us with mostly irrelevant and sometimes inappropriate questions, like:
0: Can I choose my own nickname when getting an email address?
1: Does the entire department get same salaries?
2: Are there yoga classes on Sundays only or every morning?
3: Will I get a car?
4: Does the firm support workspace equality? How many chicks are in the team?
5: I want the newest grey Mac.

And then.. Then the questions turn into demands:
6: I need a high salary (asks for 2.5 more than the job pays. Which is still a lot).
I ask him why would he get that at his first job in the industry (remind you, this is an internship and we are a relatively high paying company).
He says he's getting paid more at his current job.
His CV lists no current job and only indicates that he just finished studying.
He says that he's working at his parent's business...
Next he says that he is very talented and has to be promoted very quickly and that we need to teach him a lot and finance his courses.

At this point me and the team lead were barely holding our laughs.

The team lead asks him about his English (English is not our native language).
He replies "It's good, trust me".
Team lead invites him for an English conversation. Team lead acts like a customer with a broken internet and the guy is there to troubleshoot. (btw that's not job related, just a simple scenario)
TL: "Hello, my name is Andrew, I'm calli..."
Guy: *interrupts* "Yes, yes, hi! Hi! What do you want?"
TL: "Well, if you let me fi..."
Guy: "Ok! Talk!"
TL: "...inish... My internet is not working."
Guy: "Ok, *mimics tuning a V engine or cooking a soup* I fixed! *points at TL* now you say 'yes you fixed'".

Important to note that his English was horrible. Disregarding the accent he just genuinely does not know the language well.

Then he continiues with "See? Good English. Told you no need to check!".

After about half a minute of choking on out silent laughter I ask him how much Python experience he has (job lists a requirement of at least 1 year).
He replies "I'm very good at object oriented functional programming".
I ask again "But what is your experience? Did you ever take any courses? Do you have a git repository to show? Any side.."
*he interrupts again* "I only use Matlab!".

Team lead stands up and proceeds to shake his hand while saying "we will get back to you".

At last the guy says with a stupid smile on his face "You better hire me! Call me back tomorrow." Leaves TL hanging and walks away after packing his stuff into the pockets.

I was so shocked that I wasn't even angry.
We both laughed for the rest of the day though. It was probably the weirdest interview I took part at.

The first time I realized I wasn't as good as I thought I was when I met the smartest dev I've ever known (to this day).

I was hired to manage his team but was just immediately floored by the sheer knowledge and skills this guy displayed.

I started to wonder why they hired outside of the team instead of promoting him when I found that he just didn't mesh well with others.

He was very blunt about everything he says. Especially when it comes to code reviews. Man, he did /not/ mince words. And, of course, everyone took this as him just being an asshole.

But being an expert asshole myself, I could tell he wasn't really trying to be one and he was just quirky. He was really good and I really liked hanging out with him. I learned A LOT of things.

Can you imagine coming into a lead position, with years of experience in the role backing your confidence and then be told that your code is bad and then, systematically, very precisely, and very clearly be told why? That shit is humbling.

But it was the good kind of humbling, you know? I really liked that I had someone who could actually teach me new things.

So we hung out a lot and later on I got to meet his daughter and wife who told me that he had slight autism which is why he talked the way he did. He simply doesn't know how to talk any other way.

I explained it to the rest of the team (after getting permission) and once they understood that they started to take his criticism more seriously. He also started to learn to be less harsh with his words.

We developed some really nice friendships and our team was becoming a little family.

Year and a half later I had to leave the company for personal reasons. But before I did I convinced our boss to get him to replace me. The team was behind him now and he easily handled it like a pro.

That was 5 years ago. I moved out of the city, moved back, and got a job at another company.

Four months ago, he called me up and said he had three reasons for us to meet up.

1. He was making me god father of his new baby boy
2. That they created a new position for him at the company; VP of Engineering
and
3. He wanted to hang out

So we did and turns out he had a 4th reason; He had a nice job offer for me.

I'm telling this story now because I wanted to remind everyone of the lesson that every mainstream anime tells us:

Never underestimate the power of friendship.

Hi, I am a Javascript apprentice. Can you help me with my project?

- Sure! What do you need?

Oh, it’s very simple, I just want to make a static webpage that shows a clock with the real time.

- Wait, why static? Why not dynamic?

I don’t know, I guess it’ll be easier.

- Well, maybe, but that’s boring, and if that’s boring you are not going to put in time, and if you’re not going to put in time, it’s going to be harder; so it’s better to start with something harder in order to make it easier.

You know that doesn’t make sense right?

- When you learn Javascript you’ll get it.

Okay, so I want to parse this date first to make the clock be universal for all the regions.

- You’re not going to do that by yourself right? You know what they say, don’t repeat yourself!

But it’s just two lines.

- Don’t reinvent the wheel!

Literally, Javascript has a built in library for t...

- One component per file!

I’m lost.

- It happens, and you’ll get lost managing your files as well. You should use Webpack or Browserify for managing your modules.

Doesn’t Javascript include that already?

- Yes, but some people still have previous versions of ECMAScript, so it wouldn’t be compatible.

What’s ECMAScript?

- Javascript

Why is it called ECMAScript then?

- It’s called both ways. Anyways, after you install Webpack to manage your modules, you still need a module and dependency manager, such as bower, or node package manager or yarn.

What does that have to do with my page?

- So you can install AngularJS.

What’s AngularJS?

- A Javascript framework that allows you to do complex stuff easily, such as two way data binding!

Oh, that’s great, so if I modify one sentence on a part of the page, it will automatically refresh the other part of the page which is related to the first one and viceversa?

- Exactly! Except two way data binding is not recommended, since you don’t want child components to edit the parent components of your app.

Then why make two way data binding in the first place?

- It’s backed up by Google. You just don’t get it do you?

I have installed AngularJS now, but it seems I have to redefine something called a... directive?

- AngularJS is old now, you should start using Angular, aka Angular 2.

But it’s the same name... wtf! Only 3 minutes have passed since we started talking, how are they in Angular 2 already?

- You mean 3.

2.

- 3.

4?

- 5.

6?

- Exactly.

Okay, I now know Angular 6.0, and use a component based architecture using only a one way data binding, I have read and started using the Design Patterns already described to solve my problem without reinventing the wheel using libraries such as lodash and D3 for a world map visualization of my clock as well as moment to parse the dates correctly. I also used ECMAScript 6 with Babel to secure backwards compatibility.

- That’s good.

Really?

- Yes, except you didn’t concatenate your html into templates that can be under a super Javascript file which can, then, be concatenated along all your Javascript files and finally be minimized in order to reduce latency. And automate all that process using Gulp while testing every single unit of your code using Jasmine or protractor or just the Angular built in unit tester.

I did.

- But did you use TypeScript?

Management : "How long you think it would take?"

Me : "now this is a rough estimate, but I think building the back-end and database alone could take 6-months minimum"

Management : "WHAT ARE YOU TALKING ABOUT? YOU ARE NOT SERIOUS"

me : "its a big proj..."

Management : "I thought it will be something like 10 days, already told the client it can be done"

me : "but we are not ready"

Management : "how are we not ready? we already have the virtual 3D shop, and we can use this ready-to-deploy eCommerce service as our data base "
... "you need to figure this out, this is not acceptable" he continued

* 2 Days Later -talking to my direct boss *
Boss : "since you don't know how to do it..."

me : "what ? I didn't say I can't do it, all I said it will take six months"

Boss : "yeah yeah, anyway there is this studio, a professional polish studio, we called them and they can do it, we will sign a contract with them, this will let you focus on the front-end. good?"

me : "well alright then"

Boss : "please write a doc, explaining everything needed from the backend"
-to me that was the end of it, took a long time to tell me they made the deal-

* 5 Months later *
- "Abdu, can you come here for a minute..."
- "yes boss?"
- "the document we asked you to do for the Polish studio, did you specify that we needed an integration with the API we are using for eCommerce?"

scared to death I answered : "why of course I did!"
I ran to my PC to check it out because I didn't know, I forgot because no one even comment on my doc. I check it out, and it was clearly explained... I got relaxed...

turns out they didn't even do what we asked them for. took them 5 months, and with no communication whatsoever. all their work was useless to us. complete dump waste.

----------------
never mentioned this until a year later... in a heat of moment when they were asking me to make an impossible task with no men and no time... I reminded them of this story... management didn't like it. but it was the truth. they didnt push this crazily this time

So, since I hear from a lot of people (on here and irl) that Linux has a 'very high learning curve', let me share my experiences with the first time my dad touched Linux (Elementary OS) without me interfering at all! (keep in mind that he is very a-technical)

*le me boots the system* (I already did setup a user account for him and gave him the password).

Dad: *enters password and presses enter*
Me: "Hmm that went faster than expected."
Dad: "Uhm I know how to login son, it's not that hard and pretty obvious".
Me: "Alright, why don't you try to open up the default word documents editor on here! I'll be right back!"
Me: *Goes away and returns after a minute*.
Dad: *already a few test sentences typed in LibreOffice writer* it's going pretty well :)!
Me: "Oo how did you find that?!"
Dad: "Well, there's a thingy that says 'applications' so I clicked in and found it in the "Office" section, do you think I am blind or something?!"
Me: 😐. uhm no but I just didn't think you'd find it that quickly. Now try to install Chromium browser! *thinking: he'll fail this one for sure* I'll be right back :).
Me: *returns again after a minute or so*
Dad: *already searching for stuff through Chromium*
Me: "wait, how the hell did you do that so quickly, it's not the easiest thingy for most people".
Dad: "Jesus, it's not that hard! I went to the application browsing thingy, typed 'software' and then a sorta software store icon showed up so I clicked it and it opened a windows with a search bar saying something like 'search for applications/software'. clicked in it, typed 'chromium', saw it coming up, there was a very clear 'install' button, it asked for my password, I put it in and after a little it gave a notification that it was installed. Then I went to that application browsing thingy again and typed Chromium. Then I hit enter because it selected an icon called chromium...."
Me: O.o. Okay this is going very good, now open an email client and login to your email address!
Dad: *goes to application browsing thingy, types 'email', evolution icon shows up, dad clicks it, email address setup steps show up and dad follows them quickly. After about a minute, everything is setup.

I expected this to be a hard process for someone who dealt with Windows his entire life but damn, I underestimated it.
Asked him if he found it easy/what he liked about it:
"Well, it's very clear where I can find everything, default browser/email/word document editor programs are easy to find and that's about all I need so yeah, great system!"

I am proud of you, dad!

wk87 is a dangerous topic for me, i've been through a lot. I apologise for what I am about to inflict on this network over the coming week.

Most incompetent co-worker, candidate 1, "T".

T was an embedded C developer who talked openly about how he's been writing code since he was 14, knew all the C system libraries and functions like the back of his hand. For the most part, he did ... but not how to actually use them, as (based on his shocking ... well everything) he was inflicted by some sort of brain disorder not yet fully understood by medical science. Some highlights:

- Myself and the CTO spent 4 days teaching him what a circle buffer was and how to build one.
- His final circle buffer implementation had about 3 times as much code as he actually needed.
- When the code was running too slowly on the device, we didn't try find any performance improvements, or debug anything to see if there was anything taking too long. No not with T, T immediately blamed TCP for being inefficient.
- After he left we found a file called "TCP-Light" in his projects folder.
- He accused the CTO of having "violent tendencies" because he was playing with a marker tossing it up in the air and catching it.
- He once managed to leave his bank statements, jumper and TROUSERS in the bathroom and didn't realise until a building wide email went out.
- He once .... no hang on, seriously his fucking trousers, how?
- He accused us all of being fascists because we gave out to him for not driving with his glasses, despite the fact his license says he needs to (blind as a bat).

... why were his trousers off in the first place? and how do you forget ... or miss the pile of clothes and letters in a small bathroom.

Moving on, eventually he was fired, but the most depressing thing of all about T, is that he might not even be top of my list.

Tune in later for more practiceSafeHex's most incompetent co-worker!!!

Long rant ahead, but it's worth it.

I used to work with a professor (let's call him Dr. X) and developed a backend + acted as sysadmin for our team's research project. Two semesters ago, they wanted to revamp the front end + do some data visualization, so a girl (let's call her W) joined the team and did all that. We wanted to merge the two sites and host on azure, but due to issues and impeding conferences that require our data to be online, we kept postponing. I graduate this semester and haven't worked with the team for a while, so they have a new guy in charge of the azure server (let's call him H), and yesterday my professor sends me (let's call me M), H and W an email telling us to coordinate to have the merge up on azure in 2-3 days, max. The following convo was what I had with H:

M: Hi, if you just give me access to azure I'll be able to set everything up myself, also I'll need a db set up, and just send me the connection string.
H: Hi, we won't have dbs because that is extra costs involved since we don't have dynamic content. Also I can't give you access, instead push everything on git and set up the site on a test azure server and I will take it from there.
M: There is proprietary data on the site...
H: Oh really? I don't know what's on it.
<and yet he knows we have no dynamic data>
M: Fine, I'll load the data some other way, but I have access to all the data anyway, just talk to Dr. X and you'll see you can give me access. Delete my access after if you want.
H: No, just do what I said: git then upload to test azure account.

Fine, he's a complete tool, but I like Dr. X, so I message W and tell her we have to merge, she tells me that it's not that easy to set it up on github as she's using wordpress. She sends me instructions on what to do, and, lo and behold, there's a db in her solution. Ok, I go back to talking to H:

M: W is using a db. Talk to her so we can figure out whether we need a database or not.
H: We can't use a database because we want to decrease costs.
M: Yes I know that, so talk to her because that probably means she has to re-do some stuff, which might take some time. Also there might be dynamic content in what she's doing.
H: This is your project, you talk to her.
<I'm starting to get mad right now>
M: I don't know what they had her do apart from how it interfaces with what I've done.
H: We still can't have databases.
M: Listen, I don't do wordpress, and I'm not gonna mess with it, you talk to her
H: I won't do any development
<So you won't do any dev, but you won't give me access to do it either?>
M: Man, the bottleneck isn't the merging right now, it's the fact that W needs a db
H: I know, so talk to her
M: THE RESTRICTION TO NOT HAVE DATABASES IS NOT MINE, IT'S YOURS, YOU TALK TO HER. I can't evaluate whether it's a reasonable enough reason or not since I don't know the requirements or what they're willing to spend.
H: It's your project.
M: Then give me fucking access to azure and I'll handle it, you know you'll have to set up wordpress again regardless whether we set it up the first time.
H: Man just do your job.

At this point I lost it. WHAT A FUCKING TOOL. He doesn't wanna do dev work, wants me to go through the trouble of setting up on a test subscription first, and doesn't want to give me access to azure. What's more, he did shit all and doesn't want to anything else. Well fuck you. I googled him, to see if he's anyone important, if he's done anything notable which is why he's being so God damn condescending. MY INTERNSHIP ALONE ECLIPSES HIS ENTIRE CV. Then what the fuck?

There's also this that happened sometime during our talk:

M: You'll have to take to Dr. Y so he'll change the DNS to point to the azure subscription instead of my server.
H: Yea don't worry, too early for that.
M: DNS propagation takes 24 hours...
H: Yea don't worry.

DNS propagation allows the entire web to know that your website is hosted on a different server so it can change where it's pointing to. We have to do this in 2-3 days. Why do work in parallel? Nah let's wait.

I went over his head and talked to the professor directly, and despite wanting to tell him that he was both drunk and high the day he hired that guy, I kept it professional. He hasn't replied yet, but this fucker's pompous attitude is just too much for me alone, so I had to share.

PS: I named his contact as Annoying Prick 4 minutes into our chat. Gonna rename him cz that seems tooooooo soft a name right now.

Frack he did it again.
In a meeting with the department mgr and going over a request feature *we already discussed ad nauseam* that wasn’t technically feasible (do-able, just not worth the effort)

DeptMgr: “I want to see the contents of web site A embedded in web site B”
Me: “I researched that and it’s not possible. I added links to the target APM dashboard instead.”
Dev: “Yes, it’s possible. Just use an IFrame.”
DeptMgr: “I thought so. Next sprint item …what’s wrong?…you look frustrated”
Me: “Um..no…well, I said it’s not possible. I tried it and it doesn’t work”
Dev: “It’s just an IFrame. They are made to display content from another site.”
Me: “Well, yes, from a standard HTML tag, but what you are seeing is rendered HTML from the content manager’s XML. It implemented its own IFrame under the hood. We already talked about it, remember?”
Dev: “Oh, that’s right.”
DeptMgr: “So it’s possible?”
Dev: “Yea, we’ll figure it out.”
Me: “No…wait…figure what out? It doesn’t work.”
Dev: “We can use a powershell script to extract the data from A and port it to B.”
DeptMgr: “Powershell, good…Next sprint item…”
Me: “Powershell what? We discussed not using powershell, remember?”
Dev: “It’s just a script. Not a big deal.”
DeptMgr: “Powershell sounds like a right solution. Can we move on? Next sprint item….are you OK? You look upset”
Me: “No, I don’t particularly care, we already discussed executing a powershell script that would have to cross two network DMZs. Bill from networking already raised his concern about opening another port and didn’t understand why we couldn’t click a link. Then Mike from infrastructure griped about another random powershell script running on his servers just for reporting. He too raised his concern about all this work to save one person one click. Am I the only one who remembers this meeting? I mean, I don’t care, I’ll do whatever you want, but we’ll have to open up the same conversations with Networking again.”
Dev: “That meeting was a long time ago, they might be OK with running powershell scripts”
Me: “A long time ago? It was only two weeks.”
Dev: “Oh yea. Anyway, lets update the board. You’ll implement the powershell script and I’ll …”
Me: “Whoa..no…I’m not implementing anything. We haven’t discussed what this mysterious powershell script is supposed to do and we have to get Mike and Bill involved. Their whole team is involved in the migration project right now, so we won’t see them come out into the daylight until next week.”
DevMgr: “What if you talk to Eric? He knows powershell. OK…next sprint item..”
Me: “Eric is the one who organized the meeting two weeks ago, remember? He didn’t want powershell scripts hitting his APM servers. Am I the only one who remembers any of this?”
Dev: “I’m pretty good with powershell, I’ll figure it out.”
DevMgr: “Good…now can we move on?”

GAAAHH! I WANT A FLAMETHROWER!!!

Ok…feel better, thanks DevRant.

Me: *Applies for entry level full-stack job*

Recruiter: "Sorry, I can't hire you because you don't have the years of experience we're looking for. We can take you on as an intern! Unpaid of course, while we train you."🙂

Clueless Me: "Sure, why not."

*second day into the internship*

Boss: "I have this really big project, and I want you to be the lead. I'm going to be very vague about what I want, so you'll constantly have to make changes to user stories, wireframes, & database designs until I'm satisfied. Don't ask me any questions for clarity, because I'm busy 🙂"

Silly Me: "okay"

Boss: "Also, can you train all the other interns? You're so lucky! You'll get to pick the best to join your team" 🙂

Stupid Me: "okay"

Boss: *emails me a spreadsheet of 80 Front-End interns (freshmen and sophomores)*
"Did you start building the app yet?" 🙂

Me (Dummy): "You haven't approved the final wireframes ye-"

Boss: "And for the other interns' training, what did you have in mind?" 🙂

Me (Dumbass): "I made a training guide, they're already followi-"

Boss: "My project manager for this other project left, guess he couldn't handle the pressure of a real job... HAHAHAHA! You're gonna take the lead of that project, too!"
*Adds me to the slack group* 😁

Me (Imbecile): "Wha-"

Boss: "And we've been having trouble with keeping track of everyone's code. Is there something we can do instead of slacking code snippets back and forth?" 🤔😮

Me (Fucking Imbecile): "Wait, you guys are working on a project and you don't have any form of version control? Maybe we should take a few steps back and plan thi-"

Boss: "Are you gonna take initiative or not!?" 😡

Me (Enlightened): "I quit." 😑

Former Boss: "Too bad... I was going to offer you a paid role tomorrow morning. Oh well!" 😔

I think I'm losing my mind working in the IT Department. 😂 Sometimes the questions are UNBELIEVABLE!

Client: Hi, my computer is not working.

Me: Hi, what's wrong with it?

Client: IDK. It won't work.

Me: Alright, what do you see on your screen?

Client: Nothing!

Me: Nothing as in there are no icons on your desktop or black screen?

Client: Oh, black screen.

Me: Is your monitor on? Do you see a light on the power-on button?

Client: Yes, it's white.

Me: Ok, good. What about your computer? Is it turned on?

Client: Well, I never turn off my computer so I assume it's on. I leave it as is when I leave the office then log-in in the morning when I come in.

**At this point I realized this person doesn't even lock the computer until it locks by itself after a while.

Me: Ok please turn on your computer by pressing the power button with a thin line on it. It should turn white.

Client: Ok but as I said I don't turn it off so why should I turn it on? Did it turn off by itself?

Me: That can happen.

Client: Ok....oh wait, it working! Thank you so much. Sorry if I was a little pain. I am a little stressed out this morning.

Me: No problem. Glad it worked. Have a good day.

*Hangs up confused. I mean really confused. Smh

You know what?

Young cocky React devs can suck my old fuckin LAMP and Objective-C balls.

Got a new freelance job and got brought in to triage a React Native iOS/Android app. Lead dev's first comment to me is: "Bro, have you ever used React Native".

To which I had to reply to save my honor publicly, "No, but I have like 8 years with Objective-C and 3 years with Swift, and 3 years with Node, so I maybe I'll still be able help. Sometimes it just helps to have a fresh set of eyes."

"Well, nobody but me can work on this code."

And that, as it turned out was almost true.

After going back and forth with our PM and this dev I finally get his code base.

"Just run "npm install" he says".

Like no fuckin shit junior... lets see if that will actually work.

Node 14... nope whole project dies.

Node 12 LTS... nope whole project dies.

Install all of react native globally because fuck it, try again... still dies.

Node 10 LTS... project installs but still won't run or build complaining about some conflict with React Native libraries and Cocoa pods.

Go back to my PM... "Um, this project won't work on any version of Node newer than about 5 years old... and even if it did it still won't build, and even if it would build it still runs like shit. And even if we fix all of that Apple might still tell us to fuck off because it's React Native.

Spend like a week in npm and node hell just trying to fucking hand install enough dependencies to unfuck this turds project.

All the while the original dev is still trying TO FIX HIS OWN FUCKING CODE while also being a cocky ass the entire time. Now, I can appreciate a cocky dev... I was horrendously cocky in my younger days and have only gotten marginally better with age. But if you're gonna be cocky, you also have to be good at it. And this guy was not.

Lo, we're not done. OG Dev comes down with "Corona Virus"... I put this in quotes because the dude ends up drawing out his "virus" for over 4 months before finally putting us in touch with "another dev team he sometimes uses".

Next, me and my PM get on a MS Teams call with this Indian house. No problems there, I've worked with the Indians before... but... these are guys are not good. They're talking about how they've already built the iOS build... but then I ask them what they did to sort out the ReactNative/Cocoa Pods conflict and they have no idea what I'm talking about.

Why?

Well, one of these suckers sends a link to some repo and I find out why. When he sends the link it exposes his email...

This Indian dude's emails was our-devs-name@gmail.com...

We'd been played.

Company sued the shit out of the OG dev and the Indian company he was selling off his work to.

I rewrote the app in Swift.

So, lets review... the React dev fucked up his own project so bad even he couldn't fix it... had to get a team of Indians to help who also couldn't fix it... was still a dickhead to me when I couldn't fix it... and in the end it was all so broken we had to just do a rewrite.

None of you get npm. None of you get React. None of you get that doing the web the way Mark Zucherberg does it just makes you a choad locked into that ecosystem. None of you can fix your own damn projects when one of the 6,000 dependency developers pushes breaking changes. None of you ever even bother with "npm audit fix" because if security was a concern you'd be using a server side language for fucking server side programming like a grown up.

So, next time a senior dev with 20 years exp. gets brought in to help triage a project that you yourself fucked up... Remember that the new thing you know and think makes you cool? It's not new and it's not cool. It's just JavaScript on the server so you script kiddies never have to learn anything but JavaScript... which makes you inarguably worse programmers.

And, MF, I was literally writing javascript while you were sucking your mommas titties so just chill... this shit ain't new and I've got a dozen of my own Node daemons running right now... difference is?

Mine are still working.

Client: "This has been broken for weeks! Why is it still broken!?!?"

Me: "Did you tell anyone it was broken?"

Client: "Well...um...no..."

I may be good at my job, but I have not been able to (nor do I want to) develop mind-reading abilities. Now please fuck off (so that I can go fix it).

Linux sucks.

Now now, chill. I'm using it as my main OS for a few years now. I know what I'm talking and this title is a bit click-baity, but this just has to go out there:

1. It's usable as a Windows replacement just fine - FALSE. XFCE4 is years old and buggy as hell especially on multi-monitor set-up, Gnome3 gets stuck more often than my Windows 98 machine used to, KDE is like a rich kid on meth. Plug in Bluetooth headphones? Well no, sorry, you have to research that online, since you'll probably need to install some packages for it to work. Did I say "work"? Well no, because after more research you realize that Debian on Gnome3 on gdm3 launches pulseaudio on its own, so you have 2 instances of pulseaudio, and one of them is stealing your headphones sometimes and you either have no sound or shitty sound. How do I know that you ask? The same way I know everything else - every time you try to do something new on any Linux, it involves a ton of research. Exciting research, don't get me wrong, but at this point it looks more like a toy than a reliable desktop computer operating system.

2. And why am I using pulseaudio? Why not alsa? years ago people were discussing on forums that pulseaudio is old and dead, yet here we are with new LTS release of Ubuntu still shining with Pulseaudio. How about several different service management systems being deprecated by new ones, each having different configurations and calling methods? Apparently systemd is old and lame now. It's a mix of 10 year old software that works badly, with a 5 year old replacement that works worse, somehow trying to live under the same roof. Does it work? Ask my headphones who sound like a fucking dial-up modem.

3. Let's talk about displays, shall we? xorg is old and deprecated, right? We got Wayland that's mostly stable. Don't know what that is? That's just basic knowledge for Linux. And when you try to install network-manager, it also tries to install Mir toolkits. Because why the fuck not install 3 display managers when you want a network manager, of which one is old and dying, one is young and stupid, and another is an infant that died of cancer?

4. Want to integrate with Google Drive? Yeah, there's a tool that mounts the drive as a local directory. Yeah only for Ubuntu. Want it on Debian? You need to compile it. Oh wait, it's on Ocaml, because fuck mainstream languages, we're hipsters. How do you compile Ocaml? Well you need to have Ocaml on your system, dummy. How do you do that? Well you need to compile Ocaml. Ok, how do I do that? Well, git clone, download and install some dependencies, configure, make... oh sorry, you're using libssl1.0.2g when you need libssl1.0.1f, nope, sorry, won't work. Want to install libssl1.0.1f? Why? You already have the "g", stupid! Want to remove libssl1.0.2g? Bye-bye literally everything that you have on your PC. But at least you got the "f". Does it work now? Well no, because you need libssl1.0.2g for another dependency to work.
And all I ever wanted was to get a fucking document from google drive (not nudes, I promise).

5. Want to watch a movie? Let me tear that screen in half and make the bottom half late by a couple of frames, because who needs vertical sync, right? Oh you do? Well install the native drivers maybe. Oh you have? Welcome to eternal Boot to Recovery mode, motherfucka!

---------------------------------

Yeah, most of the times things work just fine. But the reason I know what those things are and how they work is not curiosity. The reason that I know the inner workings of Linux much better than the inner workings of Windows, is because in those few years that I've been using it full time, it has caused me 10 times more headache than I have ever experienced with other systems. And it's not the usual annoyances like "OMG it rebooted when I didn't ask it to", but more like "Oh, it won't work and I need 2 days to find out why" kind of stuff, because even if you experience the same thing again, it's always caused by some new shit and the old solution won't work any more.

I still love it, and will continue to use it. I don't know why really. Maybe because I'm not afraid of fucking it up any more? Maybe because I can do what I want in it and recovering will be easier than on Windows?
It's a toy for me, after all these years. And I also use it for professional reasons.

But whenever someone presents it as a better alternative to Windows, I just want to puke.

The way 90% of the population wears their face masks really explains a lot about their approach to using software, apps & websites as well.

I feel like giving up.

I am not a developer for the salary, or just to solve analytical puzzles. Those are motivators, but my main drive is to make the world more comfortable and enjoyable, better optimized, build ethical services which bring happiness into people's lives. I want to improve society, even if it's just a tiny bit.

But if users invest absolutely zero percent of their limited brain capacity into understanding a product that already has a super-clean design and responds with helpful validation messages...

...why the fuck bother.

I used to think of the gap between technology and tech-incompetent people as an optimization problem.

As something which could be fixed by spending a fortune on UX research. Write tests, hire QA employees, decrease tech debt, create a bold but unified & simple design.

But the technologically incompetent just get more entitled with every small thing you simplify.

It's never fucking fool-proof enough.

Why can't I upload a 220MB PDF as profile picture? Why doesn't the app install on my 9 year old Android Froyo phone? Why can't I sign up if my phone number contains a  U+FFFC? Why does this page load so slowly from my rural concrete bunker in East Ukraine? WHY DO I HAVE PNEUMONIA, HOW DID I GET INFECTED EVEN THOUGH I WAS WEARING A MOUTH MASK ON MY FOREHEAD?

This is why I ran away from Frontend, to Backend, to DBA.

If I could remove myself further from the end user, I would.

At least I still have a full glass of tawny port and a huge database which needs to be normalized & migrated.

Fuck humans, I'm going to hug a server.

I am an indie game developer and I lead a team of 5 trusted individuals. After our latest release, we bought a larger office and decided to expand our team so that we could implement more features in our games and release it in a desirable time period. So I asked everyone to look for individuals that they would like to hire for their respective departments. When the whole list was prepared, I sent out a bunch of job offers for a "training trial period". The idea was that everyone would teach the newbies in their department about how we do stuff and then after a month select those who seem to be the best. Our original team was
-Two coders
-One sound guy(because musician is too mainstream)
-Two artists
I did coding, concept art(and character drawings) and story design, So, I decided to be a "coding mentor"(?).
We planned to recruit
-Two coders
-One sound guy
-One artist (two if we encountered a great artstyle)
When the day finally arrived I decided to hide the fact that I am the founder and decided that there would be a phantom boss so that they wouldn't get stressed or try flattery.
So out of 7, 5 people people came for the "coding trial session". There were 3 guys and 2 girls. My teammate and I started by giving them a brief introduction to the working of our engine and then gave them a few exercises to help them understand it better. Fast forward a few days, and we were teaching them about how we implement multiple languages in our games using Excel. The original text in English is written in the first column and we then send it to translators so that they can easily compare and translate the content side by side such that a column is reserved for each language. We then break it down and convert the whole thing into an engine friendly CSV kind of format. When we concluded, we asked them if they had any questions. So there was this smartass, who could not get over the fact that we were using Excel. The conversation went like this:(almost word to word)

Smartass: "Why would you even use that primitive software? How stupid is that? Why don't you get some skills before teaching us about your shit logic?"
Me:*triggered* "Oh yeah? Well that's how we do stuff here. If you don't like it, you can simply leave."
Smartass: "You don't know who I am, do you? I am friends with the boss of this company. If I wanted I could have all of you fired at whim."
Me:"Oh, is that right?"
Smartass:"Damn right it is. Now that you know who I am, you better treat me with some respect."
Me: "What if I told you that I am not just a coder?"
Smartass:"Considering your lack of skills, I assume that you are also a janitor? What was he thinking? Hiring people like you, he must have been desperate."
Me:"What if I told you that I am the boss?"
Smartass:"Hah! You wish you were."*looks towards my teammate while pointing a thumb at me* "Calling himself the boss, who does he think he is?"
Teammate:*looks away*.
Smartass:*glances back and forth between me and my teammate while looking confused* *realizes* *starts sweating profusely* *looks at me with horror*
Me:"Ha ha ha hah, get out"
Smartass:*stands dumbfounded*
Me:"I said, get out"
Smartass:*gathers his stuff and leaves the room*
Me: "Alright, any questions?"*Smiling angrily*
Newcomers: *shake heads furiously*
Me:"Good"

For the rest of the day nobody tried to bother me. I decided to stop posing as an employee and teaching the newcomers so that I could secretly observe all sessions that took place from now on for events like these. That guy never came back. The good news however, is that the art and music training was going pretty well.

What really intrigues me though is that why do I keep getting caught with these annoying people? It's like I am working in customer support or something.

At the beginning of an interview...

HR girl: You know, that position you applied is already taken but I found some similar in our company.
Me: Uhm, ok?
HRG: What about this one? It's some programming... *pointing at some IT position regarding db maintenance* Do you want to try that?
Me: Sure, why not.

I was applying to student position at embedded firmware development at the time. I did some school project with MySQL but it was few years back and I happily forgot most about it.
Anyway, story continues.

IT manager: Hi, I heard you want to join our lines.
Me: That is what I heard as well.
IT: Eh?
Me: I came for completely different position actually.
IT: Uhm, ok. We have standardised test, let's see what you can do.

It was some basic stuff for db guys but I was totally lost. I was done after 3 minutes returning nearly blank paper.
We shaked hands, both agreed this is not well fit for me and I went away.

After this botched attempt HR girl remembered that there is another team looking for embedded developer students. I was accepted.

Corporates are marvelous.

A wild Darwin Award nominee appears.

Background: Admins report that a legacy nightly update process isn't working. Ticket actually states problem is obviously in "the codes."

Scene: Meeting with about 20 people to triage the issue (blamestorming)

"Senior" Admin: "update process not working, the file is not present"
Moi: "which file?"
SAdmin: "file that is in ticket, EPN-1003"
Moi: "..." *grumbles, plans murder, opens ticket*
...
Moi: "The config dotfile is missing?"
SAdmin: "Yes, file no there. Can you fix?"
Moi: "Engineers don't have access to the production system. Please share your screen"
SAdmin: "ok"
*time passes, screen appears*
Moi: "ls the configuration dir"
SAdmin: *fails in bash* > ls

*computer prints*
> ls
_.legacyjobrc

Moi: *sees issues, blood pressure rises* "Please run list all long"
SAdmin: *fails in bash, again* > ls ?
Moi: *shakes* "ls -la"
SAdmin: *shonorable mention* > ls -la

*computer prints*
> ls -la
total 1300
drwxrwxrwx- 18 SAdmin {Today} -- _.legacyjobrc

Moi: "Why did you rename the config file?"
SAdmin: "Nothing changed"
Moi: "... are you sure?"
SAdmin: "No, changed nothing."
Moi: "Is the job running as your account for some reason?"
SAdmin: "No, job is root"
Moi: *shares screenshot of previous ls* This suggests your account was likely used to rename the dotfile, did you share your account with anyone?
SAdmin: "No, I rename file because could not see"
Moi: *heavy seething* so, just to make sure I understand, you renamed a dotfile because you couldn't see it in the terminal with ls?
SAdmin: "No, I rename file because it was not visible, now is visible"
Moi: "and then you filed a ticket because the application stopped working after you renamed the configuration file? You didn't think there might be a correlation between those two things?"
SAdmin: "yes, it no work"
Interjecting Director: "How did no one catch this? Why were there no checks, and why is there no user interface to configure this application? When I was writing applications I cared about quality"
Moi: *heavy seething*
IDjit: "Well? Anyone? How are we going to fix this"
Moi: "The administrative team will need to rename the file back to its original name"
IDjit: "can't the engineering team do this?!"
Moi: "We could, but it's corporate policy that we have no access to those environments"
IDjit: "Ok, what caused this issue in the first place? How did it get this way?!"

TFW you think you've hit the bottom of idiocy barrel, and the director says, "hold my mango lassi."

Here's a recent interview I had for an Android Developer job:
I: Interviewer, M: Me

I: hello, welcome
M: hi, thanks

I: do you know Kotlin?
M: yes, I've been working with it for 1.5 years and have written 3 projects in it

I: do you know RxJava, Dagger, Retrofit, and how to make Custom Views?
M: yes, I'm comfortable with them *explains*

I: do you know Room?
M: yes I do, I've done a lot of practices in it, but unfortunately have never needed to use it in production

I: what architecture do you use? Do you know MVP?
M: I'm currently using MVVM, but not MVP. I've debugged projects in it so I know what's going on in it

I: ok, do you have any questions for us?
M: how did I do?

I: I'm sorry sir, but you're not even a junior here
M: what? Why is that?

I: well you don't know Room and MVP?
M: I said I know them, just haven't used them in production.

I: well you have 3 years of experience but you dont even know Kotlin!
M: Kotlin was your first question and I said I have 3 projects in it. Did you even check the samples you asked for in the job posting?

I: SIR YOU'RE NOT A GOOD FIT FOR US, THANK YOU FOR COMING.

:/

*Facebook Hackers follow the Rules*
(real story)

TL;DR: sorry, not available, can't do spoilers

One night I was with a group of friends out at a pub. A guy and his girlfriend show up, I didn't know them but they were my friend's friends.

The girl kept bragging the whole time about his boyfriend being a professional programmer, trying to remind it to everybody whenever possible (don't ask me why!).

So, after a while, the discussion moves towards "suspect Facebook activities" and the guy starts saying that he can hack Facebook.

- "What do you mean?", I ask.
- "Hacking into other people's accounts, even with 2 factor authentication. I did it a lot of times"
- "Wait, and they don't notice?"
- "Of course not! ^_^ He's a hacker", the girl replies.

Ok, time to do a coming out.

- "Hey, I'm a developer myself. Can you give me an idea of what you did in technical terms? Did you find a vulnerability? Used a virus? Maybe a keylogger?"
- "No... Uh... Well... The secret is to read the terms of service"
- "What?"
- "Yes... yes it's all in the facebook terms of service..."
- "Uhm, I'm not really sure I'm following. Could you prove it by hacking my Facebook account? I'm giving you the permission".

In less than a minute the discussion flew completely away and they never mentioned computers again.

😂😂

Client: Can you provide some kind of guaranteed timeline that you're going to be able to move our website to our new servers with the optimizations implemented? I know you said it should take a week, but we have 3 weeks to get this moved over and we cannot afford to be double billed. I'm waiting to fire up the new server until you can confirm.

Me: As I said, it SHOULD take about a week, but that's factoring in ONLY the modifications being made for optimization and a QA call to review the website. This does not account for your hosting provider needing to spin up a new server.

We also never offered to move your website over to said new server. I sent detailed instructions for your provider to move a copy of the entire website over and have it configured and ready to point your domain over to, in order to save time and money since your provider won't give us the access necessary to perform a server-to-server transfer. If you are implying that I need to move the website over myself, you will be billed for that migration, however long it takes.

Client: So you're telling me that we paid $950 for 10 hours of work and that DOESN'T include making the changes live?

Me: Why would you think that the 10 hours that we're logged for the process of optimizing your website include additional time that has not been measured? When you build out a custom product for a customer, do you eat the shipping charges to deliver it? That is a rhetorical question of course, because I know you charge for shipping as well. My point is that we charge for delivery just as you do, because it requires our time and manpower.

All of this could have been avoided, but you are the one that enforced the strict requirement that we cannot take the website down for even 1 hour during off-peak times to incorporate the changes we made on our testbed, so we're having to go through this circus in order to deliver the work we performed.

I'm not going to give you a guarantee of any kind because there are too many factors that are not within our control, and we're not going to trap ourselves so you have a scapegoat to throw under the bus if your boss looks to you for accountability. I will reiterate that we estimate it would take about a week to implement, test and run through a full QA together, as we have other clients within our queue and our time must be appropriately blocked out each day. However, the longer you take to pull the trigger on this new server, the longer it will take on my end to get the work scheduled within the queue.

Client: If we get double billed, we're taking that out of what we have remaining to pay you.

Me: On the subject of paying us, you signed a contract acknowledging that you would pay us the remaining 50% after you approved the changes, which you did last week, in order for us to deliver the project. Thank you for the reminder that your remaining balance has not yet been paid. I'll have our CFO resend the invoice for you to remit payment before we proceed any further.

---

I love it when clients give me shit. I just give it right back.

Manager: Why did you clear the data from the database? The client is now specifically requesting it and we don’t have it anymore!

Dev: You told me to.

Manager: Well why did you listen? It’s obvious now that that data was very important and should have been kept!

Dev: Last time you told me to do something that wasn’t a good idea I tried to explain why and told me not to question you ever again and that doing so was “disrespectful” and then threatened to have me fired. So now I just go along with what you say and let you suffer the consequences of not listening.

Manager: Well don’t do that then! It’s obviously not working very well! It’s ok to disagree with me you just have to make sure that what you think is something I agree with!

Dev: …

So, I'm programming a control system for a prototype aerospace vehicle. You know, the stuff that needs to work to prevent falling out of the sky.

Anyway, test day was today (was -- not anymore). Wiring all the electronics, everything is actuating and works well. Except for one part, a little thruster for stability.

I spent hours - literally, fucking hours - trying to fix the problem. Wrong address? Wrong syntax? I had absolutely no clue what was wrong. Queue the hardware guy, $stupid:

$stupid: "How have you not got it working yet?!"

$me: "I don't know, everything I'm trying isn't working. I've spent hours digging through this code and nothing is fucking working."

$stupid: "Well have you set it up for the new thruster?"

$me: "What...What new thruster?"

$stupid: "Oh, the one we installed this morning, did noone tell you?"

WHY WOULDN'T YOU TELL ME THIS?! COMMUNICATION 101!

Storytime!

This customer comes in and practically throws a computer on the counter.

Customer: This computer isn't working. I've ran the diagnostics and it says it's software. *places a dvd case with a 32 bit Windows 7 disk in it on the counter* It had Windows 10 on it, but I want Windows 7 on it.

Me: Well, you may have issues with the drivers if you put Windows 7 on it--

Customer: I don't care, I just want Windows 7.

Me: You SHOULD care. That means no wifi, no display, no mouse... Windows 7 doesn't like Windows 10 hardware.

Customer: Then... check to see Windows 7 compatibility!

Me: Alright.... *makes notes to check for Windows 7 compatibility*

Me: So has this Windows 7 been used before?

Customer: Yes, it has.

Me: On how many computers?

Customer: I've installed it on two computers and it works just fine.

Me: That's weird because Windows license keys are for one computer only. Are both of them connected to the internet?

Customer: Yes.

Me: Well, okay then... *finishes up ticket*

Customer: I work in this field and I just don't understand why they don't come with the disks anymore. How much is a Windows 10 disk?

Me: *gives price*

Customer: And do you have any?

Me: Let me check *I go to where they are, find some and come back out*

Me: Unfortunately we're out at the moment and would have to special order some back in.

Customer: OK. So then how much to fix this computer?

Me: *price of installing Windows and backing up data*

Customer: That's halfway to the price of a new one of these!

Me: Well yes, an HP at Walmart... But you do have that option if you want to take it.

Customer: Well, why does it cost that much?

Me: Well, it's $labor1 to install Windows, $labor2 to do some basic setup and drivers, and $labor3 to backup and restore data.

Customer: Oh, well I don't want data.

Me: Okay, well then it would be $total - $labor3

Customer: ...Okay, fine

Me: *updates the ticket*

When she finally left I put it on the bench and the first message said "SMART ERROR." I then did 4 different tests that said "lol, the hard drive is failing."

If you "worked in this field," you would know that a SMART error is hard drive related.

If you worked in this field, you would know that Windows is only a 1PC license, so why are you lying about installing it with no issues on other computers?

If you worked in this field, you would know you would want a 64bit Windows on your computer.

If you worked in this field, you would know how to find a Windows 10 installation media online.

If you worked in this field, you would know that HPs are not good computers to get.

IF YOU FUCKING WORKED IN THIS FIELD YOU WOULDN'T BE SUCH A FUCKING CUNT.

Was at my sisters place a little ago and somehow we came at the subject of her laptop.
For everyone who thinks I'm posting this solely to hate on windows, I'm not. This really happened and if you don't believe it, well, so be it, I guess.
Also keep in mind that's she's using a stock version without anything except for word and itunes installed.

She got it a couple of years ago and I dual booted it for her (windows + ubuntu). I fully expected her to use windows because of office and outlook etc.

Asked her anyways:

Me: So, you've got dual boot, although I think already know the answer, what system do you use mostly? (I didn't even consider that there was a possibility that the answer would be ubuntu or linux)
Sister: Ubuntu!
Me:
Me:
Me:
Me:
Me:
Me:
Me:
Me: 😵
Me: Sorry, what? You're not using windows as primary system?!
Sister: No. It at first takes that motherfucking system about 5 minutes to reach the FUCKING LOGIN SCREEN.
Me: Ow, that's bad :/
Me: *turns laptop on and indeed, it takes a fuckton of time*
Me: Is the password still the same as when I set it up for you?
Sister: Yesss.
Me: *types the password, it's working, loading screen appears*
Sister: Would you like a coffee?
Me: Uhm.... sure? But that would take you about 10-15 minutes to make.......?
Sister: Yes. And that's exactly how long it takes before that fucking piece of shit called windows has finally loaded the FUCKING DESKTOP.
Me: 😅
Me: Okay but it can't be that bad, right? I mean, I hate windows but you mostly need it for studies and such and as you know I'm not judging you for tha......
Sister: YES IT IS THAT FUCKING BAD. WHEN I'M IN CLASS, IT TAKES HALF THE FUCKING CLASS TO LOAD BEFORE I CAN OPEN WORD OR WHAT-THE-FUCK EVER.
THAT'S WHY I USE UBUNTU PRIMARILY, BECAUSE, ALTOUGH IT'S NOT MY FAVOURITE SYSTEM, IT. JUST. FUCKING. WORKS.

Well, I did definitely NOT see that one coming!

There is some bloatware on there but definitely as bad as what would cause this. Virus scan turned up empty. No. Fucking. Clue.
It's not a gaming laptop or anything but come on, it should run either windows or linux very well.

Worst thing you've seen another dev do? Long one, but has a happy ending.

Classic 'Dev deploys to production at 5:00PM on a Friday, and goes home.' story.

The web department was managed under the the Marketing department, so they were not required to adhere to any type of coding standards and for months we fought with them on logging. Pre-Splunk, we rolled our own logging/alerting solution and they hated being the #1 reason for phone calls/texts/emails every night.

Wanting to "get it done", 'Tony' decided to bypass the default logging and send himself an email if an exception occurred in his code.

At 5:00PM on a Friday, deploys, goes home.

Around 11:00AM on Sunday (a lot folks are still in church at this time), the VP of IS gets a call from the CEO (who does not go to church) about unable to log into his email. VP has to leave church..drive home and find out he cannot remote access the exchange server. He starts making other phone calls..forcing the entire networking department to drive in and get email back up (you can imagine not a group of happy people)

After some network-admin voodoo, by 12:00, they discover/fix the issue (know it was Tony's email that was the problem)

We find out Monday that not only did Tony deploy at 5:00 on a Friday, the deployment wasn't approved, had features no one asked for, wasn't checked into version control, and the exception during checkout cost the company over $50,000 in lost sales.

Was Tony fired? Noooo. The web is our cash cow and Tony was considered a top web developer (and he knew that), Tony decided to blame logging. While in the discovery meeting, Tony told the bosses that it wasn't his fault logging was so buggy and caused so many phone calls/texts/emails every night, if he had been trained properly, this problem could have been avoided.

Well, since I was responsible for logging, I was next in the hot seat.

For almost 30 minutes I listened to every terrible thing I had done to Tony ever since he started. I was a terrible mentor, I was mean, I was degrading, etc..etc.
Me: "Where is this coming from? I barely know Tony. We're not even in the same building. I met him once when he started, maybe saw him a couple of times in meetings."
Andrew: "Aren't you responsible for this logging fiasco?"
Me: "Good Lord no, why am I here?"
Andrew: "I'll rephrase so you'll understand, aren't you are responsible for the proper training of how developers log errors in their code? This disaster is clearly a consequence of your failure. What do you have to say for yourself?"
Me: "Nothing. Developers are responsible for their own choices. Tony made the choice to bypass our logging and send errors to himself, causing Exchange to lockup and losing sales."
Andrew: "A choice he made because he was not properly informed of the consequences? Again, that is a failure in the proper use of logging, and why you are here."
Me: "I'm done with this. Does John know I'm in here? How about you get John and you talk to him like that."
'John' was the department head at the time.
Andrew:"John, have you spoken to Tony?"
John: "Yes, and I'm very sorry and very disappointed. This won't happen again."
Me: "Um...What?"
John: "You know what. Did you even fucking talk to Tony? You just sit in your ivory tower and think your actions don't matter?"
Me: "Whoa!! What are you talking about!? My responsibility for logging stops with the work instructions. After that if Tony decides to do something else, that is on him."
John: "That is not how Tony tells it. He said he's been struggling with your logging system everyday since he's started and you've done nothing to help. This behavior ends today. We're a fucking team. Get off your damn high horse and help the little guy every once in a while."
Me: "I don't know what Tony has been telling you, but I barely know the guy. If he has been having trouble with the one line of code to log, this is the first I've heard of it."
John: "Like I said, this ends today. You are going to come up with a proper training class and learn to get out and talk to other people."

Over the next couple of weeks I become a powerpoint wizard and 'train' anyone/everyone on the proper use of logging. The one line of code to log. One line of code.

A friend 'Scott' sits close to Tony (I mean I do get out and know people) told me that Tony poured out the crocodile tears. Like cried and cried, apologizing, calling me everything but a kitchen sink,...etc. It was so bad, his manager 'Sally' was crying, her boss 'Andrew', was red in the face, when 'John' heard 'Sally' was crying, you can imagine the high levels of alpha-male 'gotta look like I'm protecting the females' hormones flowing.

Took almost another year, Tony released a change on a Friday, went home, web site crashed (losses were in the thousands of $ per minute this time), and Tony was not let back into the building on Monday (one of the best days of my life).

Sister comes into my room

"Can you look at moms laptop, it stopped working I'm scared I broke it"

Ask why

"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"

Top kek

Take a look

"EFI IPV4 0 (error code) failed to boot"

Weird. Enter bios

"Hard drive: [Not detected]"

Well, that's no bueno

Pop open back, hard drive is loose

Pfft, push that fucker back in

Boot -> works

"Mom is going to kill me I broke it im so worried" -> relieved laughter

Adobeflashplayerkilledmyharddrive.jpg

Shook.exe

So I own a webshop together with a guy I met at one of my previous contract jobs. He said he had a great idea to sell product X because he can get them very cheap from another European country. Actually it is a great idea so we decided to work together on this: I do everything tech related, he does the non tech stuff.

Now we are more than 1 year in business. I setup a VPS, completely configured it, installed and setup the complete webshop, built 2 custom PrestaShop modules, built many customizations, built a completely new order proces (both front and back end), advertised quite some products, did some link building, ensured everything is in place to do proper SEO, wrote some content pages, did administration and tax declarations, rewrote a part of a PrestaShop component because it was so damn inefficient and horribly slow, and then some more. Much more.

He did customer relation management, supplier management and some ad words campaigns. Promised me many times to write the content for our product pages. This guy has an education in marketing but literally said: I'm not gonna invest in creating some marketing plan. I have no ambition in online marketing.

What?! You have the marketing knowledge and skills but refuse to use it to market our webshop and business? What the fuck is wrong with you?!

Today he says to me: 'Hey man, this is becoming an expensive hobby as we don't sell much and have lots of costs. I don't understand why I should be the one to write these content pages. Everything you did in the past 8 months can be done in less than 20 hours! You are a joke and just made it a big deal by spreading your work over so many months. I know for sure because I currently work at a company where I'm surrounded by front end devs! Are you fucking crazy?! You're a liar.'

He talks like this to me every 2 months or so while he can't even deliver the content for 1 single product in 6 fuckin' months! We even had to refund a few of our customers because Mr. client relations manager didn't respond to their e-mails within 1 fucking week!! So I asked him how could that have happened as you do the client relations and support. Well, he replied to me: 'Why didn't YOU respond to our clients? You don't log on in our back office at least once a day?!'.

Of course I do asshole. But YOU don't. He replied that I was lying just like I was lying about what I did for our business.

So, asshole, let's have a look at PrestaShops logs to see who's logging in daily. Well, you can probably guess who's IP was there in most of the entries. It wasn't his.

So, what the fuck have you been doing then?! You can't even manage to respond quickly to a client?!! We have maybe 50 clients and if we get 1 question a month by email it is already a lot. But you keep bitching, complaining and insulting me instead?!!!

Last time he literally admitted on a WhatsApp conversation that he had and still has the hope that he could just sit back and relax and watch me do ALL the work.

Well, guess what you fucking moron. That's not what we agreed upon. You fuckin' retard think you're so smart but you say EVERYTHING on WhatsApp! Including your promises to me. Thank you you fuckin' piece of dog shit because now I have hard evidence and will hand it over to my lawyer to make you pay every god damn cent for all the hours I've spent working on our business. Oh, and I'll take over the webshop and make it a success on my own because I know damn well how to get relevant traffic and thus customers.

You just go get yourself fucked in the ass without lubricant you fuckin' asshole. I have told you you shouldn't fuck with me because I take business very seriously. I even warned you when you were crossing a line again. Well, if you don't listen... You will pay for the consequences. I will be so damn happy to tell you 'I told you so' with a very very big smile on my face. That momemt WILL come, 'partner'.

Fuck you. You will be fucked. Count on that. Fucking asshole.

Wow this one deserves a rant. Where should I even begin? I got a new job for over half a year now doing work in an agency. We're building websites and online shops with Typo3 and Shopware (not my dream, but hey). All fine you might think BUT...

1) I have been working on the BIGGEST project we have all by myself since I started working at this company. No help, nobody cares.

2) If something goes wrong all the shit falls back to me like "wHy DiDnT yoU WoRk MoRE?". Seriously? How should one dev cover a project that's meant for at least two or three.

3) The project was planned four years ago (YES that's a big fat FOUR) and sat there for 3,5 years - nobody gave a fuck. I got into the company and immediately got the sucky shit project to work on.

4) I was promised some time to get familiar with the projects and tech we use and "pick something I like most to get started". Well that never happened.

5) I was also promised not to talk directly to our customers. Well, each week I was bombarded with insults, a shitload of work and nonsense by our customers because (you guessed it) I was obligated to attend meetings.

6) The scheduled time for a meeting was 30 minutes, sometimes they just went on for over two hours. Fml.

7) Project management. It does not exist. The company is just out to get more and more clients, hires more god damn managers and shit and completely neglects that we might need more devs to get all this crap finished. Nope, they don't care. By the way: this is not like a 200 employee company, it's more like 15 which makes it even sadder to have 4 managers and 3 devs.

8) We don't use trello (or anything to keep track of our "progress"), nobody knows the exact scope of the project, because it was planned FOUR FUCKING YEARS AGO.

9) They planned to use 3 months on this project to get it finished (by the way it's not just an online shop, it has a really sophisticated product configurator with like 20 dependencies). Well, we're double over that time period and it is still not finished.

10) FUCK YOU SHOPWARE

11) The clients are super unsatisfied with our service (who would have guessed). They never received official documents from us (that's why nobody knows the scope), nor did they receive the actual screen design of the shop so we just have to make it up on the go. Of course I mean "I" by "we", because appearently it is my job to develop, design and manage this shit show.

12) My boss regularly throws me in front of the bus by randomly joining meetings with my client telling them the complete opposite of things that we discussed internally (he doesn't know anything about this stupid project)

13) FUCK YOU COLLEAGUES, FUCK YOU COMPANY, FUCK YOU SHOPWARE AND FUCK YOU STUPID CUSTOMERS.

14) Oh btw. the salary sucks ass, it's barely a couple of bucks above minimum wage. Don't ask me why I accepted the offer. I guess it was better than nothing in the meantime.

Boy that feels good. I needed that rant. But hey don't get me wrong. I get that dev jobs can be hard and sucky, but this is beyond stupidity that I can bear. I therefore applied for a dev job in research at a university in my dream country. Nice colleagues, interesting projects, good project management. They accepted me, gave me a good offer and I can happily say that in 6-7 weeks my current company can go fuck themselves (nobody knows the 10.000+ lines of code but me). Just light it up and watch it burn!

M: Me
FAC : Fucking annoying colleague
1.
FAC: Hey how did you set up your microservices?
M: I used docke...
FAC: But docker is hard to setup, i want an easier option
2.
FAC: Which services do you have?
M: I have one service for the api, one with redi..
FAC: Redis is not a service
3.
FAC: Do you use AWS API gateway?
M: No, in set up my ow..
FAC: why would you set up your own? I just use the one from AWS.
4.
FAC: How many instances are you have running
M: I have 5 replic...
FAC: 5 replicas? That's why i hate microservices,they are costly
5.
FAC: How did you divide up your app?
M: Since I am starting, its better to run the monolithic and then break it up lat...
FAC: I knew it,you don't actually use microservices
6.
M:(thinking)* Fucker, if you know it well why are you fucking disturbing me?? *

#3 Worst thing I've seen a co-worker do?

A 20-something dev, 'A', back in the early days of twitter+facebook would post all his extracurricular activities (drinking, partying, normal young-buck stuff). The dev mgr, 'J', at the time took offense because he felt 'A' was making the company look bad, so 'A' had a target on his back. Nothing 'A' did was good enough and, for example, 'J' had the source control czars review 'A's code to 'review' (aka = find anything wrong). Not sorting the 'using' statements, and extra line after the closing }, petty things like that. For those curious, orders followed+carried out by+led by 'T' in my previous rant.

As time went on and 'T' finding more and more 'wrong' with A's code, 'J' put A on disciplinary probation. 'A' had 90 days to turn himself around, or else.

A bright spot was 'A' was working on a Delphi -> C# conversion, so a lot of the code would be green-field development and by simply following the "standards", 'A' would be fine...so he thought.

About 2 weeks into the probation, 'A' was called into the J's office and berated because the conversion project was behind schedule, and if he didn't get the project back on track, 'A' wouldn't make it 30 days. I sat behind 'A' and he unloaded on me.
<'A' slams his phone on his desk>
Me: "Whoa...whats up?"
A: "Dude, I fucking hate this place, did you hear what they did?"
<I said no, then I think we spent an hour talking about it>
Me: "That all sucks. Don't worry about the code. Nobody cares what T thinks. Its not even your fault the project is behind, the DBAs are tasked with upgrades and it's not like anyone is waiting on you. It'll get done when it's done. Sounds like a witch hunt, what did you do? Be honest."
A: "Well, um...I kinda called out J, T, and those other assholes on facebook. I was drunk, pissed, and ...well...here we are."
Me: "Geez, what a bunch of whiney snowflakes. Keep your head down and you'll get thru it, or don't. Its not like you couldn't find another job tomorrow."
A: "This is my first job out of college and I don't want to disappoint my dad by quitting. I don't even know what I'm supposed to be doing. All J told me was to get better. What the fuk does that even mean?"
Me: "He didn't give you any goals? Crap, for someone who is a stickler for the rules, that's low, even for J."

Fast forward 2 weeks, I was attending MS TechEd and I was with another dev mgr, R.

R: "Did you hear? We had to let 'A' go today."
Me: "What the hell? Why?"
R: "He couldn't cut it, so we had to let him go."
Me: "Cut what? What did he do, specifically?"
R: "I don't know, 'A' was on probation, I guess he didn't meet the goals."
Me: "You guess? We fire a developer working on a major upgrade and you guess? What were these so-called goals?"
R: "Whoa...you're getting a little fire up. I don't know, maybe not adhering to coding standards, not meeting deadlines?"
Me: "OMG...we fire people for not forming code? Are you serious!?"
R: "Oh...yea...that does sound odd when you put it that way. I wish I'd talk to you before we left on this trip"
Me: "What?! You knew they were firing him *before* we left? How long did you know this was happening?"
R: "Honestly, for a while. 'A' really wasn't a team player."
Me: "That's dirty, the whole thing is dirty. We've done some shitty things to people, but this is low, even for J. The probation process is meant to improve, not be used as a witch hunt. I don't like that you stood around and let it happen. You know better."
R: "Yea, you're right, but doesn't change anything. J wanted to do it while most of us were at the conference in case 'A' caused a scene."
Me: "THAT MAKES IT WORSE! 'A' was blindsided and you knew it. He had no one there that could defend him or anything."
R: "Crap, crap, crap...oh crap...jeez...J had this planned all along...crap....there is nothing I can do no...its too late."
Me: "Yes there is. If 'A' comes to you for a letter of recommendation, you write one. If someone calls for reference, you give him a good one."
R: "Yea..yea...crap...I feel like shit...I need to go back to the room and lie down."

As the sun sets, it rises again. Within a couple of weeks, 'A' had another job at a local university. Within a year, he was the department manager, and now he is a vice president (last time I checked) of a college in Kansas City, MO.

I honestly have no energy to even type this out because this is so draining, but here goes.

I am usually very calm and can keep my composure well, but boy do you push my limits. Do you think my work is so easy that it’s just “a bunch of queries and simple logic”? Well, fine. YOU FUCKING DO IT.. right before I grab you by your fucking neck and shove your face repeatedly into the keyboard. You even have the audacity to give us a project and come the very next fucking day and repeatedly keep asking us “iS iT FiNisHeD yEt?” so much and annoy even the calmest in our team even when we clearly stated that it was going to take us 30 work days to fucking finish it. Do you not know what a working day is? 30 work days is not the same as 30 days you dumbfuck. You have no idea how any of these work and yet you preach your bullshit and waste our fucking time when we could have used that time better to finish our work. THIS IS WHY EVERY SINGLE EMPLOYEE KEEPS LEAVING AND WHY THIS COMPANY HAS A VERY LOW EMPLOYEE RETENTION RATE. You won’t even let me finish my fucking lunch in peace. We have 45 minutes for lunch and since I’ve been eating out for almost the past year (I live alone and don’t usually have time to make food at home because of my hour and a half long commute), a close friend of mine’s mom reached out to and said “Hey, since you’ve been usually getting food from outside, why not join us for lunch?”, so I did and it was the most amazing food ever. Mind you, this was the first time I’ve ever left work myself to have lunch since I joined. I did get 10 minutes late because lunchtime tends to fall around the time where the schools close for the day (no shit) and school traffic is usually insane, and you unsurprisingly decided to make an issue out of a non-issue especially since I’M THE ONLY FUCKING PERSON WORKING IN THE COMPANY and also dock my pay for that. Let me also include the time where our one of the others in the management gave us a quick project that was to be quickly finished while we working on an existing project so we put aside a day just to complete and ship the app and the features and as usual, you decided to make an issue out of a non-issue and decided to shame us publicly and even made (my now former) colleague cry. You’re just a spoiled, selfish, ignorant nit-witted fucking imbecile who has no idea how to even properly run a business. Get fucked in the arse with a cactus. I'm done. I've held on for so long but this is the last straw. I'll be handing my letter of resignation soon. Good luck with running a company without any employees.

This happens way too FUCKING often:
Random person: Hey, can I have your number so I can text you?
Me: Yeah sure! *gives number*
*A few days later*
Person: Hey you gave me your number to message you but I can't find you on whatsapp???
Me: no indeed....?
Person: Well, then why did you give me your number?!?
Me: you asked if you could TEXT me, I don't have whatsapp.....?
Person: Ohh but I meant whatsapping.... that's like the same

THAT'S NOT THE MOTHERFUCKING SAME!!! TEXTING != WHATSAPPING YOU FUCKING COCKSUCKING MOTHERFUCKING ANNOYING PIECE OF GRRRRRRRRR

At one of my former jobs, I had a four-day-week. I remember once being called on my free Friday by an agitated colleague of mine arguing that I crashed the entire application on the staging environment and I shall fix it that very day.

I refused. It was my free day after all and I had made plans. Yet I told him: OK, I take a look at it in Sunday and see what all the fuzz is all about. Because I honestly could fathom what big issue I could have caused.

On that Sunday, I realized that the feature I implemented worked as expected. And it took me two minutes to realize the problem: It was a minor thing, as it so often is: If the user was not logged in, instead of a user object, null got passed somewhere and boom -- 500 error screen. Some older feature broke due to some of my changes and I never noticed it as while I was developing I was always in a logged in state and I never bothered to test that feature as I assumed it working. Only my boss was not logged in when testing on the stage environment, and so he ran into it.

So what really pushed my buttons was:

It was not a bug. It was a regression.

Why is that distinction important?

My boss tried to guilt me into admitting that I did not deliver quality software. Yet he was the one explicitly forbidding me to write tests for that software. Well, this is what you get then! You pay in the long run by strange bugs, hotfixes, and annoyed developers. I salute you! :/

Yet I did not fix the bug right away. I could have. It would have just taken me just another two minutes again. Yet for once, instead of doing it quickly, I did it right: I, albeit unfamiliar with writing tests, searched for a way to write a test for that case. It came not easy for me as I was not accustomed to writing tests, and the solution I came up with a functional test not that ideal, as it required certain content to be in the database. But in the end, it worked good enough: I had a failing test. And then I made it pass again. That made the whole ordeal worthwhile to me. (Also the realization that that very Sunday, alone in that office, was one of the most productive since a long while really made me reflect my job choice.)

At the following Monday I just entered the office for the stand-up to declare that I fixed the regression and that I won't take responsibility for that crash on the staging environment. If you don't let me write test, don't expect me to test the entire application again and again. I don't want to ensure that the existing software doesn't break. That's what tests are for. Don't try to blame me for not having tests on critical infrastructure. And that's all I did on Monday. I have a policy to not do long hours, and when I do due to an "emergency", I will get my free time back another day. And so I went home that Monday right after the stand-up.

Do I even need to spell it out that I made a requirement for my next job to have a culture that requires testing? I did, and never looked back and I grew a lot as a developer.

I have familiarized myself with both the wonderful world of unit and acceptance testing. And deploying suddenly becomes cheap and easy. Sure, there sometimes are problems. But almost always they are related to infrastructure and not the underlying code base. (And yeah, sometimes you have randomly failing tests, but that's for another rant.)

A couple of months back I got an interview for a junior android devel position. I do not consider myself a junior devel, bt fuck it they paid 78k a year plus benefits and this is for south texas where it ain't thaaat expensive. So i kept my mouth shut and went with it.
The company was glorious, one of those hipsert marketing companies with cool couches and shit and people doing fuckign whatever all over the place and cool tools and desks.

So the initial interview with the hr dept went amazing, real cool guys and very down to earth. Next was the senior android dev.

This dude.

It was to be a phone interview, with a lil coding test. Fine whatevs. But the moment he called i knew shit was going down hill. Dude sounded dead af. Like he could not stand being himself that day. Asked asshole questions that every developer in Android should know that were frankly quite insulting ("what company develops the Android os" kind of deal) but kept my mouth shut and answered as needed.

Then the coding portion. Given a string, find the first position of the first repeated char, so if I had , fuck i dunno "tetas" then t was the first (and only) char repeated and it should have given out 2.
Legit finished it up in less than 6 mins and only because he was making me explain my entire thought process.

He got angry for some reason. Mind you I speak like a hippie, with a melow town and calm voice all the damned time, got that Texas swag going on as well as any good ol' boy from Texas should right?
Well this dude was not having none of that shit that day.

Dude was all like "ok now....why exactly did you do it this way?"

With a VERY condescending tone. And i explained that at first I normally think about solutions in pseudocode, so I wrote that as well...1 min or less. In python. This is after I still had the Java solution on screen with perfectly clean and working Java. I saif that since Python was as close to pseudocode as it gets that I figured i would just write the "pseudocode" in python and then map it to Java with all the required modifications.

"Welk i did not ask you to write it in java, so i dunno why you would even do that to begin with"

That is one of many asshole remarks. The first when I mentioned that I found React Native good for prototyping complex ideas for FUCKING FUN. Passion motherfucker. Shit so fly I do it for fun. "We don't deal with that here so I am not interested in what you can do with that or how would it help me"

Mofocka plz.

Well going back to the python shit. I explain (calmly) that it was just a way that I had to figure details, to think of different implementations. He continues by saying that it takes valuable company time.

Then he proceeds to tell me that he believes that i cheated since i fi ished the java "problem" too fast.
I told him that simple stuff like that should take even less for any senior java dev and that we could run another example if he wanted.
Bring it puto.
But no.

He then said that he still did not understand the need for Python in my solution. I lost it.

"Look man, getting real tired of your tone, i explained already, it is just a mental process, i do this when comming up with solutions, thinking in theory, not languages, helps me bridge the gap between problem and implementation, the solution works, it is efficient and fast and i can do it in 5 diff ways if you wanted, i offered and you said no. Don't really know what else you want"

"All i am saying, i am not going to hire you if you are going to be writing Python for Android, that is useless to me"

Lost it more.

I do sound different when pissed. So I basically told him that he asked for my reasoning behind and it was given, that not getting it was a you problem.

Sooooo did not get the job. Was relieved really. Can't imagine having a twat like that as a lead devel.

One day I developed a simple website for a goldsmith who I already new for a year or so.

We discussed everything and agreed on a feature set, price and a deadline when it should be ready. Based on this we signed a contract and I started my work.

Unfortunately at the same time I lost most of my childhood friends. I moved to a new city and started to study computer science, which was awesome on the contrary.

This is where the horror began.

I was totally occupied by the studying, my partner, myself and by the shit of life.

It knocked on my door. The horror decided to pay me a visit.

"Had a look at your calendar recently? Just saying..."

Shit! The deadline came closer and closer everyday and the pile of work undone grew with it. At that point I had to do something. I don't know what it was or how I did it, but somehow I managed to finish the project just in time. I was totally not proud of it, but it featured what was required.

The day before I contacted my client, the horror knocked on my door again. He said:

"You really should have a look at your hard drive."
"Why? everything seems allright."
"Well, then look closer."
"Fuck."
"Right."

Well, there are backups at least, I thought to myself. I'll just recover the last state. That was an annoying thought, but nothing serious. That's just one or two days of w... - Wait, what? Where are my backups? What the actual fuck? Why is the zip file broken? Why doesn't the flash drive work anymore? FUUUCK!!

I was lost. It was a complete nightmare.

Each time my telephone rang the following days, my heart skipped a beat. Finally my client's name appeared on the display. I answered the call, my hands shaking.

"Hey there! I'm calling to discuss the website project with you."
"Well, about that..."
"Yeah, I know you put a huge amount of efford in it so I'm really sorry to say that I on the other hand can't effort the money. Actually I'd like to simply forget about this whole idea."

Seriously? What the fuck just happend? I suddenly noticed a sticky note infront of me reading:
"It was really fun to see you suffer, but I have to go! See ya
- The Horror"

"Hello, are you still there? Do you hear me?", yelled a voice through my phone.
"Uh, yeah. You know, that project was a lot of work and... but you know what? It was actually a pretty fun exercise and I'm doing well over here, so because it's you I'd agree."
I heared a reliefed sigh from the other end of the line.
"Really good! I owe you something! Bye!"

What. The. Fuck.

Aaaah...I just got back from a meeting because of a production data problem caused by an analyst who keeps making mistakes that screw up client data. I wrote a program to automate most of it and everybody initially accused me of having a buggy program, only to find out she wasn't using it, never did.

"Why aren't you using the program then?" was asked. "Oh, well, I just understand my way better," she replies, "When I make a mistake at least I understand why."

Pause....

"Then, um, if you know you're making a mistake, why don't you fix it?"
"Because my process is so manual and labor intensive sometimes it's not worth it to go back and fix it, because I'd have to do everything over again, and you guys are much better at fixing this stuff than I am."

I indicated that everyone is too busy to stop and fix her mistakes, to which she then asks:

"So if you can't fix my mistakes, what am I supposed to do?"

I might have posted this before. But I am going to post it again. Because emojis.

Me: 😁 Software lead I have finished coding the thing.
SL: 😀 Cool, good job. That is going to really help out the analysts.
Software Manager: 😐 hey I noticed you have coded a new thing and pushed it to integration.
Me: 😁 Yes.
SM: 😐 Well how do you know when it's done?
Me: 😑 . . . When you run it and it does the thing?
SM: 😐 Did you write test steps?
Me: 😕 Yeah . . . they're in the issue ticket.
SM: 😐 Yeah but how do you know those are right?
Me: 😕 Because I wrote the thing and the test steps?
SM: 😐 did you put any steps in our acceptance test procedure?
Me: 😕 No.
SM: 😐 why not?
Me: 😧 Because the acceptance test procedure tests requirements. There is no requirement for this functionality.
SM: 😑 Then why did you do it?
Me: 🤔 Because it was an internal request from the analysis team. There is no customer impact here.
SM: 😑 I really think we should write a requirement.
SL: 🤔 But what requirement is he going to attach this to?
SM: 😑 We don't have to attach it to a requirement. We can just test it once and remove it.
Me: 😒 SM, you know we never remove anything from the acceptance test procedure.
SM: 🙂 We do sometimes.
SL: 🤔 When was that I have worked here for twenty years and we have never removed a test from that document.
SM: 😑
SL: 😒
SM: 😑
SL: 😒
Me: 🤐
SM: 😧 I really think there should be an acceptance test written.
SL: 😧 Looks like you're writing an acceptance test.
Me: 😒 Alright as long as y'all're payin'. Shit I was just tryin' to save y'all money.

*acceptance test written and sent to peer review*

Peer: 😐 The requirement tested section doesn't have any requirements spelled out.
Me: 😅 No.
Peer: 🤔 Why?
Me: 😓 Because there is no requirement associated with this test.
Peer: 🤔 Then why are we adding an acceptance test?
Me: 😡 WELL AIN'T THAT A GOOD GOD DAMN QUESTION!?

"Hey nephew, why doesn't the FB app work. It shows blank white boxes?"
- It can't connect or something? (I stopped using the FB app since 2013.)

"What is this safe mode that appeared on my phone?!"
- I don't know. I don't hack my smartphone that much. Well, I actually do have a customised ROM. But stop! I'm pecking my keyboard most of the time.

"Which of my files should I delete?"
- Am I supposed to know?

"Where did my Microsoft Word Doc1.docx go?"
- It lets you choose the location before you hit save.

"What is 1MB?"
- Search these concepts on Google. (some of us did not have access to the Internet when we learned to do basic computer operations as curious kids.)

"What should I search?"
- ...

"My computer doesn't work.. My phone has a virus. Do you think this PC they are selling me has a good spec? Is this Video Card and RAM good?"
- I'm a programmer. I write code. I think algorithmically and solve programming problems efficiently. I analyse concepts such as abstraction, algorithms, data structures, encapsulation, resource management, security, software engineering, and web development. No, I will not fix your PC.

An intern I was supposed to lead (as an intern) and work with. Which sounded kinda crazy to me, but also fun so I rolled with it. But when I met her I quickly found out she didn't even have a coding editor installed and when I advised one she was "scared of virusses". She had Microsoft Edge in her toolbar, and some picture of a cat as a background. We were given some project by our boss, and a freelance programmer helped us set it up on Trello. Great, lets start! Oke maybe first some R&D, she had to reaeach how to use the Twilio API. After catching her on WhatsApp a few times I realised this wasnt gonna go anywere. After a few weeks of coding and posting a initial project to git I asked her if she could show me the code of the API she made so far..

She told me she was using the quickstart guide (the last 3 FUCKING weeks) which contained some test project with specific use cases.

The one that I did 3 weeks ago that same fucking morning.

AND SHE WAS STILL NOT DONE...

A few days later I asked her about the progress (strangly, I wasn't allowed ti give her another task bcs the freelanc already did) and guess what... She got fking pissed at me

Her: "I will come to you when im done, ok?"
Me: "I just want to see how it is going so far and if you are running into any problems!"
Her: "I dont want to show you right now"

She then goes to my fucking boss to tell him I am bothering her.

And omg... Please dear god please kill me now...

Instead of him saying the she probably didn't do shit. He says to me that the girl thinks im looking down on her and she needs a stress free environment to work in. She will show me when its done. ITS A FUCKING QUICKSTART GUIDE YOU DUMB BITCH.

He then procceeded to whine to me about the email template (another project I do at the same time) which didn't look perfect in all of his clients.

Dont they understand that I am not a frontend developer? Can you stop please? I know nothing about email templates, I told you this!!!

Really... the whole fucking internship the only thing the girl did was ask people if they want more tea. Then she starts cleaning the windows, talk to people for an hour, or clean everyone's dask.

all this while I already made 50% of the fucking product and she just finished the quickstart tutorial 😭. Truly 2 months wasted, and the worse thing is I didn't get any apprication. They constantly blamed me and whined at me. Sometimes for being 3 minutes late, the other for smoking too much, or because I drink to much coffee, or that I dont eat healthy. They even forced me to play Ping Pong. While im just trying to do my job. One of the worst things they got mad at me for if when my laptop got hacked bcs it was infected with some virus. He had remote access and bought 5 iPhones 6's with my paypal while I was on break. I had to go home and quickly reset all my passwords and make sure the iPhones wouldnt get delivered. strange this was, this laptop I only used at the company. So it must have been software I had to download there. Probably phpstorm (torrent). Bcs nobody would give me a license. And the freelancer said I * have to *.

the monday after I still had to reinstall windows so I called them and said I would be late. when I came they were so disrepectfull and didn't understand anything. It went a little like this:

Boss: why u late?
Me: had to reinstall my laptop, sorry.
Boss: why didnt you do this in your own time?
Me: well, I didn't have any time.
Boss: cant you do this in the weekend or something? Because now we have to pay you several hours bcs you downloaded something at home.

Me: I am only using this laptop for work so thats not possible.

Boss: how can that even be possible? You are not doing anything at home with your laptop? Is that why you never do anything at home?

Me: uhm, I have desktop computer you know. Its much faster. And I also need to rest sometimes. Areeb (freelancer) told me to torrent the software. He gave me the link. 2 days later this happends

Boss: Ahh okeee I see.. Well dont let it happen again.

After that nobody at the compamy trusted me with anything computer related. Yes it was my own fault I downloaded a virus but it can happen to anyone. After that I never used Windows again btw, also no more auto login apps.

So I've been looking for a Linux sysadmin job for a while now. I get a lot of rejections daily and I don't mind that because they can give me feedback as for what I am doing wrong. But do you know what really FUCKING grinds my FUCKING gears?

BEING REJECTED BASED ON LEVEL OF EDUCATION/NOT HAVING CERTIFICATIONS FOR CERTAIN STUFF. Yes, I get that you can't blindly hire anyone and that you have to filter people out but at least LOOK AT THEIR FUCKING SKILLSET.

I did MBO level (the highest sub level though) as study which is considered to be the lowest education level in my country. lowest education level meaning that it's mostly focused on learning through doing things rather than just learning theory.

Why the actual FUCK is that, for some fucking reason, supposed to be a 'lower level' than HBO or Uni? (low to high in my country: MBO, HBO, Uni). Just because I learn better by doing shit instead of solely focusing on the theory and not doing much else does NOT FUCKING MEAN THAT I AM DUMBER OR LESS EDUCATED ON A SUBJECT.

So in the last couple of months, I've literally had rejections with reasons like
- 'Sorry but we require HBO level as people with this level can analyze stuff better in general which is required for this job.'. - Well then go fuck yourself. Just because I have a lower level of education doesn't FUCKING mean that I can't analyze shit at a 'lower level' than people who've done HBO.

- 'You don't seem to have a certificate for linux server management so it's a no go, sorry!' - Kindly go FUCK yourself. Give me a couple of barebones Debian servers and let me install a whole setup including load balancers, proxies if fucking neccesary, firewalls, web servers, FUCKING Samba servers, YOU FUCKING NAME IT. YES, I CAN DO THAT BUT SOLELY BECAUSE I DON'T HAVE THAT FUCKING CERTIFICATE APPEARANTLY MEANS THAT I AM TOO INCOMPETENT TO DO THAT?! Yes. I get that you have to filter shit but GUESS WHAT. IT'S RIGHT THERE IN MY FUCKING RESUME.

- 'Sorry but due to this role being related to cyber security, we can't hire anyone lower than HBO.' - OH SO YOUR LEVEL OF EDUCATION DEFINES HOW GOOD YOU ARE/CAN BE AT CYBER SECURITY RELATED STUFF? ARE YOU MOTHERFUCKING RETARDED? I HAVE BEEN DOING SHIT RELATED TO CYBER SECURITY SINCE I WAS 14-15 FUCKiNG YEARS OLD. I AM FAMILIAR WITH LOADS OF TOOLS/HACKING TECHNIQUES/PENTESTING/DEFENSIVE/OFFENSIVE SECURITY AND SO ON AND YOU ARE TELLING ME THAT I NEED A HIGHER LEVEL OF FUCKING EDUCATION?!?!? GO FUCKING FUCK YOURSELF.

And I can go on like this for a while. I wish some companies I come across would actually look at skills instead of (only) study levels and certifications. Those other companies can go FUCK THEMSELVES.

Went blank when interviewer asked me do I know KITT. I knew that he didn't mean Knight Rider, but I could not think of anything sensible in the few seconds I had time to answer the question so I answered NO. Interviewer said that it is a basic requirement for the job and it seemed that I lacked the basic skill needed for the job.

Needless to say I didn't get the job. Later that day as I was telling my friends about the interview they seemed really confused....

"... but you know GIT very well. You use it on a daily basis. Why did you answer NO ?"

Damn, blew my interview on pronounciation issue :/

Our website once had it’s config file (“old” .cgi app) open and available if you knew the file name. It was ‘obfuscated’ with the file name “Name of the cgi executable”.txt. So browsing, browsing.cgi, config file was browsing.txt.
After discovering the sql server admin password in plain text and reporting it to the VP, he called a meeting.
VP: “I have a report that you are storing the server admin password in plain text.”
WebMgr: “No, that is not correct.”
Me: “Um, yes it is, or we wouldn’t be here.”
WebMgr: “It’s not a network server administrator, it’s SQL Server’s SA account. Completely secure since that login has no access to the network.”
<VP looks over at me>
VP: “Oh..I was not told *that* detail.”
Me: “Um, that doesn’t matter, we shouldn’t have any login password in plain text, anywhere. Besides, the SA account has full access to the entire database. Someone could drop tables, get customer data, even access credit card data.”
WebMgr: “You are blowing all this out of proportion. There is no way anyone could do that.”
Me: “Uh, two weeks ago I discovered the catalog page was sending raw SQL from javascript. All anyone had to do was inject a semicolon and add whatever they wanted.”
WebMgr: “Who would do that? They would have to know a lot about our systems in order to do any real damage.”
VP: “Yes, it would have to be someone in our department looking to do some damage.”
<both the VP and WebMgr look at me>
Me: “Open your browser and search on SQL Injection.”
<VP searches on SQL Injection..few seconds pass>
VP: “Oh my, this is disturbing. I did not know SQL injection was such a problem. I want all SQL removed from javascript and passwords removed from the text files.”
WebMgr: “Our team is already removing the SQL, but our apps need to read the SQL server login and password from a config file. I don’t know why this is such a big deal. The file is read-only and protected by IIS. You can’t even read it from a browser.”
VP: “Well, if it’s secured, I suppose it is OK.”
Me: “Open your browser and navigate to … browse.txt”
VP: “Oh my, there it is.”
WebMgr: “You can only see it because your laptop had administrative privileges. Anyone outside our network cannot access the file.”
VP: “OK, that makes sense. As long as IIS is securing the file …”
Me: “No..no..no.. I can’t believe this. The screen shot I sent yesterday was from my home laptop showing the file is publicly available.”
WebMgr: “But you are probably an admin on the laptop.”
<couple of awkward seconds of silence…then the light comes on>
VP: “OK, I’m stopping this meeting. I want all admin users and passwords removed from the site by the end of the day.”

Took a little longer than a day, but after reviewing what the web team changed:
- They did remove the SQL Server SA account, but replaced it with another account with full admin privileges.
- Replaced the “App Name”.txt with centrally located config file at C:\Inetpub\wwwroot\config.txt (hard-coded in the app)
When I brought this up again with my manager..
Mgr: “Yea, I know, it sucks. WebMgr showed the VP the config file was not accessible by the web site and it wasn’t using the SA password. He was satisfied by that. Web site is looking to beat projections again by 15%, so WebMgr told the other VPs that another disruption from a developer could jeopardize the quarterly numbers. I’d keep my head down for a while.”

It seems like every other day I run into some post/tweet/article about people whining about having the imposter syndrome. It seems like no other profession (except maybe acting) is filled with people like this.

Well lemme answer that question for you lot.

YES YOU ARE A BLOODY IMPOSTER.

There. I said it. BUT.

Know that you're already a step up from those clowns that talk a lot but say nothing of substance.

You're better than the rockstar dev that "understands" the entire codebase because s/he is the freaking moron that created that convoluted nonsensical pile of shit in the first place.

You're better than that person who thinks knowing nothing is fine. It's just a job and a pay cheque.

The main question is, what the flying fuck are you going to do about being an imposter? Whine about it on twtr/fb/medium? HOW ABOUT YOU GO LEARN SOMETHING BEYOND FRAMEWORKS OR MAKING DUMB CRUD WEBSITES WITH COLOR CHANGING BUTTONS.

Computers are hard. Did you expect to spend 1 year studying random things and waltz into the field as a fucking expert? FUCK YOU. How about you let a "doctor" who taught himself medicine for 1 year do your open heart surgery?

Learn how a godamn computer actually works. Do you expect your doctors and surgeons to be ignorant of how the body works? If you aspire to be a professional WHY THE FUCK DO YOU STAY AT THE SURFACE.

Go learn about Compilers, complete projects with low level languages like C / Rust (protip: stay away from C++, Java doesn't count), read up on CPU architecture, to name a few topics.

Then, after learning how your computers work, you can start learning functional programming and appreciate the tradeoffs it makes. Or go learn AI/ML/DS. But preferably not before.

Basically, it's fine if you were never formally taught. Get yourself schooled, quit bitching, and be patient. It's ok to be stupid, but it's not ok to stay stupid forever.

/rant

!!politics

My employer held a company wide zoom meeting today. It was officially optional, but like 90% of the company attended.

It started out interesting as they had invited a speaker, but it quickly degraded into a gigantic political circlejerk. It was an hour and a half of bashing everyone who doesn’t hold exactly their views, calling them evil, calling them nazis, radicals, militants, racists, etc. — and I don’t share their views, like, at all, so. That really lets me know how they feel!

As far as I can tell, everyone else at the company has the same ideology. Not only does this make me incredibly uncomfortable and require me to act and pretend at all times, it’s honestly kind of infuriating, too. The amount of insults they throw around and blatant lack of tolerance displayed by these “tolerant” people is just incredible.

To them, anyone that doesn’t hold exactly their beliefs is evil, and often a slew of other things, too. And it doesn’t seem to matter how far removed those views are; apparently libertarians are evil as well? Apparently “leave everyone alone” is evil and gets you branded as a militant far-righty? Like, how does that even work? They ascribe to “everyone who doesn’t agree with me is literally Hitler,” I guess.

Fucking hell I can’t stand these people and their politics. And when they all get going on it together? Just. Fucking toxic.

I’ve been so disgusted today after sitting in on that meeting I’ve gotten practically nothing done. And I was so hoping to finally finish this stupid ticket.

Oh, and Mr. PM wants that screwdriver to do even more things now — by next week, of course. Fucking hell.

Why did I switch jobs, again?
Right, to get away from the politics.
Fucking hell.

I've had 3 interviews with the same company. The first two interviews went pretty well, they looked interested, on the third they tell me "your CV says you are not graduated yet, we can't hire you now".

SO WHY THE FUCK DID YOU HAD TO WASTE MY TIME?

You've had my CV before the first interview, why the hell didn't you read that I am still a student? Is the first thing it's written on it! Stupid fuckers.

Dev: “Ughh..look at this –bleep- code! When I execute the service call, it returns null, but the service received a database error.”
Me: “Yea, that service was written during a time when the mentality was ‘Why return a service error if the client can’t do anything about it?’”
Dev: “I would say that’s a misunderstanding of that philosophy.”
Me: “I would say it’s a perfectly executed example of a deeply flawed philosophy.”
Dev: “No, the service should just return something that tells the client the operation failed.”
Me: “They did. It was supposed to return a valid result, and the developer indicated a null response means the operation failed. How you deal with the null response is up to you.”
Dev: “That is stupid. How am I supposed to know a null response means the operation failed?”
Me: “OK, how did you know the operation failed?”
Dev: “I had to look at the service error logs.”
Me: “Bingo.”
Dev: “This whole service is just a –bleep-ing mess. There are so many things that can go wrong and the only thing the service returns is null when the service raises an exception.”
Me: “OK, what should the service return?”
Dev: ”I don’t know. Error 500 would be nice.”
Me: “Would you know what to do with error 500?”
Dev: ”Yea, I would look at the error log”
Me: “Just like you did when the service returned null?”
<couple of seconds of silence>
Dev: “I don’t know, it’s a –bleep-ing mess.”
Me: “You’re in the code, change it.”
Dev: “Ooohhh no, not me. The whole thing will have to be re-written. It should have been done correctly the first time. If we had time to do code reviews, I would have caught this –bleep- before the service was deployed.”
Me: “Um, you did.”
<a shocked look from Dev>
Dev: “What…no, I’ve never seen this code.”
Me: “I sat next to Chuck when you were telling him he needed to change the service to return null if an exception was raised. I remember you telling him specifically to pop-up an error dialog ‘Service request failed’ to the user when the service returned null.”
Dev: “I don’t remember any of that.”
Me: “Well, Chuck did. He even put it in the check-in comments. See…”
<check in comments stated Dev’s code review and dictated the service return null on exceptions>
Dev: “Hmm…I guess I did. –bleep- are you a –bleep-ing elephant? You –bleep-ing remember everything.”

<what I wanted to say>
No, I don’t remember everything, but I remember all the drive-by <bleep>-ed up coding philosophies you tried to push to the interns and we’re now having all kinds of problems I spend waaaaay too much time fixing.
<what I said, and lied a little bit>
Me: “No, I was helping Nancy last week troubleshoot the client application last week with the pop-up error. Since the service returned a null, she didn’t know where to begin to look for the actual error.”
Dev: “Oh.”

So as quite some people know on here, I am strongly against closed source software and have a very strong distrust in it as well.
So next to some principles (and believes etc etc etc) there is one specifc 'event' which triggered the distrust in CSS (No not Cascading Style sheet, I mean Closed Source Software :P). So hereby the story about what happened.

I think it was about 5 years ago when a guy joined my programming class (I wasn't in uni although I studied but for the sake of clarity, lets just call it uni for now (also, that makes me feel smarter so why the fuck not!)) in uni. He knew a shitload about programming for his age but he was convinced that he was always right. (that aside)
Anyways, at some point we had to work in groups on this project (groups for specific tasks) and he chose (he loved it, we hated it, he had the final say) Trello for 'project management'. He gave everyone (I was running Windows for a little bit at that moment because the project was in C# and the Snowden leaks had not arrived yet so I was not extremely uncomfortable with using Windows, just a lot) this addon program thingy he created for Trello which would make usage easier. I asked if it was open source, he replied with 'No, because this is my project.' and although I did understand that entirely, I didn't feel comfy using it because of it's closed source nature. Everyone declared me paranoid and he was annoyed as hell but I just kept refusing to use it and just used the web interface.

*skips to 2 years later*

I met that guy again at the train station at a random day! Had the usual 'how are you and what's up after a few years' talk with him and then he told me something that changed my view on closed source software for most probably the rest of my life.

"Hey by the way, do you remember that project of a few years back where you didn't want to use my software because of your 'closed-sourceness paranoia'? I just wanted to say that I actually had some kind of backdooring feature build in which (I am not going to say what) allowed me to (although I didn't use it) look at/do certain things with the 'infected' computers. I really wanted to say that I find it funny how you, the only one who didn't give in to my/the peer pressure, were the only one who wasn't affected by my 'backdoor' at that moment! Also your standards towards the use of closed source software probably played a big part probably. I find that pretty cool actually!"

Although I cannot confirm what he said, he was exactly the type of guy who would do this IMO (and not only IMO I think).

So yeah, that's one of the reasons AND the story behind a big part of why I don't trust closed source software :).

Buddy from dept I was in 4 years ago: Check your email.
Me: OK
10 mins later
Buddy: Can you join a webex now?
Me: No
Buddy: OK, I'll forward the details, join when you can.
Me: Could you give me a little context?
Buddy: You helped them pull a cert off a USB stick in Switzerland last year (I'm in US).
Me: Don't think I did.

When I get a chance to read email chain, half of it is in German (I don't read it). Have not idea what this is about, but there seems to be a newer one that says it was resolved.

Me to Buddy: Looks like it was resolved.
Buddy: Yes, but they're still mad at you.
Me: Why?
Buddy: Because you wrote that app and it's hard to update the certs.
Me: I wrote that app as a favor, the dev they hired spent 6 months rewriting 3 SQL queries before being fired.
Buddy: LOL, well I guess they don't like the cert part.
Me: OK, but when I turned it over to them it didn't have a cert at all, I have no idea what the feature is.
Buddy: They said you help them last year.
Me: I didn't.
Buddy: Well they still think it's all your fault.

My code review nightmare part 3

Performed a review on/against a workplace 'nemesis'. I didn't follow the department standards document (cause I could care less about spacing, sorted usings, etc) and identified over 80 bugs, logic errors, n+1 patterns, memory leaks (yes, even in .net devs can cause em'), and general bad behavior (ex.'eating' exceptions that should be handled or at least logged)

Because 'Jeff' was considered a golden child (that's another long TL;DR), his boss and others took a major offense and demanded I justify my review, item by item.

About 2 hours into the meeting, our department mgr realized embarrassing Jeff any further wasn't doing anyone any good and decided to take matters into his own hands. Thinking 'well, its about time he did his job', I go back to my desk. About an hour later..
Mgr: "I need you in the conference room, RIGHT NOW!"
<oh crap>
Mgr: "I spoke to Jeff and I think I know what the problem is. Did you ever train him on any of the problems you identified in the review?"
Me: "Um, no. Why would I?"
Mgr: "Ha!..I was right. So lets agree the problems are partially your fault, OK?"
Me: "Finding the bugs in his code is somehow my fault?"
Mgr: "Yes! For example, the n+1 problem in using the WCF service, you never trained him on how to use the service. You wrote the service, correct?"
Me: "Yes, but it's not my job to teach him how to write C#. I documented the process and have examples in the document to avoid n+1. All he had to do was copy/paste."
Mgr: "But you never sat with Jeff and talked to him like a human being? You sit over there in your silo and are oblivious to the problems you cause. This ends today!"
Me: "What the...I have no idea what you are talking about. What in the world did Jeff tell you?"
Mgr: "He told me enough and I'm putting an end to it. I want a compressive training class developed on how to use your service. I'll give you a month to get your act together and properly train these developers."

3 days later, I submit the power-point presentation and accompanying docs. It was only one WCF with a handful of methods. Mgr approved the training, etc..etc. execute the 'training', and Jeff submits a code review a couple of weeks later. From over 80 issues to around 50. The poop hits the fan again.

Mgr: "What's your problem? When are you going to take your responsibility seriously?"
Me: "Its pretty clear I don't have the problem. All the review items were also verified by other devs. Its not me trying to be an asshole."
Mgr: "Enough with the excuses. If you think you can do a better job *you* make the code changes and submit them for Jeff for review. No More Excuses!"

Couple of days later, I make the changes, submit them for review, and Jeff really couldn't say too much other than "I don't see this as an improvement"

TL;DR, I had been tracking the errors generated by the site due to the bugs prior to my changes. After deployment, # of errors went from thousands per hour to maybe hundreds per day (that's another story) and the site saw significant performance increases, fewer customer complaints, etc..etc.

At a company event, the department VP hands out special recognition awards:

VP: "This award is especially well earned. Not only does this individual exemplify the company's focus on teamwork, he also went above and beyond the call of duty to serve our customers. Jeff, come on up and get this well deserved award."

I really fucking hate when people or companies do shit like this..

Apparently Google is changing the salad emoji, which is a bowl that contains lettuce, tomato, egg, onion and stuff like that, to the same, but without the egg.

Why you may ask?
Well.. they did it to "make it a more inclusive vegan salad".
ITS JUST SOME WHITE PIXELS FOR FUCKS SAKE. How would any vegan, besides the crazy ones, be upset about a moist egg in their crisp salad?

I cant even.. im out of words.. fuck.

Additionally, the news page i read it on have been so kind to host a poll of what people think about it, whether its a good idea or not.

Ill let the image speak for itself, if you really need a translation, dont use google translate, ask in the comments.

Overheard a phone call between the Senior Network Engineer and a contracted Printer-company at 9am this morning. Photocopier was giving a 'functional error' message on-screen and not printing;

N.E:
I logged this call last
Thursday afternoon. Thats 1.5 days of the photocopier not working on our busiest site! Where's the engineer??
.... yes, that's the error message.
Yes, i can log into it, you should have the IP address from the call.
Yes, it's obviously pinging too.
Yes.... we've power-cycled the printer multiple times...
yes, tried that too...
yes, I've unplugged the network cable as well... left it for 15 minutes.
... sorry. What?
What did you say?
Are you f***ing kidding me?
Would you also like me to rub the side of the f***ing machine, and say a prayer while I'm at it??
*takes a deep breath*
Fine, I'll do that but when it doesn't work, i want someone out on the site before lunchtime today!
*slams phone down angrily*

N.E to me as he stomps out of the office;
He wants me to get the user to unplug the network cable and do a power cycle. How the f**k is that going to help? Idiots! Don't know why we have a contract with them, i could do a better job!!!

*comes back into office 5 minutes later*

Me: did it fix it?
NE: yeah. Damn.
*leaves room again to make apologetic phonecall*

Dev: Hey that internal audit you asked me to perform didn’t go so well

Manager: It has too! I’ll get in a lot of trouble if it doesn’t pass.

Dev: Ok well it’s a lot of work to get it to a passing state, we have to dedicate a lot of resources to fix all these findings.

Manager: We don’t have any spare resources, they are all working on new projects! Why did you have to find things??

Dev: ….It’s a lot of hard to miss stuff, like missing signatures on security clearance forms

Manager: Ok can’t you just say that everything is all good? They’ll probably not double check.

Dev: I’m not really comfortable with that…Look all of these findings are all just from one member of the team consistently not doing their job, can’t you just address that with him and I can make a note on the audit that issues were found but corrective action was made? That’s the whole point of audits.

Manager: You don’t get it, if anything is found on the audit I’ll look bad. We have to cover this up. Plus that’s a really good friend of mine! I can’t do that to him. Ok you know what? You are obviously not the right person for this task, I’ll get someone else to do it. Go back to your regular work, I’m never assigning you audits again.

Always the same story:

Marketing: hey I'm gonna do a demo to a customer. They were asking for feature XYZ. That's ready on thr staging server right? Do you think I could use the staging server for the demo?

Devs: well feature XYZ is not 100% done. Basically just feature X is done, and it still has a few bugs. The deadline ain't for another month, since we gotta finish ABC first. I guess you could use the staging, but it has a lot of bugs.

Marketing: perfect!

*after presentation*

Marketing: the staging had so many bugs! Why didn't you tell me?! It was so embarrassing showing it to new customers! Anyway, they loved the new feature. We need it to be ready ASAP.

Devs: What?! That's gonna mess up with our schedule. You know what? Fine, but feature ABC will have to wait another month.

Marketing: Well, it'd be ideal if we could do both...

Devs: Pay for more devs or dor extra hours.

Marketing: Just do XYZ. It's a pity that you'll have to push back ABC but it's fine, XYZ is more important.

(I might ask, if it was so important, why didn't you notice so in the meeting where we had decided that ABC would be prioritized?)

*tons of working hours later*

Devs: There, we finished XYZ.

Marketing: Yay! Wow, this month we'll have two major features done: ABC and XYZ!

Devs: No, ABC is not done yet.

Marketing: What? But the deadline was this week.

Devs: It was, but then you decided to prioritize XYZ and we said we had to push back ABC to get XYZ ready, and you agreed.

Marketing: Did we? Fine. But do it quick.

Marketing and their mood swings.

Man, I think we've all gotten way too many of these.

Normally most interactions that I have are through email. Eventually some would try to contact me via phone. These are some:

"Hey! We are calling you from <whatever company name> solutions! (most of them always seem to end on solutions or some shit like that) concerning the Ruby on Rails senior dev opportunity we were talking about via email"
<niceties, how are you doing, similar shit goes here...eventually>

So tell us! how good/comfortable would you say you are with C++?"

Me: I have never done anything serious with c++ and did just use it at school, but because I am not a professional in it I did not list it in my CV, what does it have to do with Rails?

Them: "Oh the applications of this position must be ready to take in additional duties which sometimes happen to be C or C++"

Me: Well that was not anywhere in the offer you sent, it specifically requested a full stack Rails developer that could work with 3 different frontend stacks already and like 4 different databases plus bla bla bla, I did not see c++ anywhere in it. Matter of fact I find it funny, one of the things that I was curious about was the salary, for what you are asking and specifically in the city in which you are asking it for 75k is way too low, you are seriously expecting a senior level rails dev to do all that AND take additional duties with c++? cpp could mean a billion different things"

Them: "well this is a big opportunity that will increase your level to senior position"

Me: the add ALREADY asks for a senior position, why are you making it sound that I will get build towards that level if you are already off the bat asking for seniors only to begin with?

Them: You are not getting it, it is an opportunity to grow into a senior, applicants right now are junior to mid-level

ME: You are all not making any sense, please don't contact me again.

=======

Them: We are looking for someone with 15 years experience with Swift development for mobile and web

Me: What is up with your people not making these requirements in paper? if I knew from the beginning that you people think that Swift is 15 years old I would have never agreed to this "interview"

Them: If you are not interested in that then might we offer this one for someone with 10 years experience as a full stack TypeScript developer.

Me: No, again, check your dates, this is insulting.

===

* For another Rails position

Them: How good are you with Ruby on Rails in terms of Python?

Me: excuse me? Python has nothing to do with Ruby on Rails.

Her (recruiter was a woman) * with a tone of superiority: I have it here that Python is the primary technology that accompanies Rails development.

Me (thinking this was a joke) : What do you think the RUBY part of Ruby on Rails is for? and what does "accompanies Rails development" even means?

Her: Well if you are not interested in using Rails with Python then maybe you can tell us about your experience in using Javascript as the main scripting platform for Rails.

Me: This is a joke, goodbye.

====

To be fair this was years ago when I still didn't know better and test the recruiters during the email part of being contacted. Now a days I feel sorry for everyone since I just say no without even bothering. This is a meme all on itself which no one has ever bothered to review and correct in years for now. I don't know why recruiters don't google themselves to see what people think of their "profession" in order to become better.

I've even had the Java/Javascript stupidity thrown at me by a local company. For that one it was someone from their very same HR department doing the rectuiter, their shop foreman was a friend of the family, did him the service of calling him to let him know that his HR was never going to land the kind of developer they were looking for with the retarded questions they had and sent him a detailed email concerning the correct information they needed for their JAVAscript job which they kept confusing with Java (for some reason in the context of Spring, they literally wanted nothing with Spring, they wanted some junior to do animations and shit like that on their company's website, which was in php, Java was nowhere in this equation)

I think people in web development get the short end of the stick when it comes to retarded recruiters more than anywhere else.

Guy I work with: Hey can I borrow you for a minute

Me: sure. What do you need?

Him: so this is a project me an the other dev worked on

Me thinking: Well I know he did it all and sent you the project so don't tell me you worked on it

Him: so we use it to do this and this and send an email to this new account I made because (2 minute explanation)

Me thinking: I don't care. Just tell me what your issue is! I already know what it is and does from what you told me the last time when you showed me. Which took an hour of my time.

Him: so he sent me this code which is called <Descriptive name> and in the method we have variables call <descriptive name> and it returns a <variable name>

Me thinking: You mother fucker! I don't give a shit what your method is named, what it the variable names are, and you don't need to read through every line of code to me! Just from the descriptive name you just said I know what it does! What the fuck is your issue!?

Him: we also have these other methods. This one is called <Descriptive name> which does...

Me: are you fucking seriously going to read me your code line by line and tell me what you named your variables AGAIN!?

Him: and we named this one <descriptive name>

Me: you mother fucker...

Him: and it calls this stored procedure. (Literally opens the stored procedure and shows me) and it is called...which has parameters called... And it is a select query that inserts

45 minutes later after he finishes explaining all 3 pages of his code and his 5 stored procedures that the other dev wrote...

Him: So anyway, back to this method. I need to know where to put this method. The other dev said to put it in this file, but where do you think I should put it in here? Should I place it after this last one or before it?

Me thinking: You fucking wasted my fucking time just to ask where to place your mother fucking method that the other dev sent to you in a project with only 3 files, all less than 500 lines of code with comments and regions that actually tell you what you should put there and 5 small stored procedures that were not even relevant to your issue! Why the fuck did you need to treat me as a rubber ducky which would fly away if you did have one because you didn't have an issue, you just didn't know where to put your fucking code! FUCK YOUR METHOD!

Me: Where ever you want

Him: Well I think it won't work if I placed it before this method.

I walked away after that. What a waste of time and an insult to my skills and really unchallenging. He's been coding for years and still can't understand anything code related. I'm tired if helping him. Every time he needs something he always has to read through and explain his shit just to ask me things like this. One time he asked me what to name his variable and another his project. More recently he asked why he couldn't get his project he found online to work. The error clearly stated he needed to use c# 7. His initial solution was to change his sql connection string. 😑

He should just go back to setting up computers and fixing printers. At least then he would never be in the office to bug me or the other dev with things like this.

My new glasses are coming soon :)

Now I won't be as blind as a blindfolded grandmother inside a dark cave at night!

Everytime I code, my nose practically touches the screen, because even my mom's old glasses don't really help.

I can barley use Devrantron because of my blindness, but at least I can see well on mobile.

If you are wondering how my old ones broke, well, my little sister sat on them. That little demon, I love her, but she's pure evil.

Oh, and she did it on purpose btw. I asked her why and she said she wanted to know how it feels like to sit on glasses. She's not crazy, she's 6 years old lol.

I got arrested multiple times under acts of cyber crimes...
Yeah, so what if I did? Why is it a problem that I take down CP sites? "Because it's partaking in cyber warfare." Well then the police and the Federal government should execute their job keeping such out of the web space. Now, whenever I find a job, I have to inform due to the judge's final document. And not just that now when I am required to talk to a police officer who has seen my record all they can reckon is to escalate it.

What fantastic horse crap! You get arrested for tracking down child molesters and taking them off the web exclusively...
Some say I'm a social justice warrior, only I don't think that I am. I reckon I am merely an over eccentric programmer who desires to see the real criminals get sent to jail.

Hey. This code look broken. What should I do?

It isn't broken. It's doing what it's supposed to.

Well, it's hard to follow, but it certainly doesn't look right. And it isn't doing what I expect. Also, why is it calling method(a_class1_or_class2) with a class3?

It isn't hard to follow, and it works just fine. Let me show you. ... huh. looks like it isn't right. and there's a comment here saying the calls aren't clear. but it works just fine. Just copy it over and do it the same way.

I already did that. and it isn't working.

What are you talking about? Of course it works fine. Did you check your code?

------

Really, dude? It doesn't work fine. but, guess what? It works fine* when I change it to call that method with a class2 like it asks for. (Surprise!) But I can't tell him that. Nope. Bossmang get offended. Still won't admit I was right about anything, either.

Ahh... the continual joy of working with (and for) trash.

* well, more fine; the rest of the feature is still wrong. but nope, i'm not allowed to fix it. because why would they want anything to work properly? Already-accepted wrong behavior is good enough. Can't clean up the code, either, because that "muddies the waters." Bitch, I couldn't see the bottom of this sewer if it was half an inch deep! Which is more important: the last contributor entry beside the code, or that code being readable and maintainable? or it, you know, working?

doot doot.
need to scoot.

So I'm on stack overflow trying to give back to the community that has helped me so much yanno.

So I see a question and decide to answer it but I'm on my mobile and trying to write a well formatted etc. answer is a bit tricky so instead I thought I would answer it as best I could on the phone so at least the OP would be going in the right direction and then when I got back to my computer, I would expand on the answer.

But before I had a chance (within 10 minutes of answering) some 200k+ rep dickhead decided it was his job to tell me how bad I was for not giving a proper answer and i have enough rep to comment and I should know better.

So I responded to him (my first mistake) and told him that my answer was intended to get him going and most likely he wouldn't need any more help but that I was going to update it when I got back to my computer.

Well he didn't like that and continued to berate me for my unbelievable behavior.

I then said that if he was that upset, then report me, or even better how about he actually answer the question instead of being a fuckwit to others that have tried.

I also said that I thought that SO and development in general was not about being given the answer but by finding it yourself and actually learning something and that sometimes you need to be pushed it the right direction to find the answer which is what I did here.

Well he disagreed with that too and downvoted my answer which by that point had been updated (like I said I would).

I just don't get it, what is wrong with these people and why has SO become such a toxic place?

I want to give back to the community and help others like people have done for me over the years, but then fuckheads like this just ruin it and make you not want to be a part of it anymore.

Then I come here to devRant and everyone is so nice to each other, you can see the respect.

Hello everyone, this is my first time here so hi! I want to tell you all a story about my current situation.

At 18 while in the military I was able to get my first computer, it was a small hp pavilion laptop with windows 7. The system would crash constantly, even though I would only use it for googling stuff and using fb to talk to people. 5 months after I got it and continuously hated it decided to find out why and who could I blame (other than myself) for the system making me do the ctrl alt del dance all the time....

Found out that there are people called computer programmers that made software. Decided to give it a go since I had some free time most days. Started out with c++ because it was being recommended in some websites. Had many "oh deeeeer lord" moments. After not getting much traction I decided to move to Java which seemed like an easier step than C++. Had fun, but after some verbosity I decided to move into more dynamic lands. Tried JS and since at the time there was no Node and I was not very into the idea of building websites I decided to move into Python, Ruby, PHP and Perl and had a really great time using and learning all of them. I decided to get good in theoretical aspects of computer programming and since I had a knack for math I decided to get started with basic computer science concepts.

I absolutely frigging loved it. And not only that, but learning new things became an obsession, the kind that would make me go to bed at 02:40 am just to wake up at 04:00 or 06:00 because the military is like that. I really wanted to absorb as much as I could since I wanted to go to college for it and wanted to be prepared since I did not wanted to be a complete newb. Took Harvard CS50, Standford Programming 101 with Java, Rice's Python course and MIT's Python programming class. I had so much fun I don't regret it one bit.
By the time I got to college I had already made the jump to Linux and was an adept Arch user, Its not that it was superior or anything, but it really forced me to learn about Linux and working around a terminal and the internals of the system to get what I want. Now a days I settle for Fedora or Debian based systems since they are easier and time is money.

Uni was a breeze, math was fun and the programming classes seemed like glorified "Hello World" courses. I had fun, but not that much fun, most of my time was spent getting better at actual coding. I am no genius, nor my grades were super amazing(I did graduate with honors though) but I had fun, which never really happened in school before that.

While in school I took my first programming gig! It was in ASP.NET MVC, we were using C#, I got the job through a customer that I met at work, I was working in retail during the time and absolutely hated it. I remember being so excited with the gig, I got to meet other developers! Where I am from there aren't that many and most of them are very specialized, so they only get concerned with certain aspects of coding (e.g VBA developers.....) and that is until I met the lead dev. He was by far one of the biggest assholes I had ever met in my life. Absolutely nothing that I would do or say made hem not be a dick. My code was steady, but I would find bugs of incomplete stuff that he would do, whenever I would fix it he would belittle me and constantly remind me of my position as a "junior dev" in the company saying things as "if you have an issue with my code or standards tell me, but do not touch the code" which was funny considering that I would not be able to advance without those fixes. I quit not even 3 months latter because I could not stand the dick, neither 2 of the other developers since the immediately resigned after they got their own courage.

A year latter I was able to find myself another gig. I was hesitant for a moment since it was another remote position in which I had already had a crappy experience. Boy this one was bad. To be fair, this was on me since I had to get good with Lumen after only having some exposure to Laravel. Which I did mentioned repeatedly even though he did offer to train me in order to help him. Same thing, after a couple of weeks of being told how much I did not know I decided to get out.

That is 2 strikes.

So I waited a little while and took a position inside another company that was using vanilla PHP to build their services. Their system was solid though, the lead engineer remains a friend and I did learn a lot from him. I got contracted because they were looking for a Java developer. The salary was good. But when I got there they mentioned that they wanted a developer in Java...to build Android. At the time I was using Java with Spring so I though "well how hard can this be! I already use Android so the love for the system is there, lets do this!" And it was an intense, fun and really amazing experience.

-- To be continued.

Last Friday company-wide call consisted of the sales CEO bossman, the remote contractor dev, and myself. The only topic of discussion was CTO-bashing (bossman's favorite). Neither person had much of anything to say about their week, and they didn't want to hear my rather-lengthy summary either (I did a lot). All they wanted to do was bash the CTO (API Guy).

The CEO asked how many hours I had worked, and seemed annoyed when I said less than 40. Well screw you. Monday was Christmas, and Sunday was Encroaching Estranged Asshole Day. (Earlier rant)

I've been spending most of my time trying to learn the steaming mountain of rancid hippo shit that API Guy squeezed out, since he's leaving forever in 10 days. Sure, CEO bossman says he'll still be around to answer questions, but even with him right next to me in the office he's less than useful. After he's gone and finally feeling free of this farce? It'll be worth fuck-all.

So bossman is mad at me for both not working enough over Christmas, and not pumping out features at a frantic pace despite multiple explanations of why this is a bad idea. And he didn't care about what work I actually did do.

My every interaction with him makes me angry. Whenever I -- or anyone else -- does something he doesn't approve of, seemingly no matter the reasoning, he makes it out to be a failure on their part, and like he can't trust them as much now.

Well I'm sorry we're trying to make sure our websocket works perfectly before putting it in the hands of our customers who rely on it for cash processing.

I'm sorry I'm trying to recall printers that aren't configured properly, which also prevent customers from using our goddamn service they're paying for.

I'm sorry I'm trying to learn how everything works while I still have someone to talk to and ask questions of.

I'm sorry I'm preparing for the day I have to take over and have you breathing down my neck. Once API Guy's gone I'll be responsible for everything, and you'll be yelling at me and having a @Root bashing session instead if I don't know how to fix everything right away.

But no. All you care about is that I talk to you about what's going in so you can micromanage development despite having zero fucking understanding of goddamn anything. All you ever fucking want is the next shiny feature you can push to make more sales / keep your current contacts happy. Doesn't fking matter if it makes development awful later; that's tomorrow's problem. And yet you have the gall to bash API Guy over and over and over again for the codebase being a mess? Sure he's a terrible programmer, but been putting up with this exact same shit for five years. No wonder it's a mountain of rancid hippo shit. That's as much your fault as his, asshole.

I'm so sorry you "have serious concerns" about me. I don't want to put up with your shit either.

Fuck off and die.

WHY THE FUCK DOES IT HAVE TO END?

WHY THE FUCK DOES ANYTHING HAVE TO EVER END?

When I left my previous employer, I was so connected to people there. In fact my entire direct team was just few months old.

I ended up crying like a baby on my farewell call in front of everyone. I just couldn't stop.

Definitely not the brightest or smartest people, but surely great at heart. I did hate them at times and we had our ups and downs but they made the place tolerable.

The work culture is created by colleagues at any organisation and not the leadership/management. And work culture was one of the major reasons why I stayed back for 7.25 years even when a rat was earning more than me.

I joined new organisation with a big smile on my face that, I will learn and earn more. And as I was buckling up, my lead quit.

She was one of the smartest person I met. She inspired me so fucking much. Our entire team is geographically located in multiple time zones. Still she never hesitated to jump on calls as early as 07:00 AM or as late as 12:00 AM. Yet she pinged me every time on Slack to check on me and made sure I was doing well. Kept pushing me to get enough sleep, take care and not burnout myself. Always handling her daughter while on calls with us without impacting the discussions.

She taught me like her own child. So patient with a retard like me. Gave me good feedback and insights on how can I grow as a person and what all to look for in the organisation.

She bids her final goodbye early next week and with every meeting we have, I get more emotional. Doesn't feel like we are in different continents but just in same room, talking like we have known each other for years.

And you know what, after joining this org, I came to know that they hired me for a level below what I was in previous org (because how the job titles were structured here and I don't really care for titles). The product I am working on is highly ambitious and everyone is keen to make it live.

And now everything falls on me. Kickass opportunity to get a promotion, relocation, good hike, and all that I desire. And my employer is known to be quite employee friendly to actually fullfil all my wishes.

But that's not what I want. I want my people with me. It would have been so fucking awesome if she wouldn't have quit and together we would have built the product and have had so much fun doing so.

I am sure, the reason of my death will be empathy. I am next to tears while I type this.

I suck at goodbyes. Even though, with the help of technology, people are and will be connected, but still goodbyes are the shittiest things to ever exist.

So my friend, who owns a restaurant, asked me over 6 months ago, if i could redesign his homepage. I told him "sure why not" and since we're friends i didn't want him to pay me any money.

He told me what his thoughts about the design were and i told him that i needed the menu, some decent pictures of the restaurant, the "about us" story and the credentials to the server.

He didn't know the credentials to his server and i told him to ask the person, who made that page to send me the information i needed, but he kept on saying "could you call her because blah blah". Well, i did but she couldn't give me that info without asking the owner. So i met him and told him "hey i told you so, because it's completely normal not give sensible information to unknown people and besides that she told me to tell you that you should give her a call, because she hasn't got your new phone number". Two months later i got an email with the credentials, but still no menu and no pictures.

Four days ago i made a transition page, because i didn't want to publish the page with stock images and without menu, so i wrote him again whether he wanted design #1 or #2. Got a text at ~21:00 saying "design 2, but you need to publish it at 22:00".

I mean wtf?! He assured me he would call some people he knows to get those things. I told him, that it would be free, because of our friendship, but no support from him and he keeps stressing?! He knows i've got a full-time job and my studies going on, so my time is really limited and he keeps fking around like that?! Man it pisses me really off...

The story of my webshop with this fuckin' asshole continues! I decided to stop with the webshop as my partner didn't do anything, so I handed over my shares to my business partner. This was done formally at the notary. Immediately after, we agreed that I would hand over everything that same week. 1 day later I cannot access any accounts. He said that a hand over was not necessary and that he took appropriate measures. Now, 4 months later, I got a letter from a collection agency telling me to hand over the tradename. Uhm what? Tradename? I don't own it so I replied that there's nothing to hand over. A day later again a letter that he will sue me if I don't hand over the tradename. Mr. Prick Lawyer, I understand that you mean the DOMAINname, but why the fuck do you keep referring to the tradename?! You too stupid to understand the difference? So, to get rid of this crap I made an offer to sell him the domainname, which he accepted. But mr. Asshole moved the shop to a different hostingprovider thinking that the dns would be magocally updated. Of course not asshole. So I offered (to be cooperative) to update dns so his site will work again. I did. A day later again a letter that site still not reachable and he'd sue me for all damages etc.

What a muppet show! You think ypu can sue me because YOU made a config mistake? He's a funny guy! I told the lawyer to not send me any 'issues' caused by mr. Asshole's unprofessional acting and if he does, I'll charge him for every second spent.

Today mr. Asshole's webshop says 'Apache is functioning normally' and that's it. Well done, asshole! See how eaay my job is and how little knowledge it requires? You proved ypu can do it yourself Big boy! Good luck selling shit on your website. Good luck with your seo rankings. And good luck fucking yourself in the ass!

Now I'm going to sue you because of copyrights violations. You use my software and you don't have a license. Either pay or remove it or I'll make you pay!

Satoru Iwata.

You might remember it as the former president of Nintendo, but he was also a very impressive programmer. As he was president of HAL Laboratories, he helped with the development of Pokémon Stadium for the Nintendo 64 by porting the Pokémon Red/Blue battle system not by having any sort of documentation, but by reading the assembly source code.

He did so to allow Game Freak's developers (who were only a team of 4 at the time) to focus on their work on Pokémon Gold/Silver. But he did more: when they had to localize Red/Blue for America, they couldn't fit everything in a cartridge. They had the same problem while developing Gold/Silver, since cartridges had at most 8 Mb of storage capacity back then, and they had to fit not only the Johto region but the Kanto one as well! So Iwata stepped in, and created a graphics compression tool which managed to make everything fit in the cartridges.

He did this while not even being part of Nintendo, and the work was so impressive that the Pokémon devs thought it was "a waste to just have [him] as president!" (ie. why not make use of such programming skills).

Truly someone I look up to.

I developed a simple scholarship management system for my school using Laravel, MySQL, jQuery and Bootstrap, I did it for free since college students from my country have to pay social service to get their degrees. Everyone in the scholarships department seemed to be really happy with my work and they evaluated my social service with 10/10, but yesterday they asked for one last favor: to go talk to the new social service guy who'll be supposed to maintain my project, a mid 30's dude who was really pissed off from the beginning because he wasn't even able to deploy the project, he wasn't even able to clone the project from Github. Ok, so I tried to explain to him the tools I used and how the project was structured, but everything I said seemed to piss him even more, so I stopped and had a chat like:

Me: "Look man, do you know or at least have basic concepts of PHP and MVC frameworks?"

Guy: "Yes, but I'm a project manager, not just –despectively– any programmer, and you didn't write proper documentation, it's impossible to deploy your project with the manual you wrote, I cannot work like this".

*We go to their computer and I clone and setup the project in 3 minutes.

Guy: "Yes, but I still don't know how the project works, I need everything documented. If I have to change something, I don't know where to look.

Me: "Man, that's why asked you about knowing PHP MVC frameworks".

Guy: "I cannot work like this, nothing is documented, I don't even know what's that software you're using *points at Sublime Text*. Or tell me, can you arrive at a place where they expect you to work with something you don't know and they have no documentation?"

*At this point he was really pissed

Me: "Well... Dealing with non-documented software is what I do for a living"

Guy: "I don't know what companies you've worked for, probably not big ones..."

Me: "Well, I actually work for *I mention one of the biggest music apps in the country*"

*Guy ironically laughs

When I gave my feedback to the lady in charge of the department, I told her that this guy was really pissed off at how things were done and that I wasn't so sure of him being capable of maintaining the system. She told me not to worry, that the guy became a well known asshole in the office only after a few days, and that she'll probably have to find something else for him to do. It'd be hilarious if this guy ends up capturing scholarships in the system I made.

BRAIN_UNCAUGHT_EXCEPTION
Could not execute "sleep()", as main thread was busy thinking about why a beautiful girl would just handle me her number.

Ok we did get on well but it was unexpected nevertheless

Thank you brain for wasting my day 👍

The fuck did you think was going to happen?

User: ITs dragging their feet which is why x hasn't gone out yet.

PM: Why hasn't this gone out yet?

Me: They sent me a template then another and then said wait that's wrong too I'll send you the correct one.

I've yet to receive this and no one's provided me the data to check over.

PM: Well that's not what x said.

Me: Well my email chain says so. (Proceed to show them the emails)

PM then walks off and blasts the users. Your #blamegame ended the moment you emailed me knob shits.

Please. Hear me out.

I've been doing frontend for six years already. I've been a junior dev, then in was all up to the CTO. I've worked for very small companies. Also, for the very large ones. Then, for huge enterprises. And also for startups. I've been developing for IE5.5, just for fun. I've done all kinds of stuff — accessibility, responsive design (with or without breakpoints), web components, workers, PWA, I've used frameworks from Backbone to React. My favourite language is CSS, and you probably know it. The bottom line is, you name it — I did it.

And, I want to say that Safari is a very good browser.

It's very fast. Especially on M1 Macs. Yes, it lacks customization and flexibility of Firefox, but general people, not developers, like to use it. Also, Safari is very important — Apple is a huge opposing force to Google when it comes to web standards. When Google pushes their BS like banning ad blockers, Apple never moves an inch. If we lose Safari, you'll notice.

As for the Safari-specific bugs situation, well… To me, Safari serves as a very good indicator: if your website breaks in Safari, chances are you used some hacks that are no good. Safari is a good litmus test I use to find the parts of my code that could've been better.

The only Safari-specific BUG I encountered was a blurry black segment in linear gradients that go from opaque to transparent. So, instead of linear-gradient(#f00, transparent), just do linear-gradient(#f00f, #f000).

This is the ONLY bug I encountered. Every single time my website broke in Safari other than that, was for some ugly hack I used.

You don't have to love it. I don't even use it, my browser of choice is Firefox. But, I'm grateful to Safari, just because it exists. Why? Well, if Safari ceases to exist, Google will just leave both W3C and WhatWG, and declare they'll be doing things their way from now on. Obey or die.

Firefox alone is just not big enough. But, together with Safari, they oppose Google's tyranny in web standards game.

Google will declare the victory and will turn the web into an authoritarian dictatorship. No ad blockers will be allowed. You won't be able to block Google's trackers. Google already owns the internet, well, almost, and this will be their final, devastating victory.

But Safari is the atlas that keeps the web from destruction.

!rant & story_time
This happend to the startup I was working for at ~2011. I was a junior Android dev, working on a very popular app.
During experiments for a new feature, I discovered that the system AlarmManager has a serious bug - you can set a repeating alarm with interval=0ms. If your app takes more then 1 ms to handle the Intent, then the AlarmManager will start to fill up the intent Queue, with unexpected results to the OS. causing it to slow down, and reboot when it ran out of Ram. Why? my guess was that because the AlarmManager was part of the OS, then any issues caused by it caused the system process to ran out of ram, crashing it, and the whole system with it. the real kicker was that even after a reboot, the AlarmManager still had Intents queued, causing the device to bootloop for a while, untill the queue was cleared. My boss decided to report the problem to google, as this was an issue in the OS. I built an example app, that caused the crash 10-30 seconds after starting, and submitted to Google. Google responded later that day with "not an issue, no one will ever do this".
Well... At this point I decided to review the autoupdate feature in our app, to make sure this will not happen to us. We just released a new feature where a user can set an update schedule option in the app settings - where you could setup a daily, weekly, or hourly update for the app. after reviewing it, It looked good, and the issue was not triggered in the manual QA I did. So, it was all good. And we released an updated version to the store.
After we did an update-install, we discoverd that, there was a provlem reading the previous version SharedPrefs value for the update schdule settings, and the value defaulted to 0...
the result was, our app caused all our users to go into a bootloop, and because the alarm was reset when the devices booted up, the bootloop could only be solved in a factory reset, or removing our app, before the device rebooted, and then waiting a few reboot cycles.
We lost 50 places in the market, and it took us 6 months to get back to where we were.

It was not my fault, but it sucked big time!

Had a job interview back where I want to move(2300 miles away), doing exactly what I wanted. Unfortunately it was for a senior developer, a bit over my pay grade.

First Interview: "It is above your skill level, but I like you. We will make it fit you."

Second Interview(technical): " You did super well! I will make sure to pass the good news onto the boss! I am excited to work with you soon!"

Response to my thank you email: "We decided to not persue you further for this position. We are going with someone who has more experience."

Why string me along?!?!

Well, some time in the future, i will have to sit a computer science exam with C#. It can't be that bad, right?

Wrong.

To start off, Visual Studio 2013. Why the fuck someone would use this pile of garbage in 2018. I have no fucking clue why any semi-competent IT department would decide to skip TWO fucking releases of the software and decide, that it's okay to just roll with it. It's okay to not have any updates. It's okay to just no care at all.

I literally brought in my laptop with a VM installed since Visual Studio 2017 is really superior to the crap from 5 years ago just to do my coursework most lessons.

-------

Second issue, you know thoes desks where the monitor is literally under the desk and you get a small little window to see the monitor? Yeah, well I will have to take my proper exam in one of these all over the fucking room. Pic related.

Today we had a mini mock - - it went something like this:
- There was glare from the glsss on the desk because of the lights in the room and literally the monitor itself.
- The glass was beyond fucking pig filthy.
- There was neck pain from my back because i was constantly looking down and bending over the see the screen.
- There was eye strain because the document given to us was a tiny piece of paper with tiny writing and the monitor was far away and the paper was close i couldn't focus my eyes.
- Literally every desk was as bad as the next.
- I did fuck all work because i just couldn't focus because of the things above.
You can tell how great that felt.

If i was in a room with a man (or if it was a woman, let's just pretend she has balls), who was the creator of the room i just described, Hitler, my College's IT staff and other really bad people while having infinite ammo, i would continuously shoot the creator in the balls while not giving a shit about anything else.

Forever.

Until heat death.

Thanks for reading.

Be me, new dev on a team. Taking a look through source code to get up to speed.

Dev: **thinking to self** why is there no package lock.. let me bring this up to boss man

Dev: hey boss man, you’ve got no package lock, did we forget to commit it?

Manager: no I don’t like package locks.

Dev: ...why?

Manager: they fuck up computer. The project never ran with a package lock.

Dev: ..how will you make sure that every dev has the same packages while developing?

Manager: don’t worry, I’ve done this before, we haven’t had any issues.

**couple weeks goes by**

Dev: pushes code

Manager: hey your feature is not working on my machine

Dev: it’s working on mine, and the dev servers. Let’s take a look and see

**finds out he deletes his package lock every time he does npm install, so therefore he literally has the latest of like a 50 packages with no testing**

Dev: well you see you have some packages here that updates, and have broken some of the features.

Manager: >=|, fix it.

Dev: commit a working package lock so we’re all on the same.

Manager: just set the package version to whatever works.

Dev: okay

**more weeks go by**

Manager: why are we having so many issues between devs, why are things working on some computers and not others??? We can’t be having this it’s wasting time.

Dev: **takes a look at everyone’s packages** we all have different packages.

Manager: that’s it, no one can use Mac computers. You must use these windows computers, and you must install npm v6.0 and node v15.11. Everyone must have the same system and software install to guarantee we’re all on the same page

Dev: so can we also commit package lock so we’re all having the same packages as well?

Manager: No, package locks don’t work.

**few days go by**

Manager: GUYS WHY IS THE CODE DEPLOYING TO PRODUCTION NOT WORKING. IT WAS WORKING IN DEV

DEV: **looks at packages**, when the project was built on dev on 9/1 package x was on version 1.1, when it was approved and moved to prod on 9/3 package x was now on version 1.2 which was a change that broke our code.

Manager: CHANGE THE DEPLOYMENT SCRIPTS THEN. MAKE PROD RSYNC NODE_MODULES WITH DEV

Dev: okay

Manager: just trust me, I’ve been doing this for years

Who the fuck put this man in charge.

Some motherfucker at the gym called me. “Hey @growling, I am here with that gym you signed up with 5 months ago and your card for membership renewal isn’t working.”

“It’s 8:00am”

“Yes sir. It’s 8am.”

“Don’t you think it’s a bit too early?”

“Did you get a new card?”

“Hey call me at lunch or something, I’m going back to sleep.”

“Okay, or you can call me. Goodbye”
Acting like you got better shit to do with your time.

Like he wanted to lecture me and say waking me up at 8am is fine. Like he wanted to say he came from a hardworking family and so he can say waking me up at 8am is fine. Shiiit dude my mom used to work with two broken hips for 7 days a week until I made six figures. Bless her heart, that’s why I got her a new car and money each month to pay all her bills. She’s been out of work for 2-3 years now. So lecture me. Only my mom can lecture me, boy. Cause she raised me to be an engineer.

Also, why do I see this everywhere as well? I get lectured for drinking beer on a Sunday or Monday during lunch at my frequent visits to liquor store.

“Don’t you have work?”
Yes, 9-5. But I’m an engineer. So it can be 10-6 or 11-7. Doesn’t matter. All of the stuff I do follows sprints and not direct interaction with customers!

I get tasks done and I teach interns to help me get tasks done. In time. And sometimes even more.

I know my schedule is so lax you want to criticize me. Maybe you think I don’t work? Or work as hard as you?

Tl;dr I intentionally act like a spoiled baby when it comes to work so that service/retail/manual labor people lecture me so I can tell them that we work differently than what they’re used to.

I have free snacks. Don’t get me started about gloating about free beef jerky. People hate me on online forums for doing that! Drink beer on tap in work kitchen. A glass of wine anytime I want. Sleep in until sometimes 11am. But that’s why I’m an engineer, buddy.

I have got a new director at work. My previous director had to retire already, the man was already feeling it and he had been on the institution for more than 35 years....I am 30, so this tells you how much the man has been there.

This new dude.....has the presence of a Caterprie (Pokemon) or an Oompa Loompa. In contrast, the previous director felt like a 4 star General (never been in the presence of a 5 star since those occurrences are world war rare) but I had respected that man so much and loved working with him. I really did loved my boss, he was stern and professional, but kind and friendly to his staff, fiercely protective, no one took advantage of I.T while he was there, he would literally fight for us and took our word before anything else. The man was, well, a true man. A true leader.

He took a chance in putting me as the head of my department, but he had faith in me, and coached me and trained me as much as he could. Had the requirement for his position not been a masters he himself told me that he would have loved to make me his successor, even when I would constantly tell him that I was scared shitless of the work he did and the amount of things he did for the institution, to me this is a very laaaaaaaaarge cowboy hat to fill (this is Texas, he wore a hat, the saying is normally "shoes to fill", but fuck it)

This new guys looks away when the other managers are speaking to him. He constantly interrupts us. He constantly tells us about how the other institution in which he was (rival might I add) does X or Y, its fucking annoying to the point that me and the other managers have a drinking game, for every time he references his old institution we drink one beer over the weekend. It is Saturday night and I am 36 in in total (this is my favorite part of it tho) and it is just annoying.

His train of thought makes no sense to me:

"This application, where did you buy it? we tried purchasing one on Y when I was still there but found none"

Me: "Well, since it was a new government mandate and had nowhere to go we had to develop it in house"

Him: "We had tried to purchase what you guys had but found no place that sold it, so why didn't you try purchasing it?"

Me:.....well, because it was brand new, purchase it from where? We also don't like dealing with vendors that manage these sorts of things because every new requirement takes them weeks to produce on very high budgets, historically, my department has only had maintenance fees for the software that we have and even those applications crap themselves all the time and they take weeks to answer back to us.

Him: So you decided to develop it in house instead? we would never do that! back at y we purchased everything our engineers never really developed anything!

Me: Well then, what is the purpose of having engineers if they are not going to actually develop an application?

Him: IF there is something out there that is better then why should you reinvent the wheel?

Me: For this one I did not reinvent the wheel, I am not talking about creating a programming language from scratch, but how does custom solutions that specifically feed the needs of the institution to be produced otherwise? The department has developers for a reason, because they have very specific needs in here that can only come from a team of developers that are in house satisfying those needs.

Him: Well our engineers never had to do that. Sure projects sometimes had to put on holds because the vendor was busy, but such is the nature of development

Me: No it is not, the nature of development is to create things, it is one thing for my team to go through bugs and software considerations, it is another for me to not provide a service because some random company is taking two weeks on a $300 dllr an hour contract to put a simple checkbox on a form. If a project fails the board is not going to care that some vendor is not doing their job, they are just going to blame me, if that is the case then I would much rather the blame be actually mine than some sucky third party "developer" also, your engineers where not even engineers, they were people with a degree that purchased things, that's it, please do not compare them to my guys or refer them as engineers in front of me, they are not.

Him: Well, maybe.

MAYBE?!! motherfucker I did not kill myself learning the ins and outs of architecture and software engineering on my own time after my fucking bachelors in C.S for your codeless background ass to tell me MAYBE. My word IS the fucking WORD here, not yours. Fuck me I really dislike this dude's management practices.

The shitty part? He is not a bad person, he is not a bad dude that is out to get us, just a simple minded moron with no place as a leader.

I know leaders, I know what a leader is, this is not one.

One Thursday noon,
operation manager: (looking at mobile)what the.....something is wrong i am getting bunch of emails about orders getting confirmed.
Colleague dev: (checks the main email where it gets all email sent/received) holy shit all of our clients getting confirmation email for orders which were already cancelled/incomplete.
Me: imediately contacting bluehost support, asking them to down the server so just that we can stopp it, 600+ emails were already sent and people keep getting it.
*calls head of IT* telling the situation because he's not in the office atm.

CEO: wtf is happening with my business, is it a hacker?

*so we have a intrusion somebody messed the site with a script or something*

All of us(dev) sits on the code finding the vulnerabilities , trying to track the issue that how somebody was able to do that.

*After an hour*

So we have gone through almost easch function written in the code which could possibly cause that but unable to find anything which could break it.

Head asking op when did you started getting it actually?
Op: right after 12 pm.

*an other hour passes*

Head: (checking the logs) so right after the last commit, site got updated too?. And....and.....wtf what da hell who wrote this shit in last commit?
* this fuckin query is missing damn where clause* 🤬

Me: me 😰

*long pause, everyone looking at me and i couldn't look at anyone*
The shame and me that how can i do that.

Head: so its you not any intrudor 😡
Further investigating, what the holy mother of #_/&;=568 why cronjob doesn't check how old the order is. Why why why.

(So basically this happened, because of that query all cancelled/incomplete orders got updated damage done already, helping it the cronjob running on all of them sending clients email and with that function some other values got updated too, inshort the whole db is fucked up.)
and now they know who did it as well.

*Head after some time cooling down, asked me the solution for the mess i create*

Me: i took backup just couple of days before i can restore that with a script and can do manual stuff for the recent 2 days. ( operation manager was already calling people and apologising from our side )

Head: okay do it now.

Me: *in panic* wrote a script to restore the records ( checking what i wrote 100000000 times now ), ran...tested...all working...restored the data.
after that wrote an apology email, because of me staff had to work alot and it becomes so hectic just because of me.

* at the end of the day CEO, head, staff accepted apology and asked me to be careful next time, so it actually teached me a lesson and i always always try to be more careful now especially with quries. People are really good here so that's how it goes* 🙂

My code review nightmare part 2

Team responsible for code 'quality' dictated in their 18+ page coding standard document that all the references in the 'using' block be sorted alphabetically. Easy enough in Visual Studio with the right-click -> 'Remove and Sort Usings', so I thought.

Called into a conference room with other devs and the area manager (because 'Toby' needed an audience) focusing on my lack of code quality and not adhering to the coding standard.

The numerous files in question were unit tests files

using Microsoft.VisualStudio.TestTools.UnitTesting;
using System.Collections.Generic;
using System.Linq;
<the rest of the usings>

T: "As you can see, none of these files' usings are in alphabetical order"
Me: "Um, I think they are. M comes before S"
T: "The standards clearly dictate system level references are to be sorted first."
Mgr: "Yes, why didn't you sort before checking this code in? T couldn't have made the standards any easier to follow. All you had to do is right-click and sort."
Me: "I did. M comes before S."
T: "No You Didn't! That is not a system reference!"
Me: "I disagree. MSTest references are considered a system level reference, but whatever, I'll move that one line if it upsets you that much."
Mgr: "OK smartass, that's enough disrespect. Just follow the fucking standard."
T: "And learn to sort. It's easy. You should have learned that in college"
<Mgr and T have a laugh>
Me: "Are all your unit tests up to standard? I mean, are the usings sorted correctly?"
T:"Um..well..of course they are!"
Me: "Lets take a look."

I had no idea, a sorted usings seems like a detail no one cares about that much and something people do when bored. I navigate to project I knew T was working on and found nearly all the file's usings weren't sorted. I pick on one..

using NUnit;
using Microsoft.Something.Other;
using System;
<the rest of the usings>

Me: "These aren't sorted..."
T: "Uh..um...hey...this file is sorted. N comes before M!"
Me: "Say that again. A little louder please."
Mgr: "NUnit is a system level nuget package. It's fine. We're not wasting time fixing some bug in how Visual Studio sorts"
Me: "Bug? What?..wait...and having me update 10 or so files isn't a waste of time?"
Mgr: "No! Coding standards are never a waste of time! We're done here. This meeting is to review your code and not T's. Fix your bugs and re-submit the code for review..today!"

After returning back from the company we were purchasing a new phone system (hardware+software, $100K+, kind of a big deal)
VP: “I need the new phone system software integration for our CRM by next week. I need to demo the system for the other VPs”
Me: “No problem. Were you able to get their API like I asked?”
VP: “Salesman didn’t know for sure what that was, but he said all the developer software documentation is on their site.”
Me: “Did he give you a URL? Their main site is all marketing mumbo-jumbo. I assume there is another one specific for developers.”
VP: “Yea, he might have said something, but I don’t understand why you need it. The salesman said the integration would be seamless. He showed me several demos.”
Me: “No, I mean I need to know, is the API a full client install? a simple dll? is this going to be a web service integration? How will I know what to program against?”
VP: “I think I heard him say something about COM? Does that sound like an API?”
Me: “It’s a start. Did he provide you anything, a disk, a flash drive, anything with the software?”
VP: “No, only thing he told me was our CRM integration would be seamless and our development team would have no problems.”
Me: “OK..OK…I get it…he’s a salesman. Is there an 1-800 number I can call? A technical support email address? Anyone technical I can reach out to?”
VP: “Probably, but I don’t understand what the problem is. I need the CRM integrated by next week. I gave the other VPs a promise we would get it done. I do not break promises.”
Me: “Wait…when are we installing the new system?”
VP: “Well, the purchase order will be cut at the end of the month’s billing cycle, the company has about a two month turnaround time to deliver and install the hardware, so maybe 3 months from now? Are you going to be able to have the integration ready for next week?”
Me: “If we won’t see any of the hardware for 3 months, what exactly am I integrating with?”
VP: “That API you wanted or whatever it is. COM…yea, it’s COM. I was told the integration would be seamless and our developers would have no problem. I don’t understand why you can’t simply write the code to make it work. Getting the hardware installed is going to be the hardest part.”
Me: “OK, so I have no documentation, we have no hardware, no software, and no idea what this ‘seamless integration’ means. I’m afraid there isn’t anything I can do right now. ”
VP: “Fine!...I’ll just have to tell the other VPs you were not able to execute the seamless integration with the CRM.”
Which he did. When the hardware+software was finally installed, they hired consultants (because I “failed”). I think the bill was in the $50K range to perform the ‘integration’ which consisted of Excel spreadsheets (no kidding). When approached with the primary CRM integration, the team needed our API documentation, a year’s development time and $300K. I was pissed off enough, and I had the API documentation, I was able to get the basic CRM integration within 3 days. When an agent receives a call, I look up the # in our database, auto-fill the form with the customer info, etc. Easy stuff when you have the documentation.
The basics worked and the VP was congratulated by ‘saving’ the company $300K. May or may not have been bonuses involved, rumors still out on that one, but I didn't see em'. Later my manager told me the VP was really ticked that I performed the integration ‘behind his back’, but because it was a success, he couldn’t fire me.

It was friday evening and almost everyone in office had left. I was assigned a bug related to some of my code changes. I called my senior to help me debug (has three years of experience, whereas me having only one year exp, who is also a very good friend of mine *always helps in debugging*).
So the code goes

switch (someEnum) {
case One:
doSomething()
// no break
case Two:
t.x = someEnum
break
case Three:
.....
}

I had recently added new enun One and was reciting the code logic to him as we were looking through code.
Him: Hey you haven't set t.x in case One. How did you miss that?
Me: No look, I haven't but a break on it. It will go ahead and set it in next case.
Him: What are you talking about? if the someEnun is One why would it execute Two case. Lets copy that line up there and try it locally.
Me: No no no wait. Are you saying that groovy doesn't need breaks in switch (Me being new to groovy but good with Java).
Him: Why would you need break in switch case even in Java?
Me: *stares at him*
Him: I'm going to execute a psvm right freaking now.
Me: *while he writes the psvm* Why did you think there were breaks in switch in any code?
Him: Shut up. *writes psvm code cursing me everywhere*
*executes code*
No way. Really??
Me: Tell me why do you think are there breaks in switch.
Him: I though they were to get you out of switch block and not execute the default block.
Me: So were you coding switch until now without breaks?
Him: I don't know man. I'm starting to doubt all the switches I have ever written.
Me: Anyway that's not the problem, so moving on.
*a while later*
Him: If a interviewer would ask me how would you rate yourself in Java. I would be like "Well I worked on various projects for 3 years in Java, but didnt know why we put breaks in switch. So you figure it out yourself."

One of the best moments in office.

Got this from boss (a few colleagues got it as well):
Sites have been down over the weekend and seems the only person cares is PM! There is a condition about working when required (i.e. unpaid OT) on your contract! It is essential that sites are properly managed even at weekends - we run a online business! If anyone has problems we'll discuss next week
*Note: site was partially down and there was no major impact on the business

When I explained why we need to rebuild the sites, you said not now - almost 2 years now, still nothing happens.
When I asked if we can get managed hosting or load balancer, fecking NO again
After asking for my opinion on the sites, you & the puppet think my honesty is me being negative and incorporate, and exclude me from meetings and major part of my work

Go fuck yourself! I've warned you about the status of the sites and you did not want to listen SO DON'T TELL ME I'M NOT DOING MY JOB WHEN YOU'RE THE ONE STOPPING ME FROM DOING IT PROPERLY!
I'm sure we'll have our meeting very soon, cheapskate.

I was called over by a colleague. She needed help because her computer kept telling her that she did not have permission to run certain programs or access certain files.

She logged in to Windows in front of me. The first thing that I noticed that the username was her office email address. I asked her about it.

Me: Why is your username your email address?
Her: It was this way when I got it.
Me: That is impossible. I made every Windows installation here and I always use the same username which is [companyname] as it is our policy.
Her: I'm telling you, this is the way it was when I got it.
Me: Are completely sure?
Her: Well.... someone else must have renamed it.
Me: So someone fired up your laptop, used your password to log in and changed the username to your email?
Her: I don't understand it either. Is it possible that it happened accidentally, on its own?
Me: ...

Then I explained to her that changing the username on Windows 10 may result in problems with file permissions.

I am not mad because she didn't know about this. I am mad because of her idiotic lies.

Ruby’s fanciness bit me in the butt today. It’s pretty rare, but often confusing AF when it happens.

array = [1, 2, 3, 4, 5, 6, 7]
array.count +1 +2
# => 1
What the fuck?

array.count +1 +2 +3
# => 1
What the fuck?

+1 +2 +3
# => 6
Okay.

(array.count +1 +2 +3)
# => 1
What the fuck?

(7 +1 +2 +3)
# => 13
Okay...

array.count + 1 + 2 + 3
# => 13
Alright, so spaces matter here...?

((array.count) +1 +2 +3)
# => 13
But not here!? ... Oh. I think I know what’s going on.

Array#count
Returns the number of elements. If an argument is given, counts the number of elements which equal it using ==

Well fuck me.

Ruby is seeing `array.count(+1+2+3)` instead of `array.count()+1+2+3` since `+1` is a value, not an operator followed by a value as is the case with `+ 1`.

Now, why was I using +1 +2 instead of adding some spaces like I normally would? So they would match what was in the comment next to them for easier reference. Heh.

Future dev, I did this for you! So this is all your fault. :|

Boss: Client wants those stockphotos for the frontpage.

Me: ok. Please license them and let me know. I will upload them to the page.

Boss: How does that work then?

Me: you have to buy the five credit package. Here is the link...

Boss: (no response)

...few days later...

Boss: please remember to upload those images...

Me: well ok. Did you buy them?

Boss: isn't that your thing?

Me: I don't understand. You had all the info. You new where to buy them. You knew what images to buy since the client sent the preview versions. What do you need? ...and why didn't you tell me that you were waiting for my input? I was the last one to reply to this conversation.

Boss: i don't want to buy the wrong images.

Me: just buy the ones the client chose.

Boss: I don't want to look up the email he sent them in.

Me: I don't understand. I directly replied to that mail. It is in the same conversation.

Boss: ok.

...day later...

Boss sends me mail with images attached.

Boss: are those the right images?

Me: well yes. Those are the ones the client sent. I don't have more information than you.

(Me looking at the attachments and finding them in the smallest resolution available.)

Me: why did you download the images in the smallest resolution? It does not make any difference in price.

Boss: well I thought they were not needed in a bigger size.

Me: why do you make my options intentionally smaller? I am the guy doing frontend.
..please give me the login info for the stock account so I can download the images in a better resolution.

I was on vacation when my employer’s new fiscal year started. My manager let me take vacation because it’s not like anything critical was going to happen. Well, joke was on us because we didn’t foresee the stupidity of others…

I had to update a few product codes in the website’s web config and deploy those changes. I was only going to be logged in for 30 minutes to complete that.

I get messaged by one of our database admins. He was doing testing and was unable to complete a payment on the website. That was strange. There was a change pushed by our offsite dev agency, but that was all frontend changes (just updating text) and wouldn’t affect payments.

We don’t want to enlist the dev agency for debugging work, especially when it’s not likely that it’s a code issue. But I was on vacation and I couldn’t stay online past the time I had budgeted for. So my employer enlists the dev agency for help. It’s going to be costly because the agency is in Lithuania, it was past their business hours, and it was emergency support.

Dev agency looks at error logs. There are Apple Pay errors, but that doesn’t explain why non Apple Pay transactions aren’t going through. They roll back my deployment and theirs, but no change. They tell my employer to contact our payment processor.

My manager and the Product Manager contact Payroll, who is the stakeholder for our payment gateways. Payroll contacts our payment gateway and finds out a service called Decision Manager was recently configured for our account. Decision Manager was declining all payments. Payroll was not the person who had Decision Manager installed and our account using this service was news to her.

Payroll works with our payment processor to get payments working again. The damage is pretty severe. Online payments were down for at least 12 hours. Our call center had logged reports from customers the night before.

At our post mortem, we had to find out who ok’d Decision Manager without telling anyone. Luckily, it was quick work. The first stakeholder up was for the Fundraising Dept. She said it wasn’t her or anyone on her team. Our VP of Analytics broke it to her that our payment processor gave us the name of the person who ok’d Decision Manager and it was someone on the Fundraising team. Fundraising then starts backtracking and says that oh yes she knew about it but transactions were still working after the Decision Manager had been configured. WTAF.

Everyone is dumbfounded by this. How could you make a big change to our payment processor and not tell anyone? How did our payment processor allow you to make this change when you’re not the account admin (you’re just a user)?

Our company head had to give an awkward speech about communication and how it’s important. The web team can’t figure out issues if you don’t tell us what you did. The company head was pissed because it was a shitty way to start off the new fiscal year. Our bill for the dev agency must have been over $1000 for debugging work that wasn’t helpful.

Amazingly, no one was fired.

At a meeting:

"We don't know why <past developer, they all know who this motherfucker is> did it this way but we have to..."

Me: *slams table* no, stop. I am tired of this. Y'all must've really liked this guy. But he did it this way because he was a fucking idiot.
A
Fucking
Idiot
There is no other reason for this amount of fuckery that I have to be bothered to fix and mess with on A DAILY BASIS so I am gonna go ahead and call it as it is. The dude was a damn moron and no one here stopped him. I know he was a janitor here that got his cute lil associates and y'all wanted some good will hunting shit to happen, but <said dumbass developer is no matt damon"

Them: "YOU CaNt JusT UsE ThaT lanGUAGE"

"Am i gonna fix this shit?"

"Well......no one else kno...."

Me: "exactly"

Legit man i am sick and tired of this shit. I did not earn a B.S in comp sci. Graduated in the top percentage of my class, am suffering through my MCS to fix php like a fucking moron all day.The rest of my web devs backed me up.

Aaaand btw..no, it is not my job. I am a fucking analyst, i provide data reports, i program said reports, i am tasked with this shit because i used to work for then as a web tech.....got a different position cuz i was tired of it...fuck me right?

Back in the day, I joined a little agency in Cape Town, small team small office with big projects, projects they weren’t really supposed to take on but hey when the owner of a tech business is not a tech person they do weird things.
A month had passed and it was all good, then came a project from Europe, Poland to be specific. The manager introduced me to the project, it was a big brand - a segment of Lego, built on Umbraco (they should change the name to slowbraco or uhmmm..braco somewhere there) the manager was like so this one is gonna be quite a challenge and I remember you said you are keen on that, I was like hell yeah bring it on (genuinely I got excited) now the challenge was not even about complexity of the problem or code or algorithms etc you get my point… the challenge was that the fucking site was in polish - face palm 1 - so I am like okay code is code, its just content, and I already speak/familiar with 13 human languages so I can’t fail here ill get around it somehow. So I spin up IIS, do the things and boom dev environment is ready for some kick ass McCoding. I start to run through the project to dig into the previous dev’s soul. I could not relate, I could not understand. I could not read, I could not, I could not. - face palm 2 - This dude straight up coded this project in polish variable names in polish, class names in polish, comments in freaking polish. Look, I have no beef with the initial guy, its his language so why not right? sure. But not hey this is my life and now I should learn polish, so screw it, new tab - google translate, new notes, I create a dictionary of variables and class etc 
3 days go by and I am fucking polish bro. Come at me. I get to read the previous devs soul through his comments, what a cool dude, his code wasn’t shit either - huge relief. So I rock on and make the required changes and further functionality. 

The project manager is like really, you did it? I am like yeah dude, there it is. Then I realise I wasn’t the first on this, this dude done tried others and it didn’t go down well, they refused. - face palm 3 -

Anyway, now I am a rock star in the office, and to project managers this win means okay throw him in the deep - they move me to huge project that is already late of course and apparently since I am able to use google translate, I can now defeat time, let the travelling begin. - face palm 4 - I start on the project and they love me on it as they can see major progress however poland was knocking on the door again, they need a whole chunk of work done. I can’t leave the bigger project, so it was decided that the new guy on Monday will start his polish lessons - he has no idea, probably excited to start a new job, meanwhile a shit storm is being prepared for him.

Monday comes, hello x - meet the team, team meets x

Manager - please join our meeting.

I join the meeting, the manager tells me to assist the new dev to get set up.

Me: Sure, did you tell him about he site?

Manager: Yes, I told him you knocked it out the park and now we just need to keep going

Me: in my head (hmm… that’s not what I was asking but cool I guess he will see soon enough -internal face palm 5 - )

New dev is setup, he looks at the project, I am ask him if he is good after like an hour he is like yeah all good. But his face is pink so I figured, no brother man is not okay. But I let him be and give him space.

Lunch time comes, he heads out for lunch. 

1hr 15mins later, project manager is like, is the new dude still at lunch.

We are all like yeah probably. 

2hrs pass 

3hrs pass

Now we are like okay maybe something happened to him, hit by a car? Emergency? Something… 

So I am legit worried now, I ask the manager to maybe give him a ring. 

Manager tries to call. NOTHING, no response. nada.

Next day, 8am, 9am, 10am no sign of the dude. 

I go to the manager, ask him what’s up. 

Manager: he is okay. However he said he is not coming back. 


Fuck Apple and its review system

So, this started in december. We wanted to publsih an app, after years of development.

Submit to review, and passes on the first try. Well, what do you know. We are on manual release option, so we can release together with the android counterpart. Well yes, but someone notices that the app name is not what was aggreed (App Name instead of AppName). Okay, should be easy, submit the same app, just the name changed. If it passed once, it will pass again, right? HAH

Rejected, because the description, why we use the device’s camera is too general. Well... its the purpose of the app... but whatever, i read the guidelines, okay, its actually documented with exapmles. BUT THEN WHY THE FUCK COULDNT YOU SAY THAT ON THE FIRST UPLOAD?

Whatever, fix it, new version, accepted, ready to release just in time.

It doesindeed roll out,but of course, we notice that the app has a giant issue, but only on specific phones. None of our test phones had this problem, but those who have, essentially cannot use our program. Nasty as it is, the fix is really easy, done in 5 minutes. Upload it asap, literally nothing changed from user point of view, except now it doesnt crash on said devices. Meanwhile 1 star reviews are arriving from these users - of course with all the right. Apple should allow this patch quickly, right? HAH

THE REAL BULLSHIT COMES NOW

With only config files changed, the same binary uploaded we get rejected? What now? Lets read it. “Metadata rejected, no need to upload new binary”.... oh fine only the store page is wrong? Easy. Read the message, what went wrong. “Referencing third party content is nit permitted on the app store” meaning that no android test device should be shown. Fine, your rules. They even send a picutre of the offending element. BUT ITS NOT EVEN ON THE STORE. THATS A SCREENSHOT OF THE APP. HOW IS THAT METADATA? I ask about this, and i get a reply, from either a bot, or a person who cant speak or read english, and only pasted a sample answer, repeating the previous message. WTF. Fine, i guess you are dumb, but since they stop replying to our queries, do the only sensible thing, re-record the offending tutorial video that actually contained an android device. This is about 2 weeks, after the first try to apply a simple patch to a broken app. And still, how did it pass the review 2 times?

Whatever, reupload again, play the waiting game for a week, when the promised average wait time is 2 days, they hit us with a message, that they want to know what patent we use in our apps core functionality. WTF WHY NOW? It didnt bother you for a month, let it release ti production and now you delay a simple patch for this? We send them what they know. Aaaaand they reply: sorry we need more time to review your app. FUUUUUUCKKK YOUUU. You are reviewing a PATCH with close to zero functional change!!! Then, this shit goes on, every week we ask about an ETA, always asking for patience... at the end it took another 3 weeks... so december 15 to jan 21 in total...

FOR. A. SINGLE. FUCKING. PATCH

Bottom line is what is infurating, apple cares that there is an android device in the tutorial video, but they dont care that a significant percentage of our users simply cannot use the app.

Im done

Old client texted me yesterday: the website and pos system you made does not work anymore... Why ?

I saw that their domain was moved to another host and texted back: "some has moved the domain so that's why."

Client: "how can this be fixed"
Me: "move the domain back"
Client: "but then the new system I bought cannot function".
Me: oh well, then you are in trouble, if the new company you hired to make you a new system and website had been using just a little brain power, this would not happen. Now you have to bring your new system up and working before you open your store...

I could have helped them by pointing a sub domain to the server, but he never ever treated me with respect, and never payed in time, and he did not tell me about this move before he initiated it.

Me: shuts down server and thingking: good luck working with those new "professionals"

You know. I have mixed feelings on the way people have been reacting to senzory's rant regarding the way he deals with clients. Some people believe that he is unethical, some people see it as just business(me included) but to see what the community says is somewhat interesting.

First, let me be clear on something: i have been fucked over by clients many times for being a nice guy and trying to play it nicely.

Because of this I am selective of who deserves good treatment and who gets to fuck off. But regardless of the client I do the same thing: regardless of who it is, nice or otherwise. If a project will take 1 week to complete then I tell them that it will take 3 to 4 weeks. Why? Well because I have many things on my plate, I am married and have two children, one lives with me and I try to spend as much time with them as I can. I work from 8 to 6, sometimes later and when I get home I sometimes don't do shit since at work I maintain the web services of 2 fucking college campuses.
I don't look for my clients. Through word of mouth they come to me. And being in a privileged position(there are about 5 devs here and they all suck) they can either do with my times and fees or can fuck off over the border where Pedro will do their shit on vbscript and classic ASP(which I like, but you know why this is not an option in 2018)

Apps can be sold for large quantities of money, regardless of what their use case is, if a company wants to outsource their apps to an external developer(such as yours truly) that means that they are willing to play the game. And that is what business is: a game, a survival game.

Where I live, a company will not think twice of firing a single mother for whatever reason. In the U.S of A, and specially in Texas, you can be fired for whatever reason. I have automated people's jobs without knowing it, I have made people lose their jobs and saved companies thousands with my apps. Things like that were not know to me, had I known that someone would have lost their jobs I would have tried differently.

If a company is willing to tell employees(loyal employees) to fuck off, then i do not regret charging what I do and hustling the way I do with rat faced dickheads that care not for people. If I could I would destroy entire companies here. But that is for another story.

I have been used, insulted, gambled with and have been lied to, to my face by these companies. Which has left me jaded.

Oh now, trust me. I am still highly optimistic and nice. And if someone has a small business and I can help them out, then I will lower my rate and give positive vibes in the hopes of making things better through karma. I want to see the best in people. But this does not stop me from being a shark and giving quotes the way I do.

Because companies, as an overall entity are not people with the best intentions(sometimes) and they will not take your kindness, they will take advantage if possible in an effort to save money. Its just dickhead business.

So why, as a professional and privileged developer that obtained his skills through intense study and practice, a wizard by all means, should lower to these nameless, Faceless entities?
Why should i give them the fairness they do not give others? Why should I play the high morale game and come out as a loser?

At the end of the day, I get to swim in my own pool of success, knowing that they did not get the chance to fuck me over

So if you tell me that you took advantage of your hard earned skillset, and built a cross platform app(which compiles to native binaries) and sold 2 products for one, I will tell you that you are an excellent player at their game. If you tell me that you finished before and got to charge for 2 weeks of work doing just 2 days I will say that you are an excellent time manager. And if you tell me that at the end of the day you managed to keep said customer I will tell you that you are a true professional.

There is a difference lads, in selling a product to big momma jamma's cajun restaurant, to the largest logistics company around.

Be nice to those that desserve it.

My life could get worse, but it's really shitty now.

Suffering from a serious back injury since last year, my health has been not so positieve lately.
It put a toll on my mood, which in turn asked it's price regarding my relationship. Needless to say that did not go well. Already a fe months single but we kept in touch.

Three days ago my back injury returned, and was unable to lead a normal life. Constant pain, coyld not even move in the house. Even going to the toilet was a terrible experience because when you move, you're in a world of pain.

I asked my ex girlfriend to help me, since she was the only one having a key to my house.

When she arrived i hoped to have some moral support and to help me mive around, ensuring i would not injure myself any more.

Instead i received the cold shoulder. When she wanted to help pe up she did it a bit too hard and the pain sheered thrpughout my body. Screaming in pain.

She promptly left, leaving keys behind.

The hardest part is that she just left without me being able to explain clearly why i screamed. She thought i was yelling at her while in reality i was yelling due to the immense pain.

After that i had to cut ties forever. Tabula rasa. So i removed everything that is related to that time and locked it in my vault.

Since then i can hardly focus, my mibd is numb and i cannot think straight. The alcohol and other sedatives are probably also involved, but still i feel my life is a mountain of depressing shit.

Needed to vent. And yes i post this because i have a need for some understanding, yes for now i crave for some attention and some encouraging, supportive words. I'm left With no other options since the person i wanted it from the most has simply left... And the fact i am unable to actually be social outside...

Fuck friends and relationships, right?

This one is more...puzzling than anything else.

We had a consultant come in, a young guy recently out of school. He completed his basic onboarding stuff, got along okay with everyone, etc., but was quiet and kept to himself.

At the end of his first week, we were heading out the door on Friday afternoon, and someone offhandedly said to him “see you next week” or something benign like that. He responded with “yeah we’ll see,” which was...odd.

And then he completely disappeared – we never saw him again.

Okay, so he just decided the job wasn’t for him and quit, right? What’s so strange about that?

Well, for one, the company technically owed him a paycheck for the week, but they couldn’t reach him despite multiple attempts. They eventually left a message and said if you want to get paid, come in and pick up your check. He never did.

But not only that, he *abandoned his car* at the office! On the Friday that he left, he apparently got a ride or a taxi home, and then he just never came back in to get his car. The company eventually had to tow it.

I just would love to know the backstory here. Why would someone go through the trouble to apply for a job, interview, accept the position, work for a week – and then quit without getting paid and leave their car behind??

Time to rant about JavaScript tutorials.

If you don't know the 'jQuery basic arithmetic' joke, Google it now. It'll make you laugh, promised.

In that manner i just remembered a JavaScript tutorial my fiancee tried to follow when she did an internship at the company i work for last year.

She was tasked to create a temperature interface for our server rack, which she wanted to do via an Arduino and a webserver aswell as an SQL database.

The Arduino part wasn't really a problem, but since she had no experience with js she very closely clinged to a chart visualisation tutorial.

All of that worked very well, but beeing the person i am i looked at the code and found something off.

The chart library had no dependencies to external libraries or any local files for any of them. Though the tutorial used a jQuery import.

So why did it use jQuery?
Well...
To load the chart initialization after the page has loaded.

So they pulled the entirety of jQuery in just to do what fucking window.addEventListener('DOMContentLoaded',function(){...}); could have done.

I wonder how many people who just want something to work did this shit. I hate it that so many tutorials do not adhere any kinds of standards, override behavior because they don't like it, even though it may have a very good reason to exist, pull entire libraries in for something vanilla <language> can do in 3 lines, etc.

Fuck.

"I'm almost done, I'll just need to add tests!"

Booom! You did it, that was a nuke going off in my head.

No, you shouldn't just need to add tests. The tests should have been written from the get go! You most likely won't cover all the cases. You won't know if adding the tests will break your feature, as you had none, as you refactor your untested mess in order to make your code testable.

When reading your mess of a test case and the painful mocking process you went through, I silently cry out into the void: "Why oh why!? All of this suffering could have been avoided!"

Since most of the time, your mocking pain boils down to not understanding what your "unit" in your "unit test" should be.

So let it be said:

- If you want to build a parser for an XML file, then just write a function / class whose *only* purpose is: parse the XML file, return a value object. That's it. Nothing more, nothing less.
- If you want to build a parser for an XML file, it MUST NOT: download a zip, extract that zip, merge all those files to one big file, parse that big file, talk to some other random APIs as a side-effect, and then return a value object.

Because then you suddenly have to mock away a http service and deal with zip files in your test cases.

The http util of your programming language will most likely work. Your unzip library will most likely work. So just assume it working. There are valid use cases where you want to make sure you acutally send a request and get a response, yet I am talking unit test here only.

In the scope of a class, keep the public methods to a reasonable minimum. As for each public method you shall at least create one test case. If you ever have the feeling "I want to test that private method" replace that statement in your head with: "I should extract that functionality to a new class where that method public. I then can create a unit test case a for that." That new service then becomes a dependency in your current service. Problem solved.

Also, mocking away dependencies should a simple process. If your mocking process fills half the screen, your test setup is overly complicated and your class is doing too much.

That's why I currently dig functional programming so much. When you build pure functions without side effects, unit tests are easy to write. Yet you can apply pure functions to OOP as well (to a degree). Embrace immutability.

Sidenote:

It's really not helpful that a lot of developers don't understand the difference between unit, functional acceptance, integration testing. Then they wonder why they can't test something easily, write overly complex test cases, until someone points out to them: No, in the scope of unit tests, we don't need to test our persistance layer. We just assume that it works. We should only test our businsess logic. You know: "Assuming that I get that response from the database, I expect that to happen." You don't need a test db, make a real query against that, in order to test that. (That still is a valid thing to do. Yet not in the scope of unit tests.)

Step 1: Run to the store to buy a USB card reader because all of a sudden you have a need to use a 16Mb CF card that was tossed in a junk drawer for 20 years (hoping it still works, of course), but that was the easy part...

Step 2: Realize that the apps - your own - you want to run on your new (old) Casio E-125 PocketPC (to re-live "glory" days) are compiled in ARM format, not MIPS, which is the CPU this device uses, and the installer packages you have FOR YOUR OWN APPS don't include MIPS, only ARM (WHY DID I DO THAT?!), so, the saga REALLY begins...

Step 3: Get a 20-year old OS to install in a Hyper-V VM... find out that basic things like networking don't work by default because the OS is so damn old, so spend hours solving that and other issues to get it to basically run well enough to...

Step 4: Get that OS updated so that it's at least kind/sorta/maybe (but between you and me, not really!) safe online, all without a browser that will work on ANY modern site (oh, and good luck finding a version of Firefox that runs on it - that all took a few hours)...

Step 5: Okay, OS is ready to go, now get 20-year old dev tools that you haven't even seen in that many years working. Oh, do this with a missing CD key and ISO's that weren't archived in a format that's usable today, plus a bunch of missing dependencies because the OS is, again, SO old (a few MORE hours)...

Step 6: Get 20-year old code written in a language you haven't used in probably almost that long to compile, dealing with pathing issues, missing libs, and several other issues, all the while trying to dust off long-dormant knowledge somewhere in the deep, dark recesses of your brain... surprisingly, it all came back to me, more or less, in under an hour, which lead to...

Step 7: FINALLY get it all to work, FINALLY get the code to compile, FINALLY get it transferred to the device (which has no network capabilities, by the way, which is where the card reader and CF card came into play) and re-live the glory of your old, crappy PocketPC apps and games running on the real thing! WOO-HOO!

Step 8: Realize it's 3:30am by the time that's all done and be VERY thankful that you're on vacation this week or work tomorrow would SSUUCCKK!!!!

Step 9. Get called into work the next day for a production issue despite being tired from the night before and an afternoon of errands, lose basically a whole day of vacation (7 hours spent on it) and not actually resolve it by after midnight when you finally say that's enough :(

Talk about your highs and your lows.

Boss: this is different from the old console I don't like it

Me: but this has been approved by product management and the team already made estimates and committed to the feature

Boss: Well this needs to change, our existing users will not like it

Me: This is far from agile to be honest, and the change came from user feedback analysis

Boss: You are not doing your work *swears and curses* this is against the team direction!

Me: then why was this committed on this sprint? All I did was facilitate the needs of the team to proceed development.

Boss: *runs out office and starts calling other bosses to boss around*

Runs in 5 minutes later, saying we are not allowed to destroy a feature with enhancements like this.

Me: *Infinite facepalm*

Backstory: Offering manager brings a project through a few months of requirements gathering / feasibility study etc. Project spends 8 months with a R&D team to flesh out. Our team gets 6 months to turn it into a ship able product. 4 months in, offering manager calls a meeting.

OM: ok so you are all working on project X, well I need your input on something

Team: Ok, go ahead

OM: what do you think the app needs to do?

Team: ... I'm sorry?

OM: well we've been looking at it, and we don't think it does very much compared to existing apps. We need a killer feature but we don't know what. Any ideas?

Team: well we were looking at project Y originally, which was a lot more advanced. But you pulled the plug in favour of this.

OM: yeah, believe me customers will want project X a lot more. It just needs to do something interesting ... you know what I mean?

Team: not really, if it doesn't have anything, why did we go for it?

OM: ok I don't think I'm being clear. Point is, if anyone has any ideas let me know, we need to ship it in 2 months and it needs to be killer

I handed in my notice that week and was asked why ... let's just say I told them.

My first job was actually nontechnical - I was 18 years old and sold premium office furniture for a small store in Munich.
I did code in my free time though (PHP/JS mostly, had a litte browsergame back then - those were the days), so when my boss approached me and asked me whether I liked to take over a coding project, I agreed to the idea.

Little did I know at the time: I was supposed to work with a web agency the boss had contracted to build their online shop. Only that he had no plan or anything, he basically told them "build me an online shop like abc(a major competitor of ours at the time)"

He employed another sales lady who was supposed to manage the shop (that didn't exist yet). In the end, I think 80% of her job was to keep me from killing my boss.

As you can imagine, with this huuuuge amout of planning and these exact visions of what was supposed to be, things went south fast and far. So far that I could visit my fellow flightless birds down in the Penguin's republic of Antarctica and still need to go further.

Well... When my boss started suing the web agency, I was... ahem, asked to take over. Dumb as I was, I did - I was a PHP kid and thought that Magento, being written in PHP, would be easy to master. If you know Magento, you know that was maybe the wrongest thing I ever said.

Fast forward 3 very exhausting months, the thing was online. Not all of it worked yet, but it was online and fairly secure.

I did next to everything myself, administrating the CentOS box the shop was running on, its (own) e-mail server, the web server, all the coding required for the shop (can you spell 12 hour day for 8 hour pay?)

3 further months later, my life basically was a wreck, I dragged myself to work, the only thing I looked forward being the motorcycle ride home. The system worked though.

Mind you, I was still, at the time, working with three major customers, doing deskside support and some admin (Win Server 2008R2 at the time) - because, to quote my boss, "We could not afford a full time developer and we don't need one".

I think i stopped coding in my free time, the one hobby I used to love more than anything on the world, somewhere Decemerish 2012. I dropped out of the open source projects I was in, quit working on my browser game and let everything slide.

I didn't even care to renew the domains and servers for it, I just let it die without notice.

The little free time I had, I spent playing video games and getting drunk/high.

December 2013, 1.5 years on the job, I reached my breaking point and just left, called in sick at least a week per month because I just could not see this fucking place anymore.

I looked for another job outside of ALL of what I did before. No more Magento, no more sales, no more PHP. I didn't have to look for long, despite what I thought of my skills.

In February 2014, I told my boss that I quit. It was still seven months until my new job started, but I wanted him to know early so we could migrate and find a replacement.

The search for said replacement started in June 2014. I had considerably less work in the months before, looks like he got the hint.

In August 2014, my replacement arrived and I got him started.

I found a job, which I am still in, and still happy about after almost half a decade, at a local, medium sized ISP as a software dev and IT security guy. Got a proper training with a certificate and everything now.

My replacement lasted two months, he was external and never really did his job - the site, which until I had quit, had a total of 3 days downtime for 3 YEARS (they were the hoster's fault, not mine), was down for an entire month and he could not even tell why.

HIS followup was kicked after taking two weeks to familiarize himself with the project. Well, I think that two weeks is not even barely enough to familiarize yourself with nearly three years of work, but my boss gave him two days.

In 2016, the shop was replaced with another one. Different shop system, different OS, different CI. I don't know why and I can't say I give a damn.

Almost all the people that worked at the company back with me have left for greener pastures, taking their customers (and revenue) with them.

As for my boss' comments, instructions and lines: THAT might not be safe for work. Or kids. Or humans in general. And there wouldn't be much left if you put it through a language filter...

Moral of the story: No, it's not a bad thing to leave a place if you're mistreated there. Don't mistake loyalty with stupidity!

And, to quote one of my favourite Bands: "Nothing matters when the pain is all but gone" (Tragedy + Time by Rise Against).

Me : *trying to download latest version of android studio*
Google: "Your client does not have permission to get URL /studio/index.html from this server. That’s all we know."
Me: FUCK YOU GOOGLE
Me: *googles: دانلود اندروید استودیو* (which means download android studio)
*and downloads it from a random website*

It happens every goddamn time, why the fuck i can't download this shit !? Because these countries are fighting each other all the time! What did i do wrong in my life? I just want to download your fucking app to write another shitty app to continue my fucking life. I don't know shit about this wars happening, I'm just a dev like others all over the world.
Downloading an app, is that too much to ask? Well fuck you then.

Well, for starters there was a cron to restart the webserver every morning.

The product was 10+ years old and written in PHP 5.3 at the time.

Another cron was running every 15 minutes, to "correct" data in the DB. Just regular data, not from an import or something.
Gotta have one of those self-healing systems I guess.

Yet another cron (there where lots) did run everyday from 02:00 to 4ish to generate the newest xlsx report. Almost took out the entire thing every time. MySQL 100%. CPU? Yes. RAM? You bet.

Lucky I wasn't too much involved at the time. But man, that thing was the definition of legacy.

Fun fact: every request was performed twice! First request gave the already logged-in client an unique access-token. Second request then processed the request with the (just issued) access-token; which was then discarded. Security I guess.

I don't know why it was build this way. It just was. I didn't ask. I didn't wanted to know. Some things are better left undisturbed. Just don't anger the machine. I became superstitious for a while. I think, in the end, it help a bit: It feels like communicating with an alien monster but all you have is a trumpet and chewing gum. Gentle does it.

Oh and "Sencha Extjs 3" almost gave me PTSD lol (it's an ancient JS framework). Followed by SOAPs WSDL cache. And a million other things.

DO !!!NOT!!!!! USE 'X' AND 'P' TO 'CUT AND PASTE' A LOT OF LINES ACROSS FILES IN VIM!!! HOLY SHIT I JUST PWNED MYSELF SO HARD I LOST SO MUCH CODE HOLY FUCK IT'S NOT EVEN FUNNY! WHERE DID AT ALL GO YOU ASK, WHY THE FUCKING REGISTER, OK LET'S CHECK THE REGISTER, COOL THERE IT IS, BUT WAIT, THERE'S ONLY LIKE 20% OF IT BECAUSE WE CUT A SHIT LOAD OF LINES AT ONCE, AND THE REGISTER OVERFILLED.... Ok let's calm down, doesn't Vim have a recovery option? Yes it does, but WAIT A FUCKING MINUTE, MY CHANGES ARE NOT IN THE SWAP FILE BECAUSE IT'S NOT LIKE VIM CRASHED OR ANYTHING, MY DUMB-FUCK-ASS WILLFULLY WROTE THE CHANGES WHEN I SWITCHED OVER TO THE NEW FILE, AND NOW, WELL THAT'S IT, YOU'RE DEAD KIDDO, YOU WROTE THE CHANGES TO DISK, NOTHING YOU CAN DO, AND I AM SO SCREWED I SPECIFICALLY MADE A DEVRANT ACCOUNT TO MAKE SURE NO ONE ELSE PWNS HIMSELF AS HARD AS I JUST DID HOLY FUCK

No one fucking knows how to handle/raise errors.

I feel like this is the least talked topic in all fucking programming industry. This shit needs to be tought even more than the fucking SOLID, DRY, KISS, YAGNI and other kinds of buzzwords that fancy devs love tossing left and right.

Basically everyone just does "whatever you dumb error just dont bother me". They will just log/return null/ignore the errors and be in their oblivion with bugs propagating upstream the call stack.

"Throwing errors you say? Ew, why do you want to produce more errors?". Yeah, right, just stick another log/return null/or ignore the fact that the monke calling your function with bullshit arguments.

"But bro it's so difficult and time consuming and it would never happen!" Yes, you fucker! Yes! Programming IS fucking difficult if you want reliable systems! Did you not know that!? Well now you do! Go and fucking learn it!

FUCK!11!1!!

Im so frustrated with myself . I've always been afraid of being stupid . Perhaps it was because i was always called the "less intelligent" sibling by my parents . Well i did self-learn java , c++ and android (when i was 15) and made some apps and i did get acknowledged finally but i may have not acknowledged myself . I got into college a couple years ago and i can tell you right out that its like an island filled with stupidity. The teachers , the students. The other day i caught my teacher learning how a transistor works. This is unacceptable for someone who is teaching us advanced op-amps and other circuits . Well , I did get into this college cause it was less tedious and i thought college doesn't matter cause i can self-learn . All i needed was free time . Well college totally destroyed that too and provided no facilities in the process as well . So yeah should i blame my college for my inability to do things the past couple years. I mean i don't think i've learnt a single thing all this while. This is where my frustration begins cause i dont want to blame the college , it's not going to help me and i'll probably end up in a 9 to 5 call center job at this rate . Im also very heavily frustrated with myself , it's like everything i've done so far has been a path of least effort. I have tried a few things which were all just fads like machine learning and crypto and even trading . They felt good and thats what scares me , maybe i don't have the passion and am just looking for a quick buck . This is clearly reflected in the ideas i've been having as well . Well i've never had access to proper funds but now im just trying to justify this layman emotion . I just want to learn and be passionate about learning , researching and i just want enough funds for that . But im afraid , maybe its just that i want to feel superior than my circle . I mean i still don't know why i tried learning rust and wasted even more time setting up fedora and everything around it while i already had a working debian setup and a programming language i'm kind of versed with . i wouldn't say well cause im a self learner and i feel guilty for that . I definitely know i just learnt the surface of the language . Deep down i'm just another stupid fad obsessed guy who feels better by choosing a more complex language that my colleagues look upto . Is this what i am , if so im scared and i don't know what to do . People say that you are what you are and you cant change that . If i cant change this then i dont deserve this wasteful stupid life . I don't know what i should do and it makes me cry . Maybe acknowledging this would've helped but it hasn't , I've felt better playing fortnite rather than learning some basic electronics. Im another one of those aren't I ?

TL; DR: Bringing up quantum computing is going to be the next catchall for everything and I'm already fucking sick of it.

Actual convo i had:

"You should really secure your AWS instance."

"Isnt my SSH key alone a good enough barrier?"

"There are hundreds of thousands of incidents where people either get hacked or commit it to github."

"Well i wont"

"Just start using IP/CIDR based filtering, or i will take your instance down."

"But SSH keys are going to be useless in a couple years due to QUANTUM FUCKING COMPUTING, so why wouldnt IP spoofing get even better?"

"Listen motherfucker, i may actually kill you, because today i dont have time for this. The whole point of IP-based security is that you cant look on Shodan for machines with open SSH ports. You want to talk about quantum computing??!! Lets fucking roll motherfucker. I dont think it will be in the next thousand years that we will even come close to fault-tolerant quantum computing.

And even if it did, there have been vulnerabilities in SSH before. How often do you update your instance? I can see the uptime is 395 days, so probably not fucking often! I bet you "dont have anything important anyways" on there! No stored passwords, no stored keys, no nothing, right (she absolutely did)? If you actually think I'm going to back down on this when i sit in the same room as the dude with the root keys to our account, you can kindly take your keyboard and shove it up your ass.

Christ, I bet that the reason you like quantum computing so much is because then you'll be able to get your deepfakes of miley cyrus easier you perv."

Girlfriend: How much water did you drink today?
Me: About 3 litres.
Girlfriend: How much of that is coffee?
Me: 5 cups.
Girlfriend: How can you count coffee in that?
Me: Why not?
Girlfriend: It's diuretic.
Me: Yes, but it's still water that goes through my body.
Girlfriend: You're such a smart-ass, huh?
Me: Well, yes, I am.
Girlfriend: So why are you so tired if you think you're drinking enough water? Well?
Me: Never ask a question you don't want to know the answer to.

Girlfriend slammed the door.

So no, women don't want honest men. Guys, lie, lie, lie.

And now I can look at the error message.

Dealing with other technical professionals who cannot think outside their respective boxes.

Here is an example.

A QA (who is very good at her job) said this...

Her:
“We need to get one customer who is willing to pay us a lot of money to make the features they want!”

Me:
“But you realize we are a SaaS company and that means we need lots of customers and constant growth”

Her:
“No, we need to find a customer who is willing to pay us, like a million, to make the features they want. Then we make them for that customer. Then we do that again.”

Me:
“We sell software to small businesses, none of them have a million dollars to pay us, and even if they did then why wouldn’t they build it themselves?

Her:
“Well, when I worked for my last company this is what we did...”

Me:
“So you worked for a contracting company who built software for individual companies. We are not that type of company. We are a SaaS company.”

Her:
“It’s the same thing”

Me:
~Facepalm~

As a software developer and entrepreneur it frustrates me when everyone think everything is the same.

You’ll here things like...

“All we need is to get lucky with one big hit and then we will ride that wave to success, just like Facebook or Amazon!”

Holy fucking shit balls, how stupid can you be!

FB and AZ run thousands of tests a day to see what works. They do not get “lucky”. They dark launched FB messenger with thousands of messages and then rolled it out to their internal team first, they did not get lucky!

Honestly though, I can’t blame them. Most people just want a good job that pays. They aren’t looking to challenge their assumptions.

Personally I know I will be in situations again where my pride, my assumption, my fears are realized and crushed by the market place and I do not want to live in a world of willful ignorance.

I’d rather get it right than feel good.

Damn senior guy from storage background worked for a big company, he wants to learn git and so I told him to install git from git scm portal.
Well he did and came back saying its not working. I wondered thats not possible to curiousity I when to.his desk and found he was using fucking windows xp sp3 on his laptop.

I told him can you install windows 10
Well he tried but his fucking hardware doesnt support.

Wondered seriously why on earth this guy still using windows xp

At one of my former jobs, we devs had to do all sorts of non-dev work, such as writing quotes and even contracts!

The CEO of that company had this naughty habit to contact devs directly without delegating through the CIO. Sure, if it's really urgent like when some system is down because of a bug, go ahead and disturb a dev. But interrupting coders to write some freaking quote? Come on!...

Once, that CEO asked me to stop everything I was doing to write a quote to a customer ASAP, as this was really urgent.

I spent several hours writing that quote. It had to be done right as any specifications in our quotes were used in our agreeements and were referred to in the case of any dispute. So not only were we devs and salesmen in the same time; we also needed to be lawyers.

When I was done and delivered the quote to the CEO, he told me he had no intention to take on that customer in the first place. Instead, he wrote a polite we-are-not-interested e-mail to the customer and cc:d it to me just so that I could read for myself how very sleek a businessman he was.

Me: why did I have to write that quote when you knew all along that you were not going to use it anyway?
Him: It's for your own personal development.

Another naughty habit of that same CEO is that he made "jokes" and remarks that I found inappropriate, such as "You walk like a drunken sailor".

Later, he decided to discontinue our team/product because "it isn't proftable". Well, what do you expect when devs are forced to waste half day completing pointless tasks?!

It was for the better anyway, and I was actually relieved when I left the company. I'm still thinking though, that the real reason he sacked me is that I am too honest and not the docile kind of employee that would be ideal for him. I did question some of my tasks, and worst of all: I didn't laugh at his stupid jokes.

Basically: Shoutout to my dad!

My dad's not an engineer or anything. But he likes building PCs and has a bunch of tech at home.

Well, thanks to him, I had a PC very early on, and of course, I did the typical skiddie stuff it, aka "fake batch virus haha funny" and playing Minecraft.

Well, at some point, after tinkering with mods to enhance the quality of gameplay, I found the ultimate mod: Macro / Keybind Mod.
This mod allows you to bind stuff to keybinds, such as commands or chat messages, or... Macros.

This mod has a custom macro language. (Hint: This is where the fun begins)

Another mod I used was AutoSwitch. However, that mod required a "core mod" (aka library installed in a dumb way). I thought, "why do I install 2 mods to get 1 thing? dumb", and made an ugly macro with lots of nested if-elses, which perfectly emulated AutoSwitch behavior for the Minecraft version I was on.

Yup, I basically got rid of 2 jar files in my mods folder by making my own ugly macro.

The fact that I recreated something in an obscure language, having not even coded any program before, made me grow interest into actual programming languages.

TL;DR you suck, I suck and everybody sucks, deal with it....

------------------------------------

Let me let off some steam, since I've had enough of people hating on languages "just because"

Every language has it's drawbacks and quirks, BUT they have their strengths also. Saying "I hate {language}" is just you being and ignorant prick and probably your head is so far up your ass that you look like an ass hat. With that being said, every language is either good or bad depending on the developer writing in it. Let's give you an example:

If I ware to give you a brick and ask you to put a nail in a plank, can you do it? Yes, it will be easier if you do it with a hammer, but you have a brick, so hammer is out of the question. If you hit your thumb while doing it... well... sorry, but it is not the bricks fault - it is YOU!

JavaScript, yes it has a whole lot of problems, but it works, you can do a ton of stuff and does a good job at that, it is evolving through node and typescript (and others, just a personal pref), BUT if you used js when you ware debugging that jquery (1.0) plugin written in the free time of a 13 yo, who copy pasted a bunch from SO, well, it is not js' problem - deal with it. Same goes for PHP, i've been there where you had a single `index.php` with bazillion lines of code, did a bunch of eval and it was called MVC, but it also is evolving.. thing is all languages allow you to do some dumb stuff so YOU have to be responsible to not fuck it up (which you always DO btw, we all do). Difference is PHP/JS roll with it because the assumption is that you know what you are doing, which again - newsflash - you don't.

More or less I would blame that shit on businesses which decided to go with undergrads to save money instead of investing in their product, hell, I am in a major company that does not invest that doesn't care a whole lot about dev /tech stuff and now everybody's mother is an engineer - they care about money, because investors care about money (ROI) and because clean code does not pay the bills, but money does.

If we get all of the good practices and apply them to each language every one of them has it's place, that is why there is no "The Language", even if there was, we STILL ware going to fuck it up and probably it was going to be even worse than where we are now.

Study, improve, rinse and repeat... There are SENIORS and LEADS out there that are about 25-30 and have no fucking clue about the language, because they have stuck up their heads up the ass of frameworks and refuse to take a breath of clean air and consider something different than their dogmatic framework "way" of doing things.. That is the result you are seeing. Let me give you a fresh example to illustrate where I am at atm:

Le me works with ZendFramework 2.3-2.5 (why not, which is PHP5+ running on PHP7 [fancy, eh]), and little me writes a module for said project, and tries to contain it in its own space, i.e not touching anything outside of the folder of the module so it is SELF-CONTAINED (see, practices), during 2-3-4 iterations of code review, I've had to modify 4 different modules with `if (somthing === self::SOMETHING_TYPE)` as requested by my TL, which resulted in me not covering 3 use-cases after the changes and not adding a new event (the fw is event-driven, cuz.. reasons) so I have to use a bunch of ifs in the code, to check a config value and do shit. That is the way of I am asked to do things I hate what I've done and the fact that because of CR I have lost case-coverage, a week of work and the same TL will be on my ass on monday that things are now "perfect".

The biggest things is "we care about convention and code style"... right.... That is not because of the language, not because of me, not because of the framework - it is some dude's opinion that you hate, not the language.

New stuff are better, reinventing the wheel is also good, if it wasn't you would've had a few stone circular things on your car and things ware going to be like that - we need to try and try, that is the only way we actually learn shit.

Until things change in the trade, we will be on the same boat, complaining about the same shit over and over, you and me won't be alive probably but things will not change a bit.

We live in a place where state is considered good, god objects necessary (can you believe it, I've got kudos for using the term 'God Object'... yep, let that sink in). If you really hate something, please, oh god I beg you, show me how you will do it better and I will shake your hand and buy you a beer, but until then, please keep your ass-hurt fanboy opinion to your self, no one gives a shit about what you think, we will die and the world will not notice...

Do you have a ‘Drama Queen’ on your team?
This happened last week.
DK = Drama Queen
DK: “OMG..the link to the document isn’t working! All I get is page not found. I’m supposed to update the notes for this project…and now I can’t! What the _bleep_ and I supposed to do now?!...I don’t understand how …”
This goes on for it seems 5 minutes.
Me: “Hold on...someone probably accidently mistyped the file name or something. I’m sure the document is still there.”
DK: “Well, I’ll never find it. Our intranet is a mess. I’m going to have to tell the PM that the project is delayed now and there is nothing I can do about it because our intranet is such a mess.”
Me: “Maybe, but why don’t you open up the file and see where the reference is?”
DK: “Oh, _bleep_ no…it is HTML…I don’t know anything about HTML. If the company expects me to know HTML, I’m going to have to tell the PM the project is delayed until I take all the courses on W3-Schools.”
Me: “Um…you’ve been developing as long as I have and you have a couple of blogs. You know what an anchor tag is. I don’t think you have to take all those W3 courses. It’s an anchor tag with a wrong HREF, pretty easy to find and fix”
DK: “Umm…I know *my* blog…not this intranet mess. Did you take all the courses on W3-Schools? Do you understand all the latest web html standards?”
Me: “No, but I don’t think W3 has anything to do the problem. Pretty sure I can figure it out.”
DK: “ha ha…’figuring it out’. I have to know every detail on how the intranet works. What about the javascript? Those intranet html files probably have javascript. I can’t make any changes until I know I won’t break anything. _bleep_! Now I have to learn javascript! This C# project will never get done. The PM is going to be _bleep_issed! Great..and I’ll probably have to work weekends to catch up!”
While he is ranting…I open up the html file, locate the misspelling, fix it, save it..
Me: “Hey..it’s fixed. Looks like Karl accidently added a space in the file name. No big deal.”
DK:”What!!! How did you…uh…I don’t understand…how did you know what the file name was? What if you changed something that broke the page? How did you know it was the correct file? I would not change anything unless I understood every detail. You’re gonna’ get fired.”
Me: “Well, it’s done. Move on.”

oh, it got better!

One year ago I got fed up with my daily chores at work and decided to build a robot that does them, and does them better and with higher accuracy than I could ever do (or either of my teammates). So I did it. And since it was my personal initiative, I wasn't given any spare time to work on it. So that leaves gaps between my BAU tasks and personal time after working hours.

Regardless, I spent countless hours building the thing. It's not very large, ~50k LoC, but for a single person with very little time, it's quite a project to make.

The result is a pure-Java slack-bot and a REST API that's utilized by the bot. The bot knows how to parse natural language, how to reply responses in human-friendly format and how to shout out errors in human-friendly manner. Also supports conversation contexts (e.g. asks for additional details if needed before starting some task), and some other bells and whistles. It's a pretty cool automaton with a human-friendly human-like UI.

A year goes by. Management decides that another team should take this project over. Well okay, they are the client, the code is technically theirs.

The team asks me to do the knowledge transfer. Sounds reasonable. Okay.. I'll do it. It's my baby, you are taking it over - sure, I'll teach you how to have fun with it.

Then they announce they will want to port this codebase to use an excessive, completely rudimentary framework (in this project) and hog of resources - Spring. I was startled... They have a perfectly running lightweight pure-java solution, suitable for lambdas (starts up in 0.3sec), having complete control over all the parts of the machinery. And they want to turn it into a clunky, slow monster, riddled with Reflection, limited by the framework, allowing (and often encouraging) bad coding practices.

When I asked "what problem does this codebase have that Spring is going to solve" they replied me with "none, it's just that we're more used to maintaining Spring projects"

sure... why not... My baby is too pretty and too powerful for you - make it disgusting first thing in the morning! You own it anyway..

Then I am asked to consult them on how is it best to make the port. How to destroy my perfectly isolated handlers and merge them into monstrous @Controller classes with shared contexts and stuff. So you not only want to kill my baby - you want me to advise you on how to do it best.

sure... why not...

I did what I was asked until they ran into classloader conflicts (Spring context has its own classloaders). A few months later the port is not yet complete - the Spring version does not boot up. And they accidentally mention that a demo is coming. They'll be demoing that degenerate abomination to the VP.
The port was far from ready, so they were going to use my original version. And once again they asked me "what do you think we should show in the demo?"

You took my baby. You want to mutilate it. You want me to advise on how to do that best. And now you want me to advise on "which angle would it be best to look at it".

I wasn't invited to the demo, but my colleagues were. After the demo they told me mgmt asked those devs "why are you porting it to Spring?" and they answered with "because Spring will open us lots of possibilities for maintenance and extension of this project"

That hurts.
I can take a lot. But man, that hurts.

I wonder what else have they planned for me...

So recently I did a lot of research into the internals of Computers and CPUs.
And i'd like to share a result of mine.

First of all, take some time to look at the code down below. You see two assembler codes and two command lines.

The Assembler code is designed to test how the instructions "enter" and "leave" compare to manually doing what they are shortened to.

Enter and leave create a new Stackframe: this means, that they create a new temporary stack. The stack is where local variables are put to by the compiler. On the right side, you can see how I create my own stack by using

push rbp
mov rbp, rsp
sub rsp, 0

(I won't get into details behind why that works).

Okay. Why is this even relevant?
Well: there is the assumption that enter and leave are very slow. This is due to raw numbers:
In some paper I saw ( I couldn't find the link, i'm sorry), enter was said to use up 12 CPU cycles, while the manual stacking would require 3 (push + mov + sub => 1 + 1 + 1).

When I compile an empty function, I get pretty much what you'd expect just from the raw numbers of CPU cycles.

HOWEVER, then I add the dummy code in the middle:

mov eax, 123
add eax, 123543
mov ebx, 234
div ebx

and magically - both sides have the same result.

Why????

For one thing, there is CPU prefetching. This is the CPU loading in ram before its done executing the current instruction (this is how anti-debugger code works, btw. Might make another rant on that). Then there is the fact that the CPU usually starts work on the next instruction while the current instruction is processing IFF the register currently involved isnt involved in the next instruction (that would cause a lot of synchronisation problems). Now notice, that the CPU can't do any of that when manually entering and leaving. It can only start doing the mov eax, 1234 while performing the sub rsp, 0.

----------------

NOW: notice that the code on the right didn't take any precautions like making sure that the stack is big enough. If you sub too much stack at once, the stack will be exhausted, thats what we call a stack overflow. enter implements checks for that, and emits an interrupt if there is a SO (take this with a grain of salt, I couldn't find a resource backing this up). There are another type of checks I don't fully get (stack level checks) so I'd rather not make a fool of myself by writing about them.

Because of all those reasons I think that compilers should start using enter and leave again.

========

This post showed very well that bare numbers can often mislead.